Studien zur Struktur des Bewusstseins: Teilband I Verstand und Gegenstand Texte aus dem Nachlass (1909-1927) [1. Aufl.] 9783030357870, 9783030357887

Die ersten drei Bände der vorliegenden,vier Teilbände umfassenden Edition bieten eine umfangreiche Präsentation von Huss

275 85 3MB

German Pages LXXV, 523 [597] Year 2020

Report DMCA / Copyright

DOWNLOAD FILE

Polecaj historie

Studien zur Struktur des Bewusstseins: Teilband I Verstand und Gegenstand Texte aus dem Nachlass (1909-1927) [1. Aufl.]
 9783030357870, 9783030357887

Table of contents :
Front Matter ....Pages I-LXXV
I. ZUR INTENTIONALITÄT DER OBJEKTIVATION IM URTEILEN, MEINEN UND STELLUNGNEHMEN (Edmund Husserl)....Pages 1-115
II. ZUR ANALYSE DER EXPLIKATIVEN UND PRÄDIKATIVEN SYNTHESEN UND IHRER FUNDAMENTE (Edmund Husserl)....Pages 117-310
III. ZUR ANALYSE DER STELLUNGNAHMEN IN IHREN MODI UND FUNDIERUNGEN (Edmund Husserl)....Pages 311-425
IV. ANALYSEN ZU DEN VOLLZUGSMODI DER AUFMERKSAMKEIT, ZU ERKENNTNISSTREBEN UND ERKENNTNISERWERB, ZU AUSDRUCK UND VERSTEHEN UND ZU VORGEGEBENHEIT UND AFFEKTION (Edmund Husserl)....Pages 427-468
V. TEXTE ZU LANDGREBES TYPOSKRIPT DER „STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS“ (Edmund Husserl)....Pages 469-523

Citation preview

EDMUND HUSSERL

STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS TEILBAND I VERSTAND UND GEGENSTAND TEXTE AUS DEM NACHLASS (1909-1927)

HERAUSGEGEBEN VON

ULLRICH MELLE UND

THOMAS VONGEHR

STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS TEILBAND I VERSTAND UND GEGENSTAND

HUSSERLIANA EDMUND HUSSERL GESAMMELTE WERKE

BAND XLIII/1

STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS TEILBAND I VERSTAND UND GEGENSTAND

Texte aus dem Nachlass (1909–1927)

AUF GRUND DES NACHLASSES VERÖFFENTLICHT VOM HUSSERL-ARCHIV (LEUVEN) UNTER LEITUNG VON

ULLRICH MELLE

EDMUND HUSSERL STUDIEN ZUR STRUKTUR DES BEWUSSTSEINS TEILBAND I VERSTAND UND GEGENSTAND

Texte aus dem Nachlass (1909–1927)

HERAUSGEGEBEN VON

ULLRICH MELLE UND THOMAS VONGEHR

123

Edmund Husserl† Hrsg. Ullrich Melle Husserl Archives Leuven, Belgien

Thomas Vongehr Husserl Archives Leuven, Belgien

Husserliana: Edmund Husserl – Gesammelte Werke ISBN 978-3-030-35787-0 ISBN 978-3-030-35788-7 https://doi.org/10.1007/978-3-030-35788-7

(eBook)

Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliografie; detaillierte bibliografische Daten sind im Internet über http://dnb.d-nb.de abrufbar. Springer © Springer Nature Switzerland AG 2020 Das Werk einschließlich aller seiner Teile ist urheberrechtlich geschützt. Jede Verwertung, die nicht ausdrücklich vom Urheberrechtsgesetz zugelassen ist, bedarf der vorherigen Zustimmung des Verlags. Das gilt insbesondere für Vervielfältigungen, Bearbeitungen, Übersetzungen, Mikroverfilmungen und die Einspeicherung und Verarbeitung in elektronischen Systemen. Die Wiedergabe von allgemein beschreibenden Bezeichnungen, Marken, Unternehmensnamen etc. in diesem Werk bedeutet nicht, dass diese frei durch jedermann benutzt werden dürfen. Die Berechtigung zur Benutzung unterliegt, auch ohne gesonderten Hinweis hierzu, den Regeln des Markenrechts. Die Rechte des jeweiligen Zeicheninhabers sind zu beachten. Der Verlag, die Autoren und die Herausgeber gehen davon aus, dass die Angaben und Informationen in diesem Werk zum Zeitpunkt der Veröffentlichung vollständig und korrekt sind. Weder der Verlag, noch die Autoren oder die Herausgeber übernehmen, ausdrücklich oder implizit, Gewähr für den Inhalt des Werkes, etwaige Fehler oder Äußerungen. Der Verlag bleibt im Hinblick auf geografische Zuordnungen und Gebietsbezeichnungen in veröffentlichten Karten und Institutionsadressen neutral. Springer ist ein Imprint der eingetragenen Gesellschaft Springer Nature Switzerland AG und ist ein Teil von Springer Nature. Die Anschrift der Gesellschaft ist: Gewerbestrasse 11, 6330 Cham, Switzerland

INHALT

TEILBAND I

VERSTAND UND GEGENSTAND

EINLEITUNG

. . . . . . . . . . . . . . . . . . . . . . . .

li

i zur intentionalität der objektivation im urteilen, meinen und stellungnehmen Nr. 1. Allgemeine Unterscheidungen bei allen Akten. Grundarten von Akten und Gegenständen . . . . . . . . . . . . § 1. Die Unterscheidung zwischen Intentionale, Objektionale und Apparenziale. Der gebende Akt und sein Intentionale als Erscheinung. Schlichte und höherstufige Akte . . . . . § 2. Schlichte und fundierte Akte – Gegenstände erster und höherer Stufe . . . . . . . . . . . . . . . . . . . . . . § 3. Primäre Gegenstände und sekundäre Reflexionsgegenstände. Verschiedene Arten der Reflexion: die phanseologische Reflexion auf Akte und die Reflexion auf Bedeutungen und Erscheinungen. Das reine Ich als ein reines Reflexionsobjekt . . . . . . . . . . . . . . . . . . . . . . . . § 4. Immanente und transiente (empirische) Gegenstände. Naturobjekte im primären und sekundären Sinn . . . . . . . Nr. 2. Bewusstsein-von und das objektivierende Zum-Gegenstand-Machen im Urteilen . . . . . . . . . . . . . . . . . § 1. Das Erscheinende und sein Charakter. Impressionen als Unterlage eines objektivierenden Begreifens und Beurteilens. Der Unterschied der Urteilsqualitäten . . . . . . . . . .

1

1 4

5 11

15

15

vi

inhalt teilband i § 2.

Objektivierende Setzung als Urteil im weitesten Sinn – Apophansis als Urteil im engsten Sinn. Jedes Erlebnis kann Grundlage eines apophantischen Urteilens werden . . . .

19

Beilage I. Die Urteilsbedeutung und die Bedeutung der unterliegenden Akte. Die Urteilsgeltung übergreift alle anderen Fälle von Geltung. Die Bestimmung des Bewusstseins durch die Grundarten der Bedeutungen . . . . . . . . . . . . . . . . . . . . . .

22

Beilage II. Das Urteil als ein Gebilde von eigenen Intentionen. Das Urteilen ist ein erfülltes, wenn es sich nach einem gebenden Akt richtet . . . . . . . . . . . . . . . . . . . . . . . . . . .

26

Beilage III. Das Verhältnis des vorprädikativen Vorstellens zum Denken. Identifikation im eigentlichen Sinn findet nur im Denken statt . . . . . . . . . . . . . . . . . . . . . . . . . . . .

28

Nr. 3. Eigentliches und uneigentliches Urteilen . . . . . . . . § 1. Das theoretische Meinen und sein Substrat. Leeres Denken. Das Herausmeinen aus einem leeren Akt ist Meinen und keine Vergegenwärtigung . . . . . . . . . . . . . . . § 2. Das Urteil und seine retentionale Modifikation. Festhaltung und Nachdauer der Meinung gegenüber Nachklang ohne Festhaltung. Die wiedervergegenwärtigende Rückkehr zum Festgehaltenen . . . . . . . . . . . . . . . . . . . . § 3. Die Regung eines Gedankens. Das nachlebende, abklingende Urteil als Urteilsmodifikation gegenüber dem aktuell sich vollziehenden Urteil. Das Entnehmen des Intentionalen aus einem unlebendigen Phänomen in einem Zug . . . . . § 4. Unlebendiges, passives Urteilen als eine Modifikation des lebendigen, aktiven Urteilens. Der Vollzug der Urteilssynthesis und ihr Ergebnis . . . . . . . . . . . . . . . . . Nr. 4. Thematisches und unthematisches Bewusstsein. Der Unterschied und das Verhältnis zwischen Rezeptivität und schöpferischer Spontaneität . . . . . . . . . . . . . . . . § 1. Intentionale Erlebnisse im weiteren und engeren Sinn. Akte im prägnanten Sinn als Erlebnisse, in denen ein einheitliches Sich-Richten-auf-Gegenständliches statthat. Meinende Zuwendung und ihre Modi . . . . . . . . . . . . . . .

31

31

34

36

38

42

42

inhalt teilband i § 2.

§ 3.

§ 4. § 5.

Das thematische Meinen. Thema und Gegenstand. Thematischer Inhalt und Charakter. Thematisch schlichte Objektivation und sich darauf bauende synthetische Objektivationen Das passiv aufnehmende und entnehmende Betrachten und Explizieren gegenüber dem schöpferischen Konstituieren. Sinnliche gegenüber kategorialen Gegenständen. Zweierlei gebendes Bewusstsein: sinnlich gebende und synthetisch gebende Akte . . . . . . . . . . . . . . . . . . . . . . Die Schichtung in der Sphäre der Sinnlichkeit: physische Sinnlichkeit und Gemütssinnlichkeit . . . . . . . . . . . Funktionell verflochtene Grundarten des Bewusstseins. Vordergrund- und Hintergrundbewusstsein. Jeder Akt, dem sich ein Gegenstand entnehmen lässt, bezieht sich auf diesen Gegenstand. Die zu allen Akten gehörigen modalen Unterschiede . . . . . . . . . . . . . . . . . . . . . . . .

vii

47

53 59

62

Beilage IV. Psychische Akte gegenüber psychischen Zuständen. Meinen und Objektivieren. Der Satz von der Vorstellungsgrundlage und die Frage nach einem einheitlichen Vorstellungsbegriff

66

Beilage V. Lebendigkeit und ihre Grade beim Wünschen und beim Urteilen. Lebendigkeit besagt nicht Evidenz und setzt sie nicht voraus . . . . . . . . . . . . . . . . . . . . . . . . . . .

68

Beilage VI. Notiz über Stellungnahme und ihr Moment der Aktivität einerseits und über Momente der Passivität und Aktivität in der Wahrnehmung andererseits . . . . . . . . . . . . . . . . .

70

Nr. 5. Der thematische Inhalt und seine Charaktere . . . . . . § 1. Das thematische Bewusstsein mit seinen verschiedenen Qualitäten. Der thematische Blick als Bewusstsein vom Thema und als Bezogensein auf den Gegenstand. Die Objektivierung des Charakters als Prädikat eines thematischen Inhalts § 2. Das thematische Bewusstsein als unselbständige Schicht. Stellungnahme und Thema bei den synthetischen Akten und beim Gemütsbewusstsein . . . . . . . . . . . . . . . . § 3. Das Thema der Freude. Die Scheidung von Inhalt und Charakter als eine bloße Abstraktion. Die gedankenhafte Modifikation der positionalen Charaktere. Ein mehrfacher Begriff des Themas . . . . . . . . . . . . . . . . . . . . . .

71

71

76

80

viii

inhalt teilband i § 4.

Die Möglichkeit der Verwandlung jedes Themas in ein objektivierendes Thema. Der thematische Inhalt des Wunsches. Inwieweit Gewissheit und Gewissheitsmodi bei allen Akten auftreten können. Schwierigkeiten in der doxischen Sphäre Inwieweit und in welcher Hinsicht Urteil und Gedanke ein gemeinsames Wesen haben . . . . . . . . . . . . . . . Ist die Vermutung in einem bloßen Gedanken fundiert oder stehen sich alle Qualitäten und ihre gedankenhaften Modifikationen einander gleich? . . . . . . . . . . . . . . .

90

Beilage VII. Die Beziehungen zwischen thematischem und doxischem Bewusstsein. Prädikation über den Gegenstand und seine Eigenschaften einerseits und über den Charakter der Wirklichkeit und des Wertes andererseits. Die Möglichkeit der Objektivation des Themas . . . . . . . . . . . . . . . . . . . . . . . .

95

§ 5. § 6.

83 87

Nr. 6. Das Meinen als Bewusstsein von einem Inhalt und von einer gegenständlichen Einheit . . . . . . . . . . . . . . § 1. Das Meinen und sein Gemeintes als solches. Ein auf das Gemeinte gerichtetes Hinblicken und eine darauf gegründete Denksetzung. Objektivieren niederer und höherer Stufe . . § 2. Das spezifische Meinen als Meinen von Einheit. Urteilen über die gegenständliche Einheit und Urteilen über den vergegenständlichten Inhalt. Der gemeinte Gegenstand schlechthin und der gemeinte Gegenstand im Wie . . . .

101

Nr. 7. Cogitatio und ihr Korrelat. Der zur cogitatio gehörende Ichstrahl. Das Korrelat als Vermeintheit schlechthin. Evidenz als höherstufiger Charakter von Korrelaten . . . . .

106

Beilage VIII. Der Blick des reinen Ich auf die Phänomene. Das Übergehen des Blickes vom Phänomen zu dem in ihm Erscheinenden

112

98

98

ii zur analyse der explikativen und prädikativen synthesen und ihrer fundamente Nr. 8. Die Unterschiede und Verhältnisse zwischen Explikation, beziehender Synthesis und Prädikation . . . . . . . . . . .

117

inhalt teilband i § 1.

§ 2.

§ 3.

§ 4.

§ 5.

§ 6.

§ 7.

Partialerfassungen auf dem Grund einer Gesamterfassung. Das Im-Griff-Behalten des thematischen Ganzen. Das Sondererfasste kann selbst zum Thema werden . . . . . . . Das Fungieren der Partialakte im Prozess der Kenntnisnahme. Die Bereicherung der Gesamtobjekterfassung durch die Einzelerfassungen. Die explikative Synthesis als Grundlage der Prädikation . . . . . . . . . . . . . . . . . . Der Übergang von der Explikation zur Prädikation. Die Prädikation als Wiederholung des explikativen Prozesses in geänderter Einstellung. Die prädikative Synthesis als schöpferische Erzeugung des Sachverhalts. Die Sachverhaltsreflexion . . . . . . . . . . . . . . . . . . . . . . . . . Das Verhältnis zwischen prädikativer und beziehender Synthese. Das in der Erfassung und in der Explikation waltende Absehen. Die Analogie mit dem Abzielen und Erzielen im Willensgebiet . . . . . . . . . . . . . . . . . . . . . Schlichter thematischer Akt. Unterschiede thematischer Richtung schon vor der Explikation: singuläre und plurale thematische Intentionen . . . . . . . . . . . . . . . . Der Unterschied zwischen den Explikationen, deren Explikate selbständige Themata sind, und solchen, deren Explikate nicht als für sich geltende Gegenstände gesetzt sind Die Explikation als bestimmendes Übergangsbewusstsein. In ihr ist der Sachverhalt schon vorhanden, aber noch nicht synthetisch erfasst. Explikation und beziehende Synthese stehen nicht auf gleicher Stufe. Der Unterschied zwischen Explikation von Eigenschaften und der beziehenden Synthesis von Ganzem und Teil . . . . . . . . . . . . . . .

ix

117

121

124

130

134

138

141

Beilage IX. Schlichte explikative Betrachtung gegenüber prädikativer Synthesis. Die Übergangssynthese als Grundlage der Prädikation . . . . . . . . . . . . . . . . . . . . . . . . . . . .

148

Beilage X. Die Übergangssynthesen: Das Subjekt braucht nicht der Ausgangspunkt zu sein. Die Übergangssynthesen sind noch keine prädikative Bestimmung . . . . . . . . . . . . . . . . . .

153

Beilage XI. Bloße Übergänge und ihre phänomenologischen Charaktere gegenüber den Übergangssynthesen . . . . . . . . . .

154

x

inhalt teilband i

Beilage XII. Die unterschiedliche Weise der Deckung von Eigenschaften mit dem Gegenstand und von Teilen mit dem Ganzen. Der Unterschied zwischen explizierender und beziehender Einstellung . . . . . . . . . . . . . . . . . . . . . . . . . .

155

Beilage XIII. Kenntniserweiternde gegenüber kenntniserläuternder Explikation (innerer Explikation) . . . . . . . . . . . . . .

156

Beilage XIV. Prädikative und vorprädikative Übergangssynthesen. Schlicht Abgesehenes und Abgesehenes im Übergang. Die Übergangsformen. Die Form des Bestimmbaren überhaupt gegenüber der Form des Substrats . . . . . . . . . . . . . . . . . . .

157

Beilage XV. Schlichte und beziehende thematische Betrachtung. Wie das beziehende Betrachten sich zum Bestimmen in der prädikativen Synthesis wandelt . . . . . . . . . . . . . . . . . . .

161

Nr. 9. Analysen zur Explikation . . . . . . . . . . . . . . . . § 1. Hauptexplikanden und dienende Explikanden. Die mögliche Eigengeltung der Explikate. Die Beziehung zwischen Ganzem und Teil als explikative Synthese von zwei substantivischen Objekten . . . . . . . . . . . . . . . . . . . § 2. Die Frage nach dem Fundament des Relationsbewusstseins. Die sinnlichen Einheitsformen sind keine Relationen. Der Unterschied zwischen Kontrast- und Relationsprädikaten Nr. 10. Die Weisen der Erfassung und ihrer Synthesis . . . . . § 1. Die Konstitution einer gegenständlichen Einheit vor ihrer Erfassung. Das Verhältnis zwischen der Gesamterfassung eines Gegenstandes und der Sondererfassung seiner Teile und Momente. Die Hinwendung zum Gegenstand mit und ohne Explikation . . . . . . . . . . . . . . . . . . . § 2. Thematisches Meinen und Interesse. Das Sich-Näherbringen einer Gruppe von selbständigen Objekten durch Einzelerfassung ihrer Glieder . . . . . . . . . . . . . . . . . . . § 3. Verdeutlichungsstellen als Residuen von vorherigen Partialerfassungen. Die Frage, ob sich Auffassungsartikulationen von Residuen unterscheiden lassen . . . . . . . . . . . § 4. Die Einheit der Zusammennehmung gegenüber der Einheit des Bewusstseins von kontinuierlicher Totalerfassung und schrittweisen Partialerfassungen bei der Explikation . . .

166

166

169 175

175

179

184

188

inhalt teilband i § 5.

xi

Die schöpferische Konstitution des Inbegriffs im Zusammennehmen und seine ihn zum Gegenstand machende Objektivation . . . . . . . . . . . . . . . . . . . . . . . .

194

Beilage XVI. Unterschiede der Aufmerksamkeit. Die Artikulationen der Erfassung . . . . . . . . . . . . . . . . . . . . .

195

Beilage XVII. Rezeptive Zuwendung und Zuwendung zu einer synthetischen Einheit in und mit ihrer Erzeugung . . . . . . . . .

196

Nr. 11. Die Konstitution von Sachverhalten und ihren Formen in Explikationen und darauf gründenden prädikativen Denksynthesen und Denkformungen . . . . . . . . . . . . . . § 1. Die bestimmende Prädikation als eigenschaftliche und als relative. Das absolut Adjektivische gegenüber dem relativ Adjektivischen . . . . . . . . . . . . . . . . . . . . § 2. Die Frage nach den kategorialen Grundformen von Prädikaten. Ist die Bestimmung durch Teile eine Sonderform des eigenschaftlichen Bestimmens? . . . . . . . . . . . . . § 3. Einstufige Explikation. Die schon in der bloßen Explikation auftretenden Formen gegenüber den spezifisch prädikativen Denkformungen . . . . . . . . . . . . . . . . . . . . § 4. Die Frage nach dem Unterschied und Verhältnis zwischen den beiden Sachverhaltsformen „S ist p“ und „S hat P“ . . § 5. Das der Erfassung des relationellen Sachverhalts zugrunde liegende Übergehen. Die dem Gegenstand durch den beziehenden Übergang erwachsende Bestimmung bedarf zu ihrer Erfassung keiner Explikation mehr . . . . . . . . . . . § 6. Die Erfassung innerer und relativer Merkmale. Die Vorhandenheit und Erfassbarkeit relativer Merkmale setzt ein beziehendes Übergehen voraus. Die Erfassung der Merkmale ist noch keine Erfassung des Sachverhalts. Merkmal und Teil Nr. 12. Die schöpferische Erzeugung von Sachverhalten, ihre Objektivierung und ihre Explikation . . . . . . . . . . . . . § 1. Auffassung, Sich-Aufdrängen und Richtung-auf im Erfassen § 2. Blinde und von Erfassung durchleuchtete Gegenstandsphänomene. Affektives Zuhandensein gegenüber dem Zuhandensein aus schöpferischer Spontaneität. Das Ergreifen und Explizieren der durch Synthesis konstituierten Gegenstände . . . . . . . . . . . . . . . . . . . . . . . .

199

199

202

205 209

211

213

218 218

221

xii

inhalt teilband i § 3.

§ 4.

§ 5.

Schlichtes Ergreifen und sich daran anschließende schrittweise Explikation eines Dinges bzw. eines Vorgangs gegenüber der schrittweisen Erzeugung des Sachverhalts im Urteil Der Unterschied beim Sachverhaltsbewusstsein zwischen der Zuwendung zum Thema und der Richtung auf den Gegenstand. Die Zuwendung zum Sachverhalt im Wie gegenüber der nominalisierenden Reflexion als Richtung auf den Sachverhalt schlechthin . . . . . . . . . . . . . . . . Explikation und Verdeutlichung des Sachverhalts durch Wiedererzeugung. Die doppelte Art des Sachverhaltsbewusstseins. Die beiden Arten von Originarität bei synthetischen Akten . . . . . . . . . . . . . . . . . . . . . . . .

224

227

230

Beilage XVIII. Rezeptive und produktive Objektivation. Das schlichte Erfassen eines sinnlich-rezeptiv Vorgegebenen gegenüber dem Erfassen im Erzeugen einer neuen Materie in höheren Objektivationen . . . . . . . . . . . . . . . . . . . . . .

233

Beilage XIX. Sinnliche Erscheinungen vor und in der Zuwendung. Die Spontaneität des Durchlaufens gegenüber der schöpferischen Spontaneität des Denkens. Gibt es analoge Unterschiede zwischen Zuwendung und synthetischer Erzeugung im Gemüt? . . . . .

238

Nr. 13. Zuwendung und Denken. Die Frage des Substrats . . . § 1. Die formende Spontaneität des prädikativen Meinens gegenüber dem bloßen Erscheinen und Erfassen. Das Erkennen als Erscheinungscharakter . . . . . . . . . . . . . . . § 2. Im anschaulichen Urteil „erscheint“ ein Sachverhalt. Ein Sachverhalt kann in verschiedener Weise bewusst und Gegenstand der Zuwendung sein . . . . . . . . . . . . . § 3. Die stetige Konstitution der dinglichen Einheit im Fortgang des Erscheinungsabflusses. Die dem Abfluss einer Erscheinungsreihe einwohnende Zuwendung gegenüber dem retrospektiven Blick auf die herabgesunkene Erscheinungsreihe und die durch sie konstituierte Einheit . . . . . . . . . . § 4. Beim Sachverhaltsbewusstsein gibt es keine vorgebenden Erscheinungen. Vergegenwärtigung und Vorschweben als wesensverschiedene Arten von Nicht-Ursprünglichkeit. Verworrenes Urteilen gegenüber Verworrenheit in der Wahrnehmung . . . . . . . . . . . . . . . . . . . . . . .

242

242

245

248

252

inhalt teilband i § 5.

§ 6. § 7.

§ 8.

Sinnliche gegenüber kategorialer Erfassung. Der auf das verworren Gemeinte gerichtete Blick der Zuwendung gegenüber dem im eigentlichen Urteilen lebenden Blick. Das verworrene Denken gehört in die Sphäre der Passivität . . Affektion und Funktion. Die Spontaneität der Ich-Akte als freie Akte gegenüber den eigentlichen Willensakten . . . Akzeptionen gegenüber spontanen Akten als Vernunftakten im prägnanten Sinn. Akt und Zustand – Aktivität und Passivität – Sinnlichkeit und Verstand (Vernunft). Die Konstitution der Vernunftgegenstände in spontanen Vernunftakten Objektivation im Sinn der Zuwendung, des Zuwendungssubstrats und der Subjektion. Nur intentionale (gegenstandskonstituierende) Erlebnisse als Objektivationen im prägnanten Sinn können Substrate von Zuwendungen sein . . . .

xiii

257 261

265

268

Nr. 14. Stücke, Verbindungen und Eigenschaften. Zur Lehre von der Objektivation und von den verschiedenen Bestimmungsweisen eines Gegenstandes . . . . . . . . . . . . . . . . § 1. Stücke als selbständige Teile gegenüber Verbindungen und Eigenschaften als unselbständige Momente . . . . . . . § 2. Die unterschiedliche Gegebenheit von Stücken und Eigenschaften in der Explikation. Die Verwandlung des eigenschaftlich bestimmenden in ein relationell bestimmendes Bewusstsein . . . . . . . . . . . . . . . . . . . . . . . § 3. Die relative Bestimmung eines Gegenstandes als Übergangssynthese zu einem zweiten substantivischen Gegenstand. Absolute und relative Adjektivität. Relationen als KollektivKomplexe mit Kollektiv-Prädikaten. Der Unterschied zwischen Verbindungs- und Vergleichungsrelationen. Psychische Eigenschaften und die unzerstückbare Einheit des Ich

281

Beilage XX. Eigenschaftliche gegenüber relationellen Bestimmungen: die Frage nach ihren Fundamenten, den Möglichkeiten der Nominalisierung und des Habens. Der Unterschied zwischen Verbindungs- und Vergleichungsrelationen . . . . . . . . . . . .

285

Nr. 15. Sachliche Einheiten der Verschmelzung und der Verbindung als Substrate für identifizierende und relationelle Synthesen. Zur Lehre von den Prädikationsformen. Grundlegendes zur Relationstheorie . . . . . . . . . . . . . . . .

291

272 272

276

xiv

inhalt teilband i § 1. § 2.

§ 3.

Sinnlich-sachliche Einheit der Verschmelzung, sukzessiv-zusammenhaltende Synthesis und spontane Erkenntnisakte Die universelle Funktion von Identifikation und Prädikation. Identifizierende Synthesis als Quelle neuer relationeller Prädikation . . . . . . . . . . . . . . . . . . . . . . . Grundformen der Relationen und Sachverhalte . . . . .

291

297 301

Beilage XXI. Die verschiedenen Begriffe von Relationsfundament bei den Gleichheits- und Ähnlichkeitsrelationen . . . . . . . .

307

Beilage XXII. Der Unterschied zwischen den Beziehungen der Verträglichkeit und Unverträglichkeit einerseits und denjenigen der Gleichheit und Verschiedenheit andererseits: Ersteren liegt eine gestiftete Einheit zwischen Ansatzintention und Erfüllung bzw. Enttäuschung, Letzteren eine sinnliche Einheit zugrunde . . . .

309

iii zur analyse der stellungnahmen in ihren modi und fundierungen Nr. 16. Die Verhältnisse zwischen Erscheinung, belief und Setzung im Hinblick auf die dreigliedrige Struktur des Bewusstseins . . . . . . . . . . . . . . . . . . . . . . . . . . . § 1. Setzung und Substrat. Schlichte und explikative Setzung. Die funktionelle Abhängigkeit der auf dem Grund einer Erscheinung zu vollziehenden Setzungen voneinander . . . . . . § 2. Inwiefern Unterschiede der Auffassungsform und der beliefCharaktere den Erscheinungen vor der Zuwendung angehören können . . . . . . . . . . . . . . . . . . . . . . § 3. Die funktionelle Abhängigkeit der belief-Qualitäten der Prädikation von den belief-Qualitäten der als Substrat fungierenden Apparenz. Urteilen aufgrund einer Phantasieerscheinung als Phantasie-Prädikation oder als wirkliche Aussage über das Erscheinende als solches . . . . . . . . . . . . § 4. Explikation und Exhibition. Die Scheidung der Qualifizierung im Substrat von der Qualifizierung der Meinung. Das durch das denkende Meinen erzeugte synthetische Gebilde als Erscheinung höherer Stufe mit eigener belief-Qualität kann zum Substrat neuer theoretischer Meinungen werden

311

311

314

316

320

inhalt teilband i § 5.

xv

Gemüts- und Willensakte als Substrate theoretischer Meinungen. Die Gemütserscheinungen selbst haben belief-Charakter. Die Modalitäten des belief als zu allen intentionalen Erlebnissen in gleicher Weise gehörig . . . . . . . . . . Sind emotionale und volitionale Setzungen Analoga der theoretischen Setzung? Besteht die Struktur des Bewusstseins in einer genauen Entsprechung zwischen niederem und höherem Bewusstsein in Intellekt, Gemüt und Wille? . . .

327

Beilage XXIII. Die Scheidung der Akte in Grundklassen (Regionen). Die Qualität als Grundklassencharakter. Die modalen Besonderungen der Gewissheit als zu jeder Grundklasse gehörig

330

Beilage XXIV. Zur Klärung der Begriffe Aktqualität, Aktmaterie und Setzungssubstrat . . . . . . . . . . . . . . . . . . . .

331

Beilage XXV. Meinen als Setzung und Meinen als Aufmerken. Die Frage nach dem Begriff des Urteils . . . . . . . . . . . . . .

333

Beilage XXVI. Stehen das Wünschen und Werten dem Setzen der Doxa gleich? Gibt es vor dem sich richtenden Wünschen und Werten schon ein blindes, sich nicht richtendes? Die elektive gegenüber der schöpferischen Funktion der Akte. Inwiefern haben Phänomene in der Sphäre der Vorgemeintheit Wesensgemeinschaft mit setzenden Phänomenen? . . . . . . . . . . . . . .

337

§ 6.

Nr. 17. Zuwendung und Setzung. Richtungen der Zuwendung § 1. Bloße Zuwendung zu einem Erscheinenden gegenüber der theoretischen Setzung. In den Urteilsfunktionen der Setzung erwachsen neue Erscheinungen . . . . . . . . . . . . . § 2. Lust und Unlust als Erscheinungscharaktere. Verschiedene Richtungen der Zuwendung bei einer qualifizierten Erscheinung. Jede Zuwendung als Erfassung kann zur theoretischen Setzung werden . . . . . . . . . . . . . . . . . . . . § 3. Ist jede Zuwendung eine Setzung, mit der sich ein Gegenstand als seiend konstituiert? Das schon im schlichten Zuwenden waltende Meinen mit seinen Glaubensmodi. Kann ich anders als glaubend meinen? Das Ansetzen . . . . . . Nr. 18. Die Arten und der Aufbau der Stellungnahmen . . . .

324

340

340

343

347 351

xvi

inhalt teilband i § 1. § 2.

Stellungnahmen: ihre Klassifikation und ihre Modifikationen. Die anaxiontische Modifikation . . . . . . . . . . Aktuelle gegenüber potenziellen Stellungnahmen. Das potenzielle Bewusstsein des Gewissseins des Gefallenscharakters im aktuellen Gefallen . . . . . . . . . . . . . . .

351

353

Beilage XXVII. Seinscharakter und Stellungnahme. Stellungnahmen und ihre Modi der Gewissheit. Das Korrelat jeder Stellungnahme als mögliches Objekt einer doxischen Stellungnahme . .

357

Beilage XXVIII. Die Charakterisierung jedes Erlebnisses und seines Vermeinten als seiend im inneren Bewusstsein. Jedes Bewusstsein gibt seinem Korrelat eine doxische Charakteristik. Die axiotischen Charaktere und ihre Schichten . . . . . . . . . . . . . . . .

358

Nr. 19. Gattungen und Arten, Fundierungsweisen und Modi der Stellungnahmen . . . . . . . . . . . . . . . . . . . . . § 1. Gewissheit ohne Gegenmotive gegenüber der Entscheidung für eine Seite im Streit von einander hemmenden Intentionen . . . . . . . . . . . . . . . . . . . . . . . . . § 2. Stellungnahme in der Weise der Vermutung. Gewisse gegenüber gehemmter Vermutungsentscheidung. Gewissheit und Ungewissheit als zu jeder Stellungnahme gehörende Modi § 3. Fundierte Stellungnahmen, die aus der Verbindung von Stellungnahmen und Gegenstellungnahmen erwachsen: Ansetzung und Gegenansetzung, Entscheidung für und gegen, Zweifel . . . . . . . . . . . . . . . . . . . . . . . .

367

Beilage XXIX. Das Ins-Wanken-Geraten und Überwogenwerden einer Anmutung durch das Auftauchen neuer Motive. Die Entscheidung für das Für-anmutlicher-Vermeinte. Stellungnahme ohne Entscheidung. Der potenzielle belief und seine Aktualisierung . . . . . . . . . . . . . . . . . . . . . . . . . . . .

371

Beilage XXX. Stellungnahme im prägnanten Sinn als Entscheidung . . . . . . . . . . . . . . . . . . . . . . . . . . .

372

Beilage XXXI. Einschichtigkeit und Mehrschichtigkeit von Akten in Korrelation zur einfachen und mehrfachen axiologischen Charakterisierung des intentionalen Gegenstandes . . . . . . . . . .

373

362

362

365

inhalt teilband i Nr. 20. Bloße Vorstellung (bloße Attention) und Stellungnahme . . . . . . . . . . . . . . . . . . . . . . . . . . . § 1. Das Zustandekommen der bloßen Vorstellung als bloßer Attention durch den Nicht-Vollzug der Stellungnahme . . § 2. Die zu jedem intentionalen Erlebnis gehörenden Möglichkeiten der Reflexion auf das in einem intentionalen Erlebnis Vermeinte. Bloße Vorstellung vom Aktsubstrat und seiner Charakterisierung durch die Ausschaltung des Glaubens der Reflexion . . . . . . . . . . . . . . . . . . . . . . . § 3. Zum Substratbewusstsein gehört notwendig und unmittelbar eine vollzogene oder unvollzogene doxische Stellungnahme. Die fundierten Stellungnahmen. Der Aufbau des Substratbewusstseins . . . . . . . . . . . . . . . . . . . . .

xvii

375 375

379

382

Beilage XXXII. Die Beschreibung der Erscheinung unter Absehung von Sein und Nichtsein der erscheinenden Gegenstände. Phantasieurteile mit Phantasie-Stellungnahmen gegenüber Urteilen über das Phantasierte als solches. Fingierte Objekte getrennter Phantasien erhalten ihre Einheit durch die Quasi-Setzungen der Phantasie-Stellungnahmen . . . . . . . . . . . . . . . . . . . .

385

Beilage XXXIII. Das Urteilen aufgrund bloßer Vorstellung als Beschreibung des Erscheinungsgehalts ohne Setzung des Seins des Vorgestellten gegenüber dem vollen, seinssetzenden Urteilen . .

393

Beilage XXXIV. Das Sich-Richten der Aufmerksamkeit ist kein Akt höherer Stufe. Zu jedem Akt wesentlich gehörend: die Substratkomponente und die Komponente der Stellungnahme . . . . .

399

Beilage XXXV. Die Modi des Vollzugs und Nichtvollzugs. In jedem Akt kann sich ein kenntnisnehmendes doxisches Stellungnehmen etablieren. Die doppeldeutige Rede von Inaktualität . . . . . .

400

Beilage XXXVI. Die Unterscheidung zwischen vollzogenen und nicht vollzogenen stellungnehmenden Erlebnissen. Sind alle nichtstellungnehmenden Erlebnisse sinnliche Substrate? Kein Verstand ohne Sinnlichkeit. Die sich auf die sinnlichen Akte gründenden synthetischen Akte gegenüber den spezifischen Verstandesfunktionen . . . . . . . . . . . . . . . . . . . . . . . . . . .

404

xviii

inhalt teilband i

Nr. 21. Das bloße Sich-Denken als bloße Betrachtung gegenüber dem stellungnehmenden Bewusstsein . . . . . . . . . § 1. Das bloße Sich-Denken als aufmerksame Zuwendung auf das Substrat ohne Vollzug einer Stellungnahme. Die Konstitution neuer Gegenständlichkeiten durch die Stellungnahme § 2. Die stellungnehmende oder die bloß vorstellende Konstitution eines Sachverhalts in der Reflexion auf einen stellungnehmenden Akt: die durch das axiontische Prädikat charakterisierte Substratgegenständlichkeit. Die Versuchung, jedem Akt eine Vorstellung unterzulegen . . . . . . . . . Nr. 22. Stellungnahme und Aufmerksamkeit. Positionalität, Interesselosigkeit für Sein oder Nichtsein und Neutralität . . § 1. Im schlichten Wahrnehmen und Urteilen besteht keine Unterscheidung zwischen Inhalt und Seinscharakter. Das Aufmerken auf den Inhalt als Modifikation des schlichten Aktes. Die Abwandlung von vollzogenen Thesen in Quasi-Thesen § 2. Das Sich-Enthalten und erneut Vollziehen einer Seinssetzung. Die Irrelevanz der Geltung für das ästhetische Interesse. Das Bewusstsein der Position gegenüber dem Bewusstsein der Neutralität . . . . . . . . . . . . . . . . . . § 3. Der Unterschied zwischen der Phantasieeinstellung und der ästhetischen Einstellung. In der ästhetischen Einstellung setzt das wache Ich das Fiktum im Wie seiner Erscheinungsweisen . . . . . . . . . . . . . . . . . . . . . . . .

407

407

411

415

415

419

422

iv analysen zu den vollzugsmodi der aufmerksamkeit, zu erkenntnisstreben und erkenntniserwerb, zu ausdruck und verstehen und zu vorgegebenheit und affektion Nr. 23. Vorstellung als Grundlage für ein aufmerkendes und stellungnehmendes Gerichtetsein. Der universale Modus der Hintergründlichkeit . . . . . . . . . . . . . . . . . . .

427

inhalt teilband i

xix

Beilage XXXVII. Der Anfang der intentionalen Analyse: die Typik des wachen menschlichen Lebens. Unterscheidungen innerhalb der allgemeinen Form des spontanen Ichlebens . . . . . . . .

433

Beilage XXXVIII. Die Gradualität der Hingabe in der Aufmerksamkeit. Die Einigkeit des Ich in der Einheit des Interesses . . . .

435

Nr. 24. Urteilende Bestimmung, Kenntniserwerb und Kenntnisfixierung . . . . . . . . . . . . . . . . . . . . . . . . . § 1. Objektivierende und wertende Akte und (aktive) Urteilsakte . . . . . . . . . . . . . . . . . . . . . . . . . § 2. Das Begreifen des Gegenstandes in Kenntnis stiftenden Urteilen. Erkenntniserweiterung und Erkenntniserläuterung gegenüber dem bloß analytischen Urteilen . . . . . . . . § 3. Das theoretische Interesse . . . . . . . . . . . . . . . § 4. Urteilen und aussagendes Behaupten . . . . . . . . . .

438 440 441

Beilage XXXIX. Das Absehen auf bleibendes Wissen. Das Im-GriffBehalten als Willensgriff. Höherstufiges Begreifen und allgemeines Erkennen vermöge der Wissensfixierung . . . . . . . . .

443

Nr. 25. Aussagen und Verstehen . . . . . . . . . . . . . . . § 1. Die uneigentliche Rede und das passive Verstehen. Das Quasi-Mitmeinen im Verstehen der Meinung des Anderen im Lesen und Hören . . . . . . . . . . . . . . . . . . § 2. Das aussagende Meinen. Alles Sprechen will durch den Sprachleib hindurch in der Bedeutung terminieren. Zum Ausdruck kommt nur thematisch gemeinter Sinn . . . . . Beilage XL. Subjektive Ausdrücke von Gemütsphänomenen (Gemütsinhalten). Ausströmungen des Ich im Gemütsverhalten . . Nr. 26. Zur Phänomenologie der Vorgegebenheit und der Affektion . . . . . . . . . . . . . . . . . . . . . . . . . . . . § 1. Affektion als eine auf das Ich hingehende Tendenz auf thematischen Vollzug. Inwiefern das Hintergrunderleben eine Vergegenwärtigung ist. Hemmungen der Gewissheit im Vollzug thematischer Aktion und die neue Affektion und Tendenz auf Herstellung der Gewissheit . . . . . . . . . . .

437 437

445

445

447

452

454

454

xx

inhalt teilband i § 2.

Die mit einem Einfall verbundene Aufforderung zu seinem thematischen Vollzug. Übernahme und Miturteilen gegenüber Enthaltung. Epoché als allgemeine Abwandlung von thematischen Akten . . . . . . . . . . . . . . . . . . Die Struktur des Reiches der Vorgegebenheiten: das Reich der einstimmigen Erfahrungsfortgeltung, das Reich der Einfälle und das Reich der Zumutungen von anderen . . . .

463

Beilage XLI. Der intentionale Erwerb als eine Vorgegebenheit und die Intention auf Wiedererzeugung. Die in der Vergegenwärtigung liegende Zumutung, den reproduktiven Glauben mitzuvollziehen. Die Hemmung der Intention auf Mitglauben . . . . . . . . .

466

Beilage XLII. Das Fragen als Urteilsstreben. Die das Fragen fundierende Glaubensmodalität. Die Neutralitätsmodifikation . . . .

468

§ 3.

459

v texte zu landgrebes typoskript der „studien zur struktur des bewusstseins“ Nr. 27. Gedankengang der Einleitung und der I. „Studie“ . . . § 1. Zur Einführung. Sinn und Möglichkeit einer reinen Psychologie . . . . . . . . . . . . . . . . . . . . . . . . . § 2. Die Brentano’schen Grundbegriffe als Ausgangspunkt. Kennzeichnung ihrer hauptsächlichen Unklarheiten und der sich daran knüpfenden Fragen . . . . . . . . . . . . . § 3. Die Strukturen der auf einen „Inhalt“ bezogenen Intentionalität als Thema. Frage nach der Wesenstypik des mannigfaltigen Bewusstseins als Bewusstsein vom Selben . . . . § 4. Das zeitliche Sein der Erlebnisse. Reelle und irreelle Eigenheiten . . . . . . . . . . . . . . . . . . . . . . . . § 5. Die Probleme der Richtung-auf. Waches Ich und Hintergrund . . . . . . . . . . . . . . . . . . . . . . . . § 6. Akt, Aufmerksamkeit, Stellungnahme . . . . . . . . . . Beilage XLIII. Die unvermeidliche Naivität des Verfahrens der anfangenden Wissenschaft vom Bewusstsein. Als positive Wissenschaft soll die Psychologie erkenntnistheoretische Bedenken hinsichtlich der Möglichkeit einer Bewusstseinswissenschaft auf sich beruhen lassen . . . . . . . . . . . . . . . . . . . . . . .

469 469

474

475 477 481 484

488

inhalt teilband i

xxi

Beilage XLIV. Zum Problem der Klassifikation der intentionalen Erlebnisse . . . . . . . . . . . . . . . . . . . . . . . . . .

491

Beilage XLV. Die Unterordnung der reellen Analyse der Erlebnisse unter die Analyse ihrer Sinn leistenden Funktionen im Leben eines Ich . . . . . . . . . . . . . . . . . . . . . . . . . . . .

493

Beilage XLVI. Zum Anfang und zum allgemeinsten Begriff der intentionalen Erlebnisse. Die Einklammerung jeden Dafürhaltens und die Verwandlung aller uns geltenden Gegenständlichkeiten in Phänomene . . . . . . . . . . . . . . . . . . . . . . . .

495

Beilage XLVII. Fragen zur Intentionalität im Ausgang von Brentanos Bestimmungen und sich an die Synthesis knüpfende Fragen

497

Beilage XLVIII. Allgemeinste Wesenseigenheiten eines intentionalen Erlebnisses . . . . . . . . . . . . . . . . . . . . . . .

498

Beilage XLIX. Kontinuierliche Explikation und Bestimmung eines Substrats. Die sich am Substrat niederschlagende Kenntnis. Die Enthüllung des schon Bekannten als Reaktivierung schon gestifteter Geltung . . . . . . . . . . . . . . . . . . . . . . .

501

Beilage L. Bewusstsein als intentionales Erlebnis im Verhältnis zum „Meinen“ . . . . . . . . . . . . . . . . . . . . . . . . .

502

Beilage LI. Zu der Interpretation der thetischen Modalitäten . . .

504

Beilage LII. Das primäre und sekundäre Dabeisein (patentes Bewussthaben) gegenüber Wahrnehmungserlebnissen, in denen das Ich in keiner Weise dabei ist (latentes Bewussthaben) . . . . .

505

Beilage LIII. Passive und aktive Konstitution. Die aufmerkende Zuwendung als niederste Stufe der Spontaneität. Rezeptivität und Sinnlichkeit. Das Festhalten im Modus der Spontaneität gegenüber der passiven Retention . . . . . . . . . . . . . . . . .

507

Beilage LIV. Die merkwürdige Rückwirkung in der Dingwahrnehmung der impressionalen Erscheinung auf die retentionalen Erscheinungen . . . . . . . . . . . . . . . . . . . . . . . .

508

xxii

inhalt teilband i

Nr. 28. Disposition der I. Studie (zugleich als Leitfaden für die Umarbeitung) von Ludwig Landgrebe, mit Annotationen und Korrekturen von Edmund Husserl . . . . . . . . . . . . . § 1. Einleitung . . . . . . . . . . . . . . . . . . . . . . § 2. Erste vorläufige Aufweisung der zu klärenden Phänomene § 3. Anknüpfung an die traditionelle Scheidung von Vorstellung und Stellungnahme. – Fixierung des echten Begriffs der Stellungnahme als Spontaneität und Aufklärung der Problematik des „bloßen Betrachtens“ . . . . . . . . . . . . . . § 4. Thema als Korrelat der Stellungnahme. Zwei Begriffe von Thema . . . . . . . . . . . . . . . . . . . . . . . . § 5. Spontaneität als Vordergrundbewusstsein und ihr Verhältnis zum Hintergrund . . . . . . . . . . . . . . . . . . . § 6. Rezeptivität als Unterstufe der Spontaneität . . . . . . . § 7. Die schöpferische Spontaneität und die Unterscheidung von „Sinnlichkeit und Verstand“ . . . . . . . . . . . . . .

512 512 512

513 517 518 520 521

TEILBAND II

GEFÜHL UND WERT

i werten und wert. zur wertlehre § 1. § 2.

Sachbestimmtheiten und Wertbestimmtheiten . . . . . . Empirische Apperzeption und Gemütsapperzeption. Stehen Glauben und Gefallen auf einer Stufe? . . . . . . . . . Wollen ist keine Wertapperzeption. Die Bewertbarkeit des Wollens . . . . . . . . . . . . . . . . . . . . . . . Gemütsmotivation im Unterschied zur empirisch-assoziativen Motivation . . . . . . . . . . . . . . . . . . . . Werten als im Wahrnehmen fundierter Akt. Erfüllung der Wertmeinung. Unmittelbare und mittelbare Werte . . . . Empfinden und apperzeptive Objektivation in Akten des Wahrnehmens und Gefallens . . . . . . . . . . . . . . Das Verhältnis von Freude, Wunsch und Wollen zum Werten. Die Fundierung des Wollens im Wünschen . . . . . . . .

40

Beilage I. Die Fundierung der Gemütsakte als Gemütsapperzeption und Gemütsmeinung . . . . . . . . . . . . . . . . . . . .

47

Beilage II. Gibt es spontane Gemütsakte als eine von den theoretisch bestimmenden Denkakten unterschiedene Klasse von Vernunftakten? . . . . . . . . . . . . . . . . . . . . . . . . . . .

49

Beilage III. Das sinnliche Gefühl als immanente Zeiteinheit ist kein auf den Empfindungsinhalt bezogener Akt . . . . . . . . . .

50

§ 3. § 4. § 5. § 6. § 7.

1 3 11 13 22 32

xxiv

inhalt teilband ii

ii die von gegenständen ausgehende erregung von gefühlen gegenüber der auf die gegenstände hinzielenden wertung. die frage nach dem gefühlscharakter des wertens § 1.

§ 2.

§ 3.

§ 4.

Die Intensitätsunterschiede im affizierten Gefühl und im Gefühlslicht gegenüber den Unterschieden des Wertes. Die Erregung von Gefühlsakten durch wertcharakterisierte Objekte . . . . . . . . . . . . . . . . . . . . . . . . . Sinnliche Gefühle als Gefühle, deren Erregung kein Werten des Objekts zugrunde liegt. Ist das Werten ein erregtes Fühlen? . . . . . . . . . . . . . . . . . . . . . . . Die Verschmelzung des Empfindungsgefühls mit dem Empfindungsinhalt. Der Gefühlston. Die Unterscheidung zwischen der Geschmackslust und der dadurch motivierten Freude am Haben der Geschmackslust. Der Übergang der Freude in die frohe Stimmung . . . . . . . . . . . . . Das Schwelgen in der Phantasie – die Freude an wissenschaftlicher Forschung: Erlebnislust als Voraussetzung der Freude als wertendes Gefallen. Das wertende Gefallen als Gefühlsapprehension . . . . . . . . . . . . . . . . .

Beilage IV. Empfindungsgefühl und Gegenstandsgefühl

. . . . .

53

57

59

66 70

iii die analogie zwischen denkakten und axiologischen akten. rezeptivität und spontaneität bei der konstitution von seins- und wertobjektivitäten § 1. § 2. § 3.

§ 4.

Affektion, Auffassung, Zuwendung und schöpferischer Verstandesakt . . . . . . . . . . . . . . . . . . . . . . Theoretische Zuwendung und Gemütszuwendung . . . . Zuwendung als Modus der Lebendigkeit, Erfassung und Denksetzung. Die Konstitution empirischer und axiologischer Abhängigkeiten . . . . . . . . . . . . . . . . . Gefühlssinnlichkeit und Intentionalität . . . . . . . . .

73 85

87 92

inhalt teilband ii

xxv

iv die arten der gemütsintentionalität § 1.

§ 2. § 3. § 4.

Ding- und Wertapperzeption. Gefühls-, Begehrungs- und Willenseigenschaften als objektive, apperzipierte Eigenschaften . . . . . . . . . . . . . . . . . . . . . . . Wertapperzeption und Gefühlsapperzeption. Die Frage nach der Intentionalität der Stimmung . . . . . . . . . . . . Das Begehren des Schlechten. Objektiver Wert und hedonischer Wert . . . . . . . . . . . . . . . . . . . . . . Die Intentionalität des Gefühlsaffekts. Gefühlsausbreitung und miterregte Gefühle. Objektive und übertragene Gefühle

Beilage V. Die Unterscheidung zwischen Affekten und ihren Ausstrahlungen einerseits und der größeren oder geringeren Lebendigkeit und Hingabe bei den Gemütsakten andererseits . . . .

97 101 105 108

115

v die konstitution der gemütscharaktere § 1. § 2. § 3.

§ 4. § 5. § 6. § 7.

Freude aufgrund von Anschauungen und aufgrund von Urteilen . . . . . . . . . . . . . . . . . . . . . . . . . Schlichte Wertapperzeption und Stellungnahmen des Gemüts . . . . . . . . . . . . . . . . . . . . . . . . . Gefühlszuwendung und Erregungsstrom. Die Gegebenheit der Gemütscharaktere im Gemütsakt und in der setzenden Erfassung . . . . . . . . . . . . . . . . . . . . . . . Gemütscharaktere als ontische Charaktere . . . . . . . . Subjektive Richtung-auf und Stellungnahme bei den Erscheinungen und bei den Gemütscharakteren . . . . . . Empirische Apperzeption und Wertapperzeption . . . . . Die Empfindungsunterlage der Sondergefühle und der Einheitsform der Gefühle . . . . . . . . . . . . . . . . .

117 118

121 131 134 136 141

xxvi

inhalt teilband ii

vi gefühlsbewusstsein – bewusstsein von gefühlen. gefühl als akt und als zustand § 1.

§ 2. § 3. § 4. § 5. § 6.

Über die Beobachtung von Gefühlen. Lektüre von und Kommentar zu Moritz Geigers Abhandlung in der Lipps-Festschrift . . . . . . . . . . . . . . . . . . . . . . . . Meinendes Vorstellen und meinendes Fühlen . . . . . . Thema, Aufmerksamkeit und Interesse in der Sphäre der Vorstellungen und Gemütsakte . . . . . . . . . . . . . Gefallen als Akt und der Affekt der Freude als Zustand . . Sinnliche Lust, Genuss, Stimmung und intentionale Wertgefühle . . . . . . . . . . . . . . . . . . . . . . . . . Unterschiede und Zusammenhang zwischen Wertbewusstsein und intentionalem Freudegefühl . . . . . . . . . .

143 150 157 165 171 177

Beilage VI. Wertbewusstsein und Genuss . . . . . . . . . . . .

183

Beilage VII. Das Sich-Aufdrängen eines Objekts als Reiz zur Zuwendung . . . . . . . . . . . . . . . . . . . . . . . . . .

188

vii passivität und aktivität in intellekt und gemüt § 1. § 2.

Das aktive Wahrnehmen . . . . . . . . . . . . . . . . Urdoxa und Modalisierung. Die Ichbeteiligung bei der Modalisierung . . . . . . . . . . . . . . . . . . . . . . Latente Intentionalität, das Wachwerden des Ich und die Leistung des aktiven Ich . . . . . . . . . . . . . . . . Passive Lust und aktives Gefallen. Lust als Gegenstand und Lust als Wert. Die Aktrichtungen der Intellektion und Emotion . . . . . . . . . . . . . . . . . . . . . . . . . Der Bewusstseinsstrom ist durch und durch Objektivation und Synthesis. Die konstitutive Funktion der Lust . . . .

191

Beilage VIII. Objektivation und wertendes Gefühl . . . . . . . .

210

§ 3. § 4.

§ 5.

193 198

203 207

inhalt teilband ii

xxvii

Beilage IX. Die notwendige Vorstellungsgrundlage eines Gemütsakts. Fundierte Qualifizierungen: Sinnesstrukturen und entsprechende Aktschichtungen . . . . . . . . . . . . . . . . . .

214

Beilage X. Die in verschiedenen Stufen gegebenen Vorgegebenheiten für das Werten. Wertung in der Möglichkeit als eine Modalität des Wertens. Explikation des Wertes in den Gemütsakten . . .

216

Beilage XI. Sachliche und axiotische Affektion. Die Scheidung zwischen Empfindungsdaten und Gefühlsempfindungen in der Sphäre ursprünglicher Affektion. Wie verhalten sich sinnliche Gefühle zum Gefallen? . . . . . . . . . . . . . . . . . . . . . . .

218

Beilage XII. Sachen und Werte. Gefühlsbewusstsein als doxisches Bewusstsein von einem Wert und als Gemütsverhalten zu einem in einem doxischen Akt gegebenen Gegenstand . . . . . . . .

220

viii reine werte gegenüber praktischen werten. die frage nach der absoluten willenswahrheit § 1. § 2. § 3.

§ 4.

Reine Werte und ihre Rangordnungen. Werten als das Erleben reiner Freude . . . . . . . . . . . . . . . . . . . Begehrungswerte als existenziale Werte. Auf reine Schönheiten im rein wertenden Erschauen gerichtete Begehrungen Wertung von Wertobjekten als mögliche Begehrungsziele. Wertung des Wertgenusses. Praktische Werte als Schönheitswerte einer neuen Stufe. Die Frage nach einer von der Schönheitswertung noch zu unterscheidenden Willenswahrheit Formale Wertlehre und formale Praxis. Reine absolute Werte gegenüber individuell relativen praktischen Werten. Der universale kategorische Wille als ein praktisches Gut . . . . .

225 228

231

233

Beilage XIII. Die Willensrichtigkeit als Schönheitswert. Muss jedes Wollen auf einen Wert gehen? . . . . . . . . . . . . . . . .

237

Beilage XIV. Hat der Wille im Gerichtetsein auf das praktisch Gute seine eigene Richtigkeit? . . . . . . . . . . . . . . . . . .

238

xxviii

inhalt teilband ii . . . . . . . . . . . . . . . . . .

240

Beilage XVI. Freude als Modus des Genusses. Freude an der reinen Idee. Ideenschönheit. Auf Schönes gerichtetes Wollen und Begehren . . . . . . . . . . . . . . . . . . . . . . . . . . . .

241

Beilage XVII. Das Reich der reinen Schönheitswerte als Reich des Genusses gegenüber den absoluten Gewissenswerten. Das Vernunftgesetz der Wahl des Besten unter dem Erreichbaren gilt nur für die hedonischen Werte . . . . . . . . . . . . . . . . . .

242

Beilage XVIII. Ist jede Freude ein Für-wert-Halten und ist jedes Werten ein positives Gefühl? Ist Werten eine eigene Art der Stellungnahme? . . . . . . . . . . . . . . . . . . . . . .

245

Beilage XV. Lust und Wert

ix das gefallen am schönen und der schönheitswert § 1.

§ 2.

§ 3.

Das nicht durch einen Glauben motivierte, uninteressierte Gefallen am Schönen gegenüber dem Gefallen am Wesen als Seienden . . . . . . . . . . . . . . . . . . . . . Das Schön-Gefallen als inhaltliches Gefallen. Inwieweit ist ein Glauben Motivationsgrundlage für ein Schön-Gefallen? Das Gefallen an einem Ding wegen seiner schönen Erscheinungen . . . . . . . . . . . . . . . . . . . . . . . . Das Gefallen am Schönen als Gefallen an der Erscheinung und das Missfallen am Hässlichen als qualitativer Gegensatz. Schönheitswert als Wert der Erscheinung gegenüber Güterwert als Wert des Erscheinenden als Seiendem. Gibt es bloße Begehrungswerte? . . . . . . . . . . . . . . . . . . .

Beilage XIX. Die Selbstgegebenheit des Guten in der Freude am Dasein gegenüber der Selbstgegebenheit des Schönen in der Freude an der bloßen Erscheinung. Das Schöne, um seiner Schönheit willen begehrt, wird zum reinen Guten . . . . . . . . . . . .

247

250

253

256

inhalt teilband ii Beilage XX. Die Selbstgegebenheit eines Schönheitswertes in der Anschauung des Eigenwesens eines Gegenstandes. Die Fundierung eines Gutwertes in einer Seinsmodalität. Gegenstandswesen und Erscheinungswesen als das Reich des spezifisch Ästhetischen. Freude an der Selbsthabe eines Gegenstandes . . . . . . . . .

xxix

257

ERGÄNZENDE TEXTE

a wert und billigung Nr. 1. Billigung, Wert und Evidenz . . . . . . . . . . . . . .

261

Nr. 2. Wertnehmung und Billigung . . . . . . . . . . . . . . § 1. Die Frage nach der Konstitution und Erfassung des Wertes § 2. Durchführung der Analogie zwischen intellektiver und Gemütssphäre . . . . . . . . . . . . . . . . . . . . . . § 3. Zwei Arten von Billigungen . . . . . . . . . . . . . . § 4. Der Doppelsinn des Bewertens . . . . . . . . . . . . .

269 269 270 272 273

Nr. 3. Das wertkonstituierende Gefühl als zum Gegenstand gehörendes, in seinem Wesen gründendes Gefühl. Die Klarheit des Gefühls als Analogon der Evidenz . . . . . . . . . .

276

Nr. 4. Erfüllt sich der Wunsch in der Freude? Das doppelte Gerichtetsein des Wunsches auf Befriedigung und auf ein wahrhaft Gutes. Der Doppelsinn von Erfüllung: Auswertung und Befriedigung . . . . . . . . . . . . . . . . . . . . .

287

. . . . . . . . . . . . . .

293

Nr. 6. Ästhetische Wertung: Schönheit aufgrund des perzeptionalen Inhalts und Schönheit aufgrund der Darstellung . .

297

Nr. 7. Wertverhalte und die Objektivität der Werturteile . . .

307

Nr. 8. Billigung als sekundäres Gefühl auf Richtigkeit gehend. Doppelsinn des Billigens und Wertens . . . . . . . . . . .

313

Nr. 5. Konvenienz der Gemütsakte

xxx

inhalt teilband ii

b intellekt und gemüt. sind gemütsakte objektivierende akte? – gemütsakte und ihre beziehung auf objekte Nr. 9. Die verschiedenen Bewusstseinssphären und die allgemeinen, alle Sphären betreffenden Bewusstseinsformen . . . .

321

Nr. 10. Wunsch und Wunschverhalt. Wunschaussagen als unmittelbarer Ausdruck von Wünschen. Freude, Lust und Wünschen in ihrem Verhältnis zum Werten. Wert und Sollen . .

324

Nr. 11. Das Gefallen (Freude) als Zustand. Seine Erregung durch ein phantasiertes Objekt oder eine Tatsache. Doxische Prädikate der propositionalen Materie gegenüber Gemütsprädikaten als Prädikaten von Tatsachen . . . . . . . . . . .

330

Nr. 12. Intellektive und emotionale Akte: Unterschiede in der Art der Intentionalität und der Fundierung. Sinnengegenstände und Gefühlsgegenstände . . . . . . . . . . . . . .

332

Nr. 13. Haben Gefühlsprädikate bloß subjektive Geltung, indem die Gefühlsakte objektiviert und dem erscheinenden Gegenstand zugedeutet werden? . . . . . . . . . . . . . . . . .

339

Nr. 14. Die wesentliche Verschiedenheit zwischen Gemütsakten und objektivierenden Akten in der Weise der gegenständlichen Beziehung. Meinen als Doxa und Meinen als Hinwendung . . . . . . . . . . . . . . . . . . . . . . . . . . .

341

Nr. 15. Gefühlscharakter und Wertprädikat. Entspricht jeder Aktart eine bestimmte Charakterisierung ihrer Gegenstände?

346

Nr. 16. Seinsobjektivation und Wertobjektivation. Gehören Wertprädikate zum Wesen des Dinges? . . . . . . . . . . . . .

350

Nr. 17. Die Rede von Färbung bei Gemüts- und Wunschakten. Ist die gegenständliche Beziehung der Gemüts- und Wunschakte keine echte Objektivation? . . . . . . . . . . . . . . . . .

361

inhalt teilband ii

xxxi

Nr. 18. Die Unterschiede in der Fundierung von prädikativen Akten und von Gemütsakten . . . . . . . . . . . . . . . . .

365

Nr. 19. In welchem Sinn alle Akte eine Vorstellung zur Grundlage haben. Seinswertungen und Gemütswertungen. Nochmaliges Überdenken der Darstellung in den Logischen Untersuchungen . . . . . . . . . . . . . . . . . . . . . . . .

369

Nr. 20. Sinnliches und wertendes Bewusstsein gegenüber dem Verstand als logisches Vermögen . . . . . . . . . . . . .

378

Nr. 21. Intellekt und Gemüt. Die Unterscheidung zwischen niederen und höheren Bewusstseinsstufen. Empirische Funktion und Wertungsfunktion. Das Meinen als das eigentliche Objektivieren . . . . . . . . . . . . . . . . . . . . . . . .

380

Beilage XXI. Die Vieldeutigkeit des Begriffs Meinung . . . . . .

387

Beilage XXII. Affektion, blinde Funktion und Spontaneität in Verstand, Gemüt und Wille . . . . . . . . . . . . . . . . . .

388

Nr. 22. Resultate: Vorstellungsapperzeption und Gemütsapperzeption. Verstandesobjektivation und Gemütsobjektivation

392

c zur phänomenologie des fühlens, begehrens und wünschens Nr. 23. Einige Grundpunkte zur Lehre vom Gefühl. Empfindungslust und Gefallensapperzeption. Direktes und indirektes Gefallen . . . . . . . . . . . . . . . . . . . . . . . Nr. 24. Sachanschaulichkeit und Wertanschaulichkeit . . . . . § 1. Das Sich-Sättigen einer mittelbaren in einer unmittelbaren Lust . . . . . . . . . . . . . . . . . . . . . . . . . § 2. Die Unterscheidung zwischen urteilender Werterkenntnis und fühlendem Werthalten . . . . . . . . . . . . . . . § 3. Die Sättigungsunterschiede in der emprischen Wahrnehmung und in der Wertnehmung . . . . . . . . . . . . .

395 406 406 407 408

xxxii § 4.

inhalt teilband ii Die Bedeutung der Sättigung für das Wünschen und Begehren . . . . . . . . . . . . . . . . . . . . . . . . . .

414

Nr. 25. Willenswerte, die nicht durch bloße Gefallenswerte bestimmt sind: Der höhere Wert des Wollens des fremden Gutes

417

Nr. 26. Die Frage nach der Vorstellungsgrundlage des Wunsches . . . . . . . . . . . . . . . . . . . . . . . . . . .

419

Nr. 27. Die mit der dinglichen Apperzeption Hand in Hand gehende Gefühlsapperzeption: Es bedarf keiner von den Empfindungen unterschiedenen Gefühlsempfindungen . . . . .

420

Nr. 28. Das Genießen als Wahrnehmung des Gefallenswertes. Der Unterschied zwischen direktem und indirektem Gefallen. Mängel der Fülle in der Freude als Anlass für Wünsche

421

Nr. 29. Worin besteht der Unterschied zwischen existenzialen und nicht-existenzialen Gefühlen? . . . . . . . . . . . .

423

Nr. 30. Die Bestimmung der Gefühlsmodi durch die Modi des impressionalen Aktes . . . . . . . . . . . . . . . . . . . .

425

Nr. 31. Der Unterschied zwischen Empfindungsgefühl, Inhaltsgefühl und Gegenstandsgefühl . . . . . . . . . . . . . .

427

Nr. 32. Die Fundierung eines Gefallens in der Materie der Vorstellung. Die Bestimmung des Charakters des Gefallens und Begehrens durch die Setzungscharaktere . . . . . . . . .

433

Nr. 33. Vollkommenheitsgrade der Sättigung eines Wunsches und die der unterschiedlichen Höhe des Genusswertes entsprechenden Grade der erfüllenden Freude . . . . . . . .

436

Nr. 34. Unterschiede der Reinheit und Unreinheit der Gefühle. Der Charakter der Gefühle fundiert in den Gewissheitsmodi und den Modi der Anschaulichkeit der unterliegenden Vorstellung. Die Wesensbeziehung von Wunsch und Freude . .

439

inhalt teilband ii

xxxiii

Nr. 35. Wertsteigerung, Bevorzugung und Intensitätsunterschiede bei Lust und Unlust . . . . . . . . . . . . . . . .

443

Nr. 36. Das Gefallen des Besseren. Das Vorziehen als Gefallen zweiter Stufe. Sinnliche und ästhetische Werte . . . . . .

445

Nr. 37. Das Vorziehen als ein in Gefallensakten fundierter beziehender Akt. Ist das Vorziehen ein Gemütsakt? . . . . . .

448

Nr. 38. Eigentliche und uneigentliche Gefühle. Das Vorziehen aufgrund uneigentlicher Vorstellung und Wertung. Vorziehen im Gefallen und Wünschen. Das Problem der als richtig charakterisierten Liebe . . . . . . . . . . . . . . . . . .

449

Nr. 39. Freude an eigenem und fremdem Schmerz. Neid als Schmerz über die Freuden eines anderen . . . . . . . . . .

461

Nr. 40. Das Gefallen in der Phantasie und unter Assumtion. Das ästhetische Gefallen . . . . . . . . . . . . . . . . . . .

463

Nr. 41. Wirkliche Gemütserlebnisse in der Phantasie. Freude an der Phantasie. Phantasiewirklichkeit als Einheit der Konsequenz von Verstandes- und Gemütsapperzeptionen in der Phantasie . . . . . . . . . . . . . . . . . . . . . . . . .

468

Nr. 42. Die Frage nach der Entstehung des Unlustgefühls des Mangels in Auseinandersetzung mit Hermann Schwarz . . .

474

Nr. 43. Gründet sich das Wünschen auf ein assumtives Gefallen?

478

Nr. 44. Triebgefühl, Gefühl des Mangels, Begehren und Wunsch . . . . . . . . . . . . . . . . . . . . . . . . . .

482

Nr. 45. Wünschen und Begehren. Die fundierenden Akte des Wünschens . . . . . . . . . . . . . . . . . . . . . . . . § 1. Die notwendigen Zusammenhänge zwischen intellektiven Stellungnahmen, Gemütsakten und dem Wünschen . . . . § 2. Die Bezogenheit des Wunsches auf eine aktuelle Glückslage § 3. Wünschen als Vermissen und als Begehren . . . . . . . .

491 491 495 500

xxxiv

inhalt teilband ii

d schönwert und gutwert. wertkonstitution und gefühl Nr. 46. Das Sich-Verlieben als innere Entscheidung aus den Tiefen des Ich. Aktives Gefallen und Wertapperzeption. Die Entscheidung für einen Vernunftwert . . . . . . . . . . . . . Nr. 47. Genuss und Habe. Sinnliche und geistige Werte und Güter . . . . . . . . . . . . . . . . . . . . . . . . . . . . § 1. Sinnliche Lust und Genuss an lustbringenden Gegenständen. Die Verfügungsfreiheit über einen Gegenstand hinsichtlich der Realisierung seiner Lusteigenschaft. Gemeingüter . . § 2. Die kallistische Apperzeption. Die Eröffnung einer Region von Sonderschönheiten durch ein künstlerisches Problem. Das Verlangen nach neuen Problemen und neuen Typen von Schönheit. Schönheit als eine Idee ist eine Sphäre der Vernunft und des schöpferischen Handelns . . . . . . . .

507

513

513

516

Nr. 48. Schönheit als der allgemeine Wertbegriff. Wahrheit als eine Sphäre von Schönheiten. Das von der Wissensfreude geleitete Vernunftstreben gegenüber der bloßen Tendenz auf Erfüllung . . . . . . . . . . . . . . . . . . . . . . . .

520

Nr. 49. Das wertende Gefallen als Wertapperzeption gegenüber der durch den gewerteten Gegenstand erregten sinnlichen Lust und ihrer sinnlichen Resonanz . . . . . . . . . . . .

522

Nr. 50. Der doppelte Sinn, in dem Gegenstand Wert hat: als Wert in sich habend und als mittelbaren Wert habend wegen der möglichen Realisierung der wertgründenden Momente. Gut und Wert . . . . . . . . . . . . . . . . . . . . . . . . .

524

Nr. 51. Werten, Fühlen und Begehren. Schönwerten und Gutwerten. Gutwerten, ohne sich am Gut zu freuen . . . . . .

527

Nr. 52. Werterfassung trotz Hemmung des Gefühls . . . . . .

530

inhalt teilband ii

xxxv

Nr. 53. Die originale Konstitution des Wertes im originalen Akt des Wertnehmens. Originalbewusstsein und Evidenz. Die Vergegenwärtigungsmodifikation der Wertimpression als originaler Grund für die Erfassung der Möglichkeit eines konkreten Wertes . . . . . . . . . . . . . . . . . . . . . . . . . .

532

Nr. 54. Das Schöne als ideal identischer „Schein“ in Impression und Phantasie. Die realisierende Objektivierung des Schönen macht es zu einem geistig bedeutsamen Realen . . . . . . .

534

Nr. 55. Freude in ihrem Verhältnis zu Wunsch und Wille. Die Frage nach den Aktklassen und ihrer Einheit . . . . . . .

536

Nr. 56. Zu den Äquivokationen des Wortes Wert . . . . . . . .

538

Nr. 57. Gefühl und Wertkonstitution. Das Problem der Gefühlsqualitäten . . . . . . . . . . . . . . . . . . . . . . § 1. Das Genießen als originäre Wertgegebenheit und seine Modalitäten. Antizipationen des Gefühls: das Fühlen als Bewusstsein-von. Ist der konkrete Wert ein reines Vorstellungsgebilde und ist das Ich nur als gewahrendes aktiv? . . . . § 2. Die Frage nach den Gefühlsqualitäten . . . . . . . . . .

540

540 544

Nr. 58. Die Wertapperzeption als Konstitution des vorgegebenen Wertgegenstandes. Das Verhältnis von Aktivität und Passivität bei der Wertkonstitution. Unterschiedliche Wertschichten. Das Auswerten als Leistung des Intellekts gegenüber den Gefühlsbegründungen . . . . . . . . . . . . . . . .

547

Nr. 59. Sachliche und axiologische Eigenschaften . . . . . . .

550

Nr. 60. Wertprädikate als nicht-relationelle Prädikate. Der Unterschied der Wertprädikate von den doxischen Modalitäten . . . . . . . . . . . . . . . . . . . . . . . . . . .

551

TEILBAND III WILLE UND HANDLUNG

i die handlung als willentlicher vorgang § 1. § 2. § 3. § 4. § 5.

Die Phasen der Handlung: schöpferische Willenshandlung und physischer Folgeablauf . . . . . . . . . . . . . . . Einheit und Vielheit des Willens: Ziel und Weg. Mechanische und „achtsame“ Handlungen. Entschluss und Handlung Ist das setzende fiat in einer anschaulichen Vorstellung des gewollten Vorgangs fundiert? . . . . . . . . . . . . . . Die anschauliche Erwartung von Vorgängen. Allgemeine Analyse des Erinnerungs- und Erwartungsbewusstsein . . Empirisch und willentlich motivierte Erwartungen . . . .

1 5 13 15 20

ii das wesen des schlichten handelns § 1.

§ 2.

Das in Wahrnehmung fundierte Wollen als Handeln und das Wollen als fiat. Die Willenskontinuität in jeder Phase der Handlung . . . . . . . . . . . . . . . . . . . . . . . Voluntäre Form und Materie. Die stetige Erfüllung der leeren Willensintention durch das kreative Wollen . . . . . .

23 27

iii unterschiede in der willensmeinung § 1. § 2. § 3.

Der Wille im Vorsatz, im Entschluss und im handelnden Tun Einfache und zusammengesetzte Handlungen. Weg und Ziel . . . . . . . . . . . . . . . . . . . . . . . . . Mittel und Zweck . . . . . . . . . . . . . . . . . . .

33 38 43

inhalt teilband iii

xxxvii

iv willenskausation und physische kausation § 1. § 2. § 3.

§ 4.

Wille und Handlung. Handlung und Hemmung . . . . . . Das Wollen als Ablauf in der immanenten Sphäre ist kein Naturvorgang . . . . . . . . . . . . . . . . . . . . . Die Abhängigkeit der Bewusstseinsinhalte vom Leib. Mechanische Naturkausalität und funktionale psychophysische Beziehungen . . . . . . . . . . . . . . . . . . . . . Inwieweit ist das Hervorgehen der Tat aus dem Willen als ein Abhängigkeitsverhältnis zwischen Tatsachen zu bestimmen?

47 48

50 54

v naturkausalität und willenskausalität. zur analyse der primären schöpferischen handlung

59

vi passivität und spontaneität im doxischen gebiet und im willensgebiet § 1. § 2. § 3.

§ 4.

Wollen, Trieb, Tendenz, ichliche Zuwendung und die Parallelen im Urteilsgebiet . . . . . . . . . . . . . . . . . Die Bedeutung des Zeithorizontes für die Handlung . . . Ob alles spezifisch Logische aus der Sphäre der Spontaneität stammt. Tendenzen, die vor aller willentlichen Zuwendung des Ich liegen . . . . . . . . . . . . . . . . . . . . . Trieb als Wille einer tieferen Stufe . . . . . . . . . . .

67 72

75 80

xxxviii

inhalt teilband iii

vii praktische möglichkeiten und praktischer bereich. die modi willentlichen geschehens § 1.

§ 2.

Praktische Möglichkeiten als reine und als reale. Die Begrenzung meines Tunkönnens in einem empirischen Möglichkeitsbereich. Das personale Ichliche und der seelische Naturuntergrund . . . . . . . . . . . . . . . . . . . Die Frage nach der Freiheit kinästhetischer Verläufe. Das bloß außerwillentliche, sachliche Geschehen gegenüber dem willentlichen Geschehen. Im willentlichen Bereich die Scheidung des willkürlichen vom unwillkürlichen Tun . . . . .

87

92

viii das bewusstsein des „ich kann“ als voraussetzung jeder willensthesis. die konstitution von willenswegen und tätigkeitsfeldern aus unwillkürlichen ichtätigkeiten

99

ix die entwicklung „praktischer apperzeptionen“ (des willens). doxische und praktische affektion § 1.

§ 2.

§ 3.

§ 4.

Attentionale Affektion als Trieb zur Zuwendung und praktische Affektion. Die Auswirkung der praktischen Affektion als praktische Rezeptivität . . . . . . . . . . . . . . . Praktische gegenüber theoretischer Möglichkeit. Das „Ich tue“ als Urmodus des Willens. Das „Ich kann“ als eine Modalität des „Ich will“ . . . . . . . . . . . . . . . . Die Affektion in der doxischen Sphäre und ihre Parallele in der Praxis. Die Frage nach dem Verhältnis des NichtPrimitiven zum Primitiven in der praktischen Sphäre . . . Zuwendung als Übergang in ein cogito in allen Aktsphären. Tendenz und Ichstreben als Modi jeden Bewusstseins. Die assoziativ-praktische Antizipation, ichloses Tun und das Urwollen . . . . . . . . . . . . . . . . . . . . . . . .

109

112

114

116

inhalt teilband iii

xxxix

x zur willensanalyse: das wirken des ich als inneres und äusseres tun und erzeugen. die aus dem vollzug von stellungnahmen erwachsenden idealen bestimmungen des ich § 1.

§ 2.

§ 3.

§ 4. § 5.

§ 6.

§ 7.

Bleibende Hexis als ideale Eigenheit des Ich. Veränderung des Ich durch Veränderung seiner Überzeugungen. Das Sichselbst-treu-Bleiben. Das Ich in beständiger Entwicklung durch Vollzug neuer Stellungnahmen . . . . . . . . . . Weltapperzeption als Habitus. Affektion und Zuwendung. Ich-Tendenz als Hingerissenwerden des Ich und das sich im realisierenden Tun erfüllende Ich-Streben. Jeder Gegenstand als habitueller Besitz aus „Erzeugung“ . . . . . . . Das äußere Erzeugen von Werken. Das Werk als bleibendes Sein einer bleibenden Absicht. Der erledigte und der preisgegebene Wille. Willensgesinnung und wertende Gesinnung. Der auf eine Idee und ihre realisierende Selbstgebung gerichtete Wille . . . . . . . . . . . . . . . . . . . . . . . Erkenntniswerte und -werke. Das theoretische Interesse als Interesse am Optimum der Fülle . . . . . . . . . . . . Passivität des Ich – „mechanisch“ hingezogen von Reizen, „mechanisch“ genießend – gegenüber freier Stellungnahme im aktiven Glauben, Werten und Tun. Urteilswahrheit, Wertewahrheit und Willenswahrheit . . . . . . . . . . . . Freie Ich-Akte als Aktualisierungen und Stiftungen von Gesinnungen. Aktives Streben als Vernunftstreben auf Evidenz der Wahrheit im weitesten Sinn gerichtet. Jeder Akt des Ich als seine bleibende Bestimmung, solange er nicht durch neue Akte entwurzelt wird . . . . . . . . . . . . . . . . . Das Wirken des Ich auf andere Subjekte durch soziale Akte. Die Person als ein Ich, das mit anderen Ich in Willensgemeinschaft steht. Personale Liebe . . . . . . . . . . . .

121

125

129 133

135

138

140

xl

inhalt teilband iii

xi vorstellen, denken und handeln § 1.

§ 2.

Willentliche Erzeugung von Vergegenwärtigungen und von Gedanken. Mechanisches Rechnen. Das auf reales Dasein gerichtete Realisieren gegenüber dem Erzeugen von Urbildern. Die Erzeugung im Kenntnis nehmenden Erfahren eines äußeren Gegenstandes gegenüber dem Erzeugen des darstellenden Erlebnisses . . . . . . . . . . . . . . . Das Denken als Handeln mit dem praktischen Ziel der Wahrheit. Das Streben nach Evidenz. Die Logik als Wissenschaft von der praktischen Vernunft im Erkenntnishandeln . . .

145

151

xii das allgemeine des strebens und seine verschiedenen richtungen § 1.

§ 2.

Das wertende Verhalten in der Erkenntnis und das wertende Verhalten im Begehren. Sind objektivierendes und wertendes Bewusstsein gegensätzliche Aktklassen? . . . . . . . Affektion durch den Wert. Das theoretische Interesse und der Eigenwert der Erkenntnis. Die zwei Strebenssysteme. Streben nach Erkenntnis und Streben nach Realisierung des Gegenstandes um seines Wertes willen . . . . . . . . .

157

161

xiii zur lehre von der intentionalität im hinblick auf die genesis der weltkonstitution. der strebenscharakter des aktlebens § 1.

§ 2.

Das nicht durch einen Glauben motivierte, uninteressierte Gefallen am Schönen gegenüber dem Gefallen am Wesen als Seienden . . . . . . . . . . . . . . . . . . . . . Werte als im fühlend-wertenden Bewusstsein konstituierte Einheiten. Der Wert als Seinsthema . . . . . . . . . . .

173 177

inhalt teilband iii § 3.

xli

Stellungnehmende Akte als eigentliche Ichakte und ihre passiven Vorformen. Das erfahrend Gerichtetsein als eine Strebenstendenz gerichtet auf die Realisierung des Seienden in seinem Seinsgehalt. Der Willensmodus des Urteilens . .

181

Beilage I. Seiendes als erworbene Habe und Korrelat einer habituellen Zugangspraxis . . . . . . . . . . . . . . . . . . . .

185

Beilage II. Wahres Sein und wahrer Wert. Wert und Stimmung. Die auf die ganze Lebenszukunft bezogene Stimmung: Lebensgefühl und Lebenssorge . . . . . . . . . . . . . . . . . . . . . .

186

Beilage III. Die Vorfreude als eine Gefühlsantizipation und ihre Erfüllung im Genuss. Der im Genuss selbsterfühlte Wert . . . . .

190

ERGÄNZENDE TEXTE

a neigung, vermutung, anmutung, zweifel im urteilsgebiet und in der sphäre des gemüts Nr. 1. Vernunft und Neigung. Urteilsneigung . . . . . . . . .

195

Nr. 2. Anmutung als Neigung zu Vermutung oder Glaube. Urteilsneigung und Urteilshandlung . . . . . . . . . . . .

200

Nr. 3. Anmutung und Vermutung. Blinde und durch Gewicht verleihende Motive begründete Annahmen . . . . . . . . .

203

Nr. 4. Urteilsneigung und Vermutung, Frage, Zweifel . . . . .

213

Nr. 5. Begründung in der Sphäre der emotionalen Akte. Schwanken und Entscheidung. Die mit dem Urteil verbundene Wertintention und ihre Erfüllung durch die Einsicht . . . . . .

221

Nr. 6. Aktmotivation, Neigung und Tendenz. Das Willentliche in allen Akten . . . . . . . . . . . . . . . . . . . . . . .

226

xlii

inhalt teilband iii

Nr. 7. Die Willensrichtung auf Wahrheit. Denken als eine Tätigkeit . . . . . . . . . . . . . . . . . . . . . . . . . . . .

240

b zur phänomenologie des wollens und der handlung Nr. 8. Analysen zur Triebhandlung, zu unterschiedlichen Fällen des einem Trieb Folgeleistens sowie zum freien und unfreien Wollen . . . . . . . . . . . . . . . . . . . . . . .

245

Nr. 9. Zusammenstellung der Unterscheidungen bei der Analyse der Handlung . . . . . . . . . . . . . . . . . . . . . . .

251

Nr. 10. Das Gefallen aufgrund der Vorstellung als Grundlage des Wunsches. Das Verhältnis von Wunsch und Wille . . .

253

Nr. 11. Die parallele Unterscheidung zwischen Anmutung, Urteilsneigung und Urteilsentscheidung einerseits sowie Wunsch, Willensneigung und Willensentscheidung andererseits . . . . . . . . . . . . . . . . . . . . . . . . . . .

256

Nr. 12. Inwieweit das fiat die Vorstellung der Handlung voraussetzt . . . . . . . . . . . . . . . . . . . . . . . . .

262

Nr. 13. Das fiat als praktische Zustimmung und das Willensmoment in der Ansatzphase der Handlung . . . . . . . . . .

264

Nr. 14. Fiat und Vorsatz

. . . . . . . . . . . . . . . . . . .

266

Nr. 15. Aufmerksamkeit und Wille, theoretisches und praktisches Interesse . . . . . . . . . . . . . . . . . . . . . .

268

Nr. 16. Willensintention und ihre Erfüllung als Realisierung. Verworrenheit und Klarheit im Wollen . . . . . . . . . .

271

Nr. 17. Der Unterschied zwischen Gefühlsprädikaten und dem Charakter der Willentlichkeit . . . . . . . . . . . . . .

273

inhalt teilband iii

xliii

Nr. 18. Das Willensvorkommnis des Widerstandes und seiner Überwindung. Geht der Wille bei der Leibesbewegung nicht primär auf die Schicht der subjektiven Empfindungen? . . .

278

Nr. 19. Empirische Motivation und Willensmotivation. Erwartung als Komponente des Willens . . . . . . . . . . . . .

281

Beilage IV. Gibt es eigene Erwartungsphänomene in der Gemütsund Willenssphäre? . . . . . . . . . . . . . . . . . . . . .

285

Nr. 20. Analogien zwischen Urteil und Wille . . . . . . . . . § 1. Der vielfache Sinn der hypothetischen Rede und der hypothetische Wille . . . . . . . . . . . . . . . . . . . . § 2. Affirmation und Negation beim Urteil und beim Willen . .

287 287 291

c zur lehre von der tendenz und ihrer auswirkung: die spannung der erwartung und aufmerksamkeit, theoretisches interesse, tendenz und erfüllung, tendenz und wille Nr. 21. Der unterschiedliche Charakter der Erscheinungsweisen bei gegebenen Dingen und bei der Erzeugung einer Objektveränderung. Aufmerksamkeit auf das Erscheinende und Vollzug der Stellungnahme. Der Seinscharakter vor der Aktualisierung der Stellungnahme . . . . . . . . . . . . . .

297

Nr. 22. Zur Abgrenzung von Tendenz und Wille. Ist das Tendieren ein Willensmodus? . . . . . . . . . . . . . . . . . .

304

Nr. 23. Tendenz als „Form“ der Akte. Die Doppelseitigkeit der Intentionalität: Tendenz und Bewusstsein-von. Die zum inneren Bewusstsein gehörende Tendenz gegenüber dem Begehren und Wollen als Tendieren auf eine Freude . . . . . . .

308

Nr. 24. Tendenz und Aufmerksamkeit. Im Akt leben. Das Interesse. Vollzug intentionaler Erlebnisse . . . . . . . . . .

312

xliv

inhalt teilband iii

Nr. 25. Ist Glauben in analogem Sinn Intention wie Tendenz und Begehren? Das Verhältnis von Bekräftigung und Erfüllung. Intention als Stellungnahme und als Tendenz . . . . . . .

315

Nr. 26. Die Spannung der Erwartung gegenüber der Spannung der Aufmerksamkeit. Die zur Aufmerksamkeit gehörenden Tendenzen . . . . . . . . . . . . . . . . . . . . . . . .

319

Beilage V. Attentionale Wandlungen . . . . . . . . . . . . . .

327

Beilage VI. Zur Spannung und Entspannung bei Erwartung und Aufmerksamkeit. Die Erwartung als vorerinnernde Aufmerksamkeit. Quasi-Erwartung und Quasi-Aufmerksamkeit in der Phantasie

328

Beilage VII. Die Intensität der Aufmerksamkeit . . . . . . . . .

331

Nr. 27. Die Erfüllung von Intentionen gegenüber der Entspannung von Tendenzen . . . . . . . . . . . . . . . . . . .

333

Nr. 28. Aufmerksamkeit als Zuwendung und als Tendenz. Die vom Gegenstand ausgehenden Tendenzen zur Betrachtung und Tendenzen auf Explikation und synthetische Setzung

335

Nr. 29. Theoretisches Interesse als Tendenz zur Betrachtung. Ist Interesse am Gegenstand ein Gefühl? . . . . . . . . . .

338

Nr. 30. Passivität und Aktivität im Begehren und Wollen. Die zum Begehren und Wollen gehörenden Tendenzen . . . . . . .

341

Nr. 31. Der Trieb als ursprüngliches Willensphänomen. Der Widerstand gegen den Trieb als Willensenttäuschung . . . .

346

Nr. 32. Wille und Trieb. Triebe als sich von innen her auswirkende Kräfte gegenüber Wunsch- und Begehrungsintentionen . . . . . . . . . . . . . . . . . . . . . . . . . . . .

347

Nr. 33. Die Tendenz auf Vollzug eines Aktes und ihre Auswirkung in der Sättigung gegenüber dem Begehren . . . . . .

349

inhalt teilband iii

xlv

Nr. 34. Implikation der Doxa. Die Vorzugsstellung der objektivierenden Akte . . . . . . . . . . . . . . . . . . . . . .

355

Nr. 35. Verschiedene Begriffe von Aufmerksamkeit und Meinung. Tendenz, in ein Meinen überzugehen, und Tendenz im Meinen . . . . . . . . . . . . . . . . . . . . . . . . . .

360

Nr. 36. Zuwendung zum Gegenstand um seiner selbst willen und um des Gefühls willen. Das willkürliche Verfolgen eines theoretischen Interesses um seiner selbst willen und als Mittel. Das durch die „Lust am Bemerken“ motivierte theoretische Interesse . . . . . . . . . . . . . . . . . . . . . . .

362

Beilage VIII. Freude an der Forschung, Freude an der Erkenntnis. Aufmerksamkeit und theoretisches Interesse . . . . . . . . .

369

Beilage IX. Doppelsinn des cogito. Das Im-Griff-Behalten während der Ablenkung . . . . . . . . . . . . . . . . . . . . . . .

372

Nr. 37. Bejahung in der Willenssphäre und in allen Aktsphären

374

Nr. 38. Tendenz und cogito. Aufmerksamkeit als Spannung . . .

376

Nr. 39. Tendenzen auf Klärung und auf Berechtigung . . . . .

378

Nr. 40. Tendenzen und tätige Verläufe in der ichlosen Wahrnehmung und im „Ich tue“ . . . . . . . . . . . . . . . . . . .

383

Nr. 41. Intention und Erfüllung. Die Erwartung und ihre Gefühlsspannung. Der Unterschied zwischen statischen und kinetischen Intentionen . . . . . . . . . . . . . . . . . . .

387

d phänomenologie der willensaffirmation und -negation, modalitäten des wollens Nr. 42. Die Schwierigkeiten der Willensanalyse. Passivität, Rezeptivität und Spontaneität in der doxischen Sphäre. Reiz und Zuwendung . . . . . . . . . . . . . . . . . . . . . . . .

391

xlvi

inhalt teilband iii

Nr. 43. Sollensbewusstsein in der Willenssphäre. Gibt es ein eigenes Sollensbewusstsein in der Urteilssphäre? . . . . . .

397

Nr. 44. Auf Vergangenes gerichtete Wünsche. Das Verhältnis von Begehren und Wollen . . . . . . . . . . . . . . . . .

399

Nr. 45. Willensanmutung gegenüber dem Bewusstsein praktischer Möglichkeit. Die Erfassung von Handlungen. Das aus dem Wollen entquellende Gewiss-Sein . . . . . . . . . . .

401

Beilage X. Wie steht eine Handlung als praktische Möglichkeit vor Augen? . . . . . . . . . . . . . . . . . . . . . . . . . .

406

Nr. 46. Das willkürliche Eingreifen in ein von selbst ablaufendes triebmäßiges Geschehen am Beispiel des Atmens: Hemmung, Beschleunigung und Verlangsamung. Die Frage nach dem Verhältnis von Wille und Tendenz . . . . . . . . . .

408

Nr. 47. Unbestimmter, zielloser gegenüber zielgerichtetem Trieb. Triebbetätigung gegenüber Willkürtätigkeit. Das Verhältnis des Begehrens zur Schicht der tätigen Impulse in der Kontinuität des Tuns . . . . . . . . . . . . . . . . . . .

415

Nr. 48. Schlichtes Wollen und Entschluss. Triebwille und triebhaftes Tun . . . . . . . . . . . . . . . . . . . . . .

419

Nr. 49. Liegt in jedem eigentlichen Wollen ein Werten? Tendenzen und Gegentendenzen: das passive Folgen gegenüber dem wollenden Bevorzugen . . . . . . . . . . . . . . . . . .

422

Nr. 50. Die Frage nach dem Wert des blinden, aber richtigen Urteilens. Die Idee göttlicher Erkenntnis. Der Unterschied zwischen Erfüllung und Berechtigung in der Glaubens- und Willenssphäre . . . . . . . . . . . . . . . . . . . . . .

424

Nr. 51. Die Bewertung des Urteilens im Hinblick auf seine durch prinzipielle Einsicht ausgewiesene Richtigkeit. Das Werten gegenüber dem existenzial interessierten Gemütsverhalten. Die Stiftung des ethischen Gewissens und Charakters durch den ethischen Grundwillen . . . . . . . . . . . . . . . .

430

inhalt teilband iii

xlvii

Nr. 52. Der ursprüngliche Wille in Hemmung und Förderung von kinästhetischen Verläufen . . . . . . . . . . . . . . . .

437

Nr. 53. Unmittelbares Tun gegenüber willkürlichem Tun als sekundärem Tun, dem eine als Reiz fungierende Vorstellung vorausgeht. Die Erfahrung der Hemmung als Vernunftmotiv für eine Willensverneinung . . . . . . . . . . . . . . . .

440

Beilage XI. Wie geht der Wille auf die Handlung? . . . . . . . .

442

Nr. 54. Die Objektivität der Natur und die Voraus-Bestimmtheit des Erfahrungsverlaufs. Die apriorischen Voraussetzungen einer Willensthesis. Die Auszeichnung von idealen Möglichkeiten des Wollens als praktische Möglichkeiten nach bestimmten Erfahrungsthesen . . . . . . . . . . . . . . . .

444

e modi des strebens, formen der affektion und freie ichakte. hemmung und modalisierung Nr. 55. Die Erfüllungsgestalten des positiven und negativen Strebens. Spannungszustände und ihre Lösung. Prozesse der Lustabnahme, Lusterhaltung und Luststeigerung und das damit verbundene positive und negative Streben . . . . . . . .

451

Nr. 56. Der Trieb und seine Modi. Die Realisierung als Triebmodus ist keine Stellungnahme. Der Entschluss als praktisches Ja oder Nein zu einem praktischen Anschlag als das eigentliche fiat. Entschluss und eigentliche Handlung . . . . . .

456

Nr. 57. Überlegung. Zum Unterschied zwischen Triebgefühlen und Wertgefühlen . . . . . . . . . . . . . . . . . . . .

459

Nr. 58. Rationales Handeln gegenüber Handeln aus Neigung. Rationale wertnehmende Liebe und ihre Kraft. Willensschwäche: das für das Gute gelähmte Willens-Ich . . . . .

460

Nr. 59. Das Streben nach Lust. Das Haben und das Genießen der Lust . . . . . . . . . . . . . . . . . . . . . . . . . . .

462

xlviii

inhalt teilband iii

Nr. 60. Die Wesenstypen des dumpfen und wachen Lebens. Instinktive und freie Akte. Leben als unaufhörliches Streben. Hinund Wegstreben – die Fülleformen der Lust und Unlust . .

464

Nr. 61. Der Trieb in der Gestalt des Ichstrebens gegenüber „mechanisch“ ablaufenden tendenziösen Verläufen. Die Hemmung eines Strebensverlaufs durch einen Widerstand. Die Frage nach der Bedeutung der Widerstandserfahrung für die Konstitution einer Dingwelt . . . . . . . . . . . . . . . .

467

Nr. 62. Das Streben nach Selbsterhaltung als Streben nach Lust. Positives Hin- und negatives Wegstreben. Konkurrenz der Strebungen. Spontanes und affektives Tun . . . . . . .

473

Nr. 63. Die Neugier als Trieb zur Kenntnisnahme gegenüber dem allgemeinen Trieb zur Zuwendung. Die Neugier im Verhältnis zu anderen Gefühlen und ihrer Motivkraft. Phänomenologische Unterschiede zwischen Neuem und Bekanntem . . . .

476

Nr. 64. Erkennen als zielgerichtete Tätigkeit. Das durch das vermeinende Werten im Gefühl hindurchgehende Streben. Ein Ding als Gut in Bezug auf die Möglichkeit des Besitzes und der genießenden Wertrealisierung. Die Verflechtung der Bewusstseinsfunktionen . . . . . . . . . . . . . . . . . .

482

Nr. 65. Freiheit und „Ichakt“. Freie Entscheidung aufgrund freier Überlegung. Entscheidungen unter Zwang. Die Freiheit der Vernunft: Entscheidung auf Grund einer Überlegung, die auf Wahrheit abzielt . . . . . . . . . . . . . . .

487

Beilage XII. Der zur Rezeptivität gehörende Streit der Apperzeptionen. Das aktive Annehmen und das aktive Wahrnehmen als Ich-Tun . . . . . . . . . . . . . . . . . . . . . . . . . .

490

Nr. 66. Die Freude an der Erkenntnis. Das unendliche Reich der mathematischen Erkenntnis als eine eigene praktische Güterwelt. Deren methodische Beherrschbarkeit als eine eigene praktische Vernunft und ein erstes Bild eines rationalen Lebens . . . . . . . . . . . . . . . . . . . . . . . . . .

493

inhalt teilband iii

xlix

Nr. 67. Affektion und Attention als Modi des Gegenstandsbewusstseins. Streben als allgemeine Modalität des Bewusstseins. Hintergrundaffektion und attentionale Affektion: vorattentionales und attentionales Streben . . . . . . . . . .

499

. . . . . . . . . . . . . . . . .

505

Nr. 69. Der Gegenstand in der Hingabe und im Interesse. Freie Stellungnahme und Entscheidung. Das Streben nach Einstimmigkeit durch Überwindung der Hemmungen. Die Modi des Strebens . . . . . . . . . . . . . . . . . . . . . . . . .

511

Nr. 70. Das „Ich kann“. Hemmung als praktische Negation. Die Durchstreichung des fiat bei einer unüberwindlichen Hemmung. Die Modalisierung des Tuns und Könnens bei einer vorübergehenden Hemmung . . . . . . . . . . . . . . . .

517

Nr. 71. Erfahrung als kontinuierliche Identifikation im aktiven Streben. Das wiederholende Durchlaufen im „Ich kann“. Die Modalisierung der Geltung. Der Erkenntniswille . . . . .

520

Nr. 72. Das strebende Gerichtetsein des Ich auf bleibende Stellungnahmen. Geltungsmodalisierungen als Hemmungen des Ich und Störungen in seinem habituellen Sein . . . . . . .

524

Nr. 73. Freier Wille, freies Können und Willenshemmung. Phantasieabwandlungen von Willensmöglichkeiten in Bezug auf die wirkliche Situation unter Einschluss meiner geltenden Motive und Interessen . . . . . . . . . . . . . . . . . . .

529

Nr. 74. Wahrnehmungsanalyse der Handlung . . . . . . . . .

533

Nr. 68. Praktische Affektion

TEILBAND IV TEXTKRITISCHER ANHANG

Zur Textgestaltung . . . . . . . . . . . . . . . . . . . . . .

1

Beschreibung der Konvolute

. . . . . . . . . . . . . . . . .

7

Textkritische Anmerkungen zu Teilband I . . . . . . . . . . .

47

Textkritische Anmerkungen zu Teilband II . . . . . . . . . . .

167

Textkritische Anmerkungen zu Teilband III . . . . . . . . . .

269

Zeittafel der Manuskripte

361

. . . . . . . . . . . . . . . . . .

Nachweis der Originalseiten und Angaben zur Rekonstruktion

369

Nachweis der Originalseiten und Angaben zur Rekonstruktion Teilband I . . . . . . . . . . . . . . . . . . . . . . . . .

371

Nachweis der Originalseiten und Angaben zur Rekonstruktion Teilband II . . . . . . . . . . . . . . . . . . . . . . . .

429

Nachweis der Originalseiten und Angaben zur Rekonstruktion Teilband III . . . . . . . . . . . . . . . . . . . . . . . .

485

Namenregister

537

. . . . . . . . . . . . . . . . . . . . . . . .

EINLEITUNG Wohl im unmittelbaren Anschluss an seine Promotion im März 1927 begann Ludwig Landgrebe im Auftrag von Husserl eine große Anzahl von dessen stenographischen Manuskripten mit intentional-analytischen Untersuchungen zusammenzustellen, um auf der Grundlage dieser Zusammenstellung ein umfangreiches, in drei Abschnitte gegliedertes Typoskript mit dem Titel „Studien zur Struktur des Bewusstseins“ anzufertigen.1 Die vorliegende Edition bringt die diesem Typoskript zugrundeliegenden Manuskripte weitgehend vollständig zur Veröffentlichung. Weitere, von Landgrebe nicht berücksichtigte Manuskripte zur konkreten Bewusstseinsforschung wurden hinzugefügt, um auf diese Weise Husserls bewusstseinsanalytische Forschungsarbeit umfassend zu dokumentieren. Im Folgenden soll zunächst Husserls phänomenologische Bewusstseinsforschung in ihrer Eigenart, in ihren wichtigsten Ausgangspunkten, in ihrem Verhältnis zur Philosophie und in ihrem Forschungscharakter sowie ihre Entwicklung kurz charakterisiert werden. Im darauf folgenden Abschnitt der Einleitung wird dann das als Ausgangspunkt der Edition dienende Typoskript von Landgrebe näher beschrieben, sein Entstehungskontext beleuchtet und über Husserls Beschäftigung mit dem Typoskript berichtet. Im dritten Abschnitt wird der Aufbau und die Gliederung der Edition erläutert. Zum Abschluss werden im vierten Abschnitt als Hilfe zur Orientierung einige Hinweise auf den Inhalt und die sachliche Bedeutung der Texte in den drei Teilbänden gegeben. * Das Bewusstsein ist für Husserl ein Feld konkreter deskriptiver Forschung, in der es zunächst gilt, die Bewusstseinsphänomene zu klassifizieren, um sie dann in ihren konkreten Strukturen, ihren Fun1 Siehe hierzu Landgrebes im Textkritischen Anhang (Husserliana XLIII/4, S. 9 f.) wiedergegebene Skizze seines Lebenslaufs.

lii

einleitung

dierungsverhältnissen, Implikationen und Modifikationsweisen, ihren synthetischen Zusammenhängen, ihren zeitlichen Verlaufs- und Einheitsformen und ihren Motivationsweisen in genauer analytischer Deskription zu erfassen. Diese Deskription hat auf der Grundlage einer methodisch gegen alle naturalistische Verfälschung gesicherten rein immanenten Erfahrung zu erfolgen mit dem Ziel, das Eigenwesen des Bewusstseins in einer rein phänomenologischen Forschung im vollen Reichtum seiner Phänomene zu bestimmen. Husserls phänomenologische Bewusstseinsforschung erwächst aus einer kritischen Aneignung und Auseinandersetzung mit der deskriptiven Psychologie Brentanos, wobei drei Lehrstücke von grundlegender Bedeutung für Husserls eigene Forschung sind: erstens die Lehre von der Intentionalität als definierende Eigenschaft der psychischen Phänomene, d. h. der intentionalen Erlebnisse, zweitens die Klassifikation der intentionalen Erlebnisse in Vorstellungen, Urteile und die nicht-kognitiven Akte des Fühlens und Wollens und drittens die mit dieser Klassifikation verbundene These von der Vorstellungsgrundlage aller Akte. Aus der Kritik an diesen Grundpfeilern von Brentanos deskriptiver Psychologie entfaltet sich Husserls eigene Bewusstseinsforschung. Grundlegend für diese ist, dass Intentionalität keine definierende Eigenschaft, sondern eine Leistung des Bewusstseins ist, zuunterst eine Auffassungsleistung, die nicht-intentionales Empfindungsbewusstsein voraussetzt. Was die Klassifikation der intentionalen Erlebnisse betrifft, so gehören für Husserl Vorstellungen und Urteile gemeinsam in die Klasse der Verstandesakte und müssen die Gemüts- und Willensakte in zwei verschiedene Aktklassen aufgeteilt werden. Und schließlich muss Husserl zufolge der Vorstellungsbegriff neu gefasst werden. Das reine setzungslose Vorstellen Brentanos gibt es nur als ein abstraktes Aktmoment, nicht als einen selbstständigen konkreten Akt. Diese kritischen Neubestimmungen von Brentanos Intentionalitäts- und Vorstellungsbegriffs und von dessen Klassifikation der Akte führen zu weiteren grundlegenden Strukturierungen des Bewusstseinsfeldes. Von fundamentaler Bedeutung für Husserls Bewusstseinsforschung ist hierbei die zunächst bei den Verstandesakten getroffene Unterscheidung zwischen sinnlichen und kategorialen Akten, für die Husserl dann versucht, Analoga in den beiden anderen Aktklassen zu finden, was ihn schließlich zu der für alle Aktklassen geltenden allgemeinen Unterscheidung zwischen

einleitung

liii

Passivität und Aktivität führt. Die genaue Beschreibung und Differenzierung passiver Vollzüge und Leistungen in ihrem Unterschied und Verhältnis zu den aktiven, im eigentlichen Sinn schöpferischen Leistungen des Bewusstseins, die Beschreibung der Übergangsformen, wie passives Geschehen in aktives Leisten übergehen kann oder durch aktives Leisten angeeignet wird und wie aktives Leisten zurück in passives Geschehen versinkt, dies wird zu einer Hauptaufgabe der Bewusstseinsforschung in allen Aktsphären. Was das aktive Bewusstsein betrifft, so gilt es dem Unterschied zwischen einer Aktivität der Rezeption in Weisen der Zuwendung, des Erfassens und Aufmerkens und einer im eigentlichen Sinn schöpferischen Aktivität im Denken, Entscheiden und Handeln Rechnung zu tragen. Ebenso gibt es in der Passivität Abstufungen des „mehr oder weniger“, mit der untersten Stufe der vollkommenen Passivität des inneren Zeitbewusstseins. Das Bewusstsein ist eine vielfältig und vielschichtig verflochtene Einheit. Die grundlegenden Weisen wie Bewusstsein mit Bewusstsein verbunden ist, sind die Fundierung, die intentionale Implikation und die Synthesis, desweiteren passive und aktive Weisen der Motivation. Dies sind dementsprechend weitere wichtige Titel für Husserls Bewusstseinsforschungen. Wie weit Husserl in seinen Bewusstseinsforschungen auch über Brentanos deskriptive Psychologie hinausgegangen ist, wieviel reichhaltiger und detaillierter sie im Vergleich zu Brentanos Beschreibungen sind, alle noch so subtilen deskriptiven Befunde Husserls ordnen sich derselben dualen Polarität unter, die schon Brentanos Bewusstseinsbegriff kennzeichnet, der Dualität von Vorstellung und Stellungnahme bzw. Gegebenheit und Stellungnahme: Etwas ist dem Bewusstsein gegeben, zu dem es bzw. das Ich dieses Bewusstseins sich stellungnehmend verhält. Diese Gegebenheit allerdings erweist sich in Husserls phänomenologischer Forschung als Resultat einer mehr oder weniger komplexen und hochstufigen Leistung in Form von passiven oder aktiven Vollzügen eben dieses Bewusstseins, und die Stellungnahme selbst erzeugt ihrerseits neue Gegebenheit für neue Stellungnahmen. Die phänomenologische Philosophie als absolute Wissenschaft gründet ihre Wissenschaftlichkeit auf phänomenologische Bewusstseinsforschung, die in ihrer Reinheit durch die phänomenologische

liv

einleitung

Methode gesichert ist. Diese Reinheit bezieht sich in erster Linie auf die Abwehr jeglicher Naturalisierung des Bewusstseins, d. h. der Leugnung seines Eigenwesens. Sie bezieht sich aber auch auf die Fernhaltung von Vorurteilen aus der philosophischen Tradition und selbst von philosophischen Interessen, die zu einer selektiven Steuerung der Aufmerksamkeit führen könnten. Dies heißt, das die phänomenologische Forschung zunächst unbekümmert um philosophische Interessen durchzuführen ist, dass also gerade im Hinblick auf die Grundlegung einer letztwissenschaftlichen Philosophie die Philosophie einzuklammern ist. Der Forschungscharakter der phänomenologischen Forschung besteht in der geduldigen, um höchste Genauigkeit bemühten, sachgetreuen Beschreibungsarbeit der in der phänomenologischen Erfahrung gegebenen Phänomene, den Erlebnissen in ihren unterschiedlichen Vollzugsweisen, Synthesen und Motivationseinheiten. Dass es sich hierbei um eidetische Beschreibungen handeln soll, die das Eigenwesen des Bewusstseins im vollen Reichtum seiner konkreten Bestimmungen entfalten, berührt nicht den mühevollen Arbeitscharakter der phänomenologischen Forschung. Wo auf den ersten Blick alles irgendwie ineinander zu fließen scheint und sich höchstens ganz grobe und vage Unterscheidungen treffen lassen, eröffnet sich bei tieferem Eindringen ein ungeahnter Reichtum an Formen, Differenzierungen und Verflechtungen. Dieser Reichtum erschließt sich nicht auf einen Blick, sondern nur schrittweise durch eine beständige Schärfung des analytischen Blickes, eines immer genaueren Hinsehens, und einer entsprechenden Präzisierung der Beschreibungen. Vermeintlich gesicherte Ergebnisse müssen somit immer wieder an den Phänomenen selbst neu überprüft werden, die Beschreibungsbegriffe müssen beständig neu entdeckten Unterschieden und Bestimmungen angepasst werden. * Husserls phänomenologische Forschung entwickelte sich zuerst im Zusammenhang mit der erkenntnistheoretischen Grundlegung der formalen Wissenschaften, von Logik und Mathematik. Sie war deswegen zunächst weitgehend beschränkt auf die Verstandessphäre, die Vorstellungs- und Denkakte. In der V. und VI. Logischen Unter-

einleitung

lv

suchung finden sich die für Husserls weitere Bewusstseinsforschung grundlegenden Bestimmungen und Unterscheidungen zwischen Materie und Qualität eines intentionalen Aktes, zwischen Auffassungsinhalt, Auffassungssinn und Auffassungsform, zwischen anschaulichen und leeren Akten, zwischen objektivierenden und nicht-objektivierenden Akten, zwischen sinnlichen und kategorialen Akten. Am Leitfaden dieser Bestimmungen und Unterscheidungen konzentriert sich Husserls Bewusstseinsforschung nach dem Erscheinen der Logischen Untersuchungen vor allem auf die sinnlichen Anschauungen – die Wahrnehmung als Gegenwärtigung und die verschiedenen Weisen der Vergegenwärtigung in Form von Erinnerung, Erwartung, Phantasie und Bildbewusstsein – und die Denkakte, in erster Linie das Urteilen, sowie das allem Bewusstsein zugrundeliegende innere Zeitbewusstsein. Im Zusammenhang mit Vorlesungen zur Axiologie und Ethik in den Jahren 1902 sowie in den Jahren 1908/09 bis 1914 wendet Husserl sich dann auch in zahlreichen Forschungsmanuskripten der Erforschung des Gemüts- und Willensbewusstseins zu. Der größte Teil der in der vorliegenden Edition herausgegebenen Manuskripte stammt aus den Jahren 1909 bis 1914. Husserl hat, wie die zahlreichen Manuskripte zeigen, in diesen Jahren offensichtlich eine große Anstrengung unternommen, um den neuen Kontinent, den er glaubte, entdeckt zu haben, nämlich das reine Bewusstsein, nicht nur in seinen allgemeinsten Strukturen und Formen zu bestimmen, sondern auch in seinen spezifischen Phänomenen in ihrer verwirrenden Vielfalt und Verflochtenheit zu analysieren und so genau wie möglich zu beschreiben. Neben umfangreicheren Ausführungen finden sich viele nur wenige Manuskriptblätter umfassende Detailanalysen. Viele dieser Manuskripte wurden von Husserl zu thematischen Konvoluten mit einer bestimmten Signatur zusammengefasst. Einem dieser Konvolute hat Husserl den Titel „Struktur des Bewusstseins“ gegeben.1 Husserls bewusstseinsanalytische Forschung in diesen Jahren diente dem Projekt einer umfassenden phänomenologischen Kritik der theoretischen, axiologischen und praktischen Vernunft.2 Der phänomenologische Charakter einer solchen Vernunftkritik besteht in der 1 2

Siehe hierzu den Textkritischen Anhang (in Husserliana XLIII/4, S. 17 u. 365). Zu diesem Projekt einer phänomenologischen Kritik der Vernunft siehe die

lvi

einleitung

deskriptiven Analyse der jeweiligen intentionalen Akte und ihrer Aktstrukturen sowie den intentionalen Gegenständen dieser Akte, wobei vor allem die unterschiedlichen Weisen des Evidenzbewusstsein in den verschiedenen Aktsphären aufzuklären sind.1 Wie zahlreiche, in die vorliegende Edition aufgenommene Forschungsmanuskripte zeigen, hat Husserl seine intentional-analytische Forschungsarbeit auch in den zwanziger und dreißiger Jahren fortgesetzt. Das von Landgrebe 1927 angefertigte Typoskript sollte wohl Husserl als Vorlage für eine Publikation eines großen Teils seiner bewusstseinsanalytischen Untersuchungen dienen. * Ludwig Landgrebe war von 1923 bis 1930 Husserls Privatassistent.2 Nachdem er in den ersten Jahren seiner Tätigkeit mit der Abschrift von einzelnen Manuskripten beauftragt wurde, übertrug ihm Husserl ungefähr von 1926 an die Aufgabe, um Forschungsmanuskripte zu größeren Abhandlungen zusammen zu fügen, die Husserl nach einer Überarbeitung vermutlich im Jahrbuch für phänomenologische Forschung zu veröffentlichten beabsichtigte. Landgrebe stellte drei umfangreiche Typoskripte her, wovon zwei noch im Nachlass erhalten sind: das Typoskript der „Studien zur Struktur des Bewusstseins“ sowie ein Typoskript mit dem Titel „Gegenstand und Sinn“. Nicht mehr im Nachlass erhalten ist das dritte von Landgrebe hergestellte Typoskript, das den Titel „Logische Studien“ trug und das nach mehrfacher Um- und Überarbeitung durch Husserl schließlich von Landgrebe nach Husserls Tod im Jahr 1939 unter dem Titel Erfahrung und Urteil veröffentlicht wurde.

„Einleitung des Herausgebers“ in: Edmund Husserl, Vorlesungen über Ethik und Wertlehre, 1908–1914, hrsg. von Ullrich Melle, Husserliana XXVIII, Kluwer, Dordrecht, 1988, S. XX–XXIII. 1 Siehe hierzu das zweite Kapitel über die „Phänomenologie der Vernunft“ im vierten Abschnitt der Ideen zu einer reinen Phänomenologie und phänomenologischen Philosophie. Erstes Buch: Allgemeine Einführung in die reine Phänomenologie, neu hrsg. von Karl Schuhmann, Husserliana III/1, Martinus Nijhoff, The Hague, 1976, S. 314–337. 2 Siehe Karl Schuhmann, Husserl-Chronik. Denk- und Lebensweg Edmund Husserls. Husserliana Dokumente I Martinus Nijhoff, Den Haag, 1977, S. 273.

einleitung

lvii

Leider lässt sich über die konkreten Anlässe für diese Arbeiten Landgrebes, über ihre genaue Datierung und ihren Verlauf nichts Gesichertes sagen. Das Typoskript der „Studien zur Struktur des Bewusstseins“ dürfte größtenteils 1927 entstanden sein. Husserl verfasste dazu im Sommer 1927 einen fragmentarischen Einleitungsentwurf.1 Angesichts des Umfangs des Textes und der Zahl der verwendeten Manuskripte ist es nicht unwahrscheinlich, dass Landgrebe bereits 1926 mit der vorbereitenden Arbeit der Lektüre und Anordnung der Manuskripte begann. Das Typoskript ist in drei „Studien“ mit den Titeln „Aktivität und Passivität“, „Wertapperzeption, Gemüt, Wille“ und „Modalität und Tendenz“ unterteilt. Diese Gliederung entspricht nicht der Dreigliederung der Bewusstseinssphären. Die Analysen zu Gemüt und Wille sind in der zweiten Studie zusammengefasst, wobei allerdings die Untersuchung der „Tendenz“, die Husserl gewöhnlich als grundlegende Form der Willenspassivität gilt, zusammen mit der Untersuchung der Modalitäten die dritte Studie bildet.2 Da die sachliche Zusammengehörigkeit von „Modalität und Tendenz“ in der dritten Studie im Typoskript nicht verdeutlicht wird, weist diese Studie einen eher heterogenen Charakter auf. Die erste Studie beruht auf Manuskripten, die in der vorliegenden Edition im ersten Teilband, vor allem im ersten Teil, wiedergegeben werden. Wieweit Landgrebe bei der Gliederung des Typoskripts und bei der Weise, wie die Manuskripte zusammengefügt wurden, Vorgaben Husserls folgte und wie diese Vorgaben aussahen, ist nicht bekannt. In unmittelbarer zeitlicher Nähe, möglicherweise vor dem Typoskript der „Studien zur Struktur des Bewusstseins“ dürfte das Typoskript „Gegenstand und Sinn“ entstanden sein.3 Dieses Typoskript kann als komplementäre Ergänzung zu den „Studien zur Struktur 1

Siehe Text Nr. 27 im vorliegenden Teilband, S. 469. Der erste den Modalitäten gewidmete Abschnitt der dritten Studie besteht zum größten Teil aus dem für die Umarbeitung der VI. Logischen Untersuchung im Sommer 1913 neu verfassten Kapitel über das Möglichkeitsbewusstsein, siehe Edmund Husserl, Logische Untersuchungen. Ergänzungsband. Erster Teil. Entwürfe zur Umarbeitung der VI. Untersuchung und zur Vorrede für die Neuauflage der Logischen Untersuchungen (Sommer 1913), hrsg. von Ullrich Melle, Husserliana XX/1, Kluwer, Dordrecht/Boston/London, 2002, S. 171–230. 3 Ein Teil des Typoskripts (M III 3 IV 1–2) liegt in einem Briefumschlag, der auf den 22. April 1926 datiert ist; siehe Husserl Chronik, Husserliana Dokumente I, S. 304. 2

lviii

einleitung

des Bewusstseins“ betrachtet werden, in größter Vereinfachung ausgedrückt: als die Noematik zur Noetik der „Studien“. Das dritte, nur noch in seiner vielfach überarbeiteten Fassung von Erfahrung und Urteil erhaltene Typoskript der „Logischen Studien“, beruhte auf dem Manuskript der Vorlesung über „Transzendentale Logik“ von 1920/21 und aus Manuskripten aus dem Umkreis dieser Vorlesung. Wie die erste „Studie“ behandelte es die Verhältnisse zwischen Passivität, Rezeptivität und Aktivität, zwischen Sinnlichkeit und Verstand, jetzt aber auf dem methodischen Niveau der genetischen Phänomenologie und im Hinblick auf das Projekt einer transzendentalen Logik. Dem entspricht auch die folgende Aufschrift von Landgrebe auf dem Titelblatt einer Dublette der ersten „Studie“: „größtenteils veraltet, das Wesentliche verwendet in der Ausarbeitung der Urteilstheorie“1 – „Urteilstheorie“ meint hier die „Logischen Studien“. Eine ähnliche Aufschrift findet sich auch auf dem Titelblatt der Dublette des Typoskripts von „Gegenstand und Sinn“: „größtenteils verwendet in der Ausarbeitung der Urteilstheorie, zum Teil erledigt durch die ‚Formale und transzendentale Logik‘.“2 Diesen Aufschriften folgend, könnte man die erste „Studie“ über Passivität und Aktivität bei den Verstandesakten und das Typoskript „Gegenstand und Sinn“ in ihrer Einheit auch als einen frühen Entwurf der transzendentalen Logik auffassen. Die erste „Studie“ würde aber damit nicht mehr nur als Präsentation von Befunden einer noch vor- und unphilosophischen, rein phänomenologischen Bewusstseinsforschung gelten, sondern sie würde bereits eine am philosophischen Interesse der Grundlegung der Logik orientierte Auswertung und Systematisierung der Ergebnisse solcher Forschung darstellen. Letzteres widerspricht jedoch Husserls eigenen Ausführungen im fragmentarischen Entwurf einer Einleitung zu Landgrebes Typoskript der „Studien“. Er will, wie es dort heißt, in den Untersuchungen der „Studien“ alles Philosophische außer Spiel lassen, es soll sich bei diesen Untersuchungen demnach um eine „sozusagen unphilosophische Phänomenologie“ handeln.3 Eine solche unphilosophische Phänomenologie ist aber nichts anderes als eine rein phänomenolo1 2 3

M III 3 I 1 I, 1. M III 3 IV 2, 1. Siehe vorliegenden Teilband, S. 469.

einleitung

lix

gische, intentional-analytische Bewusstseinsforschung im Sinne einer phänomenologischen Psychologie, von Husserl auch reine oder intentionale Psychologie genannt. Zur gleichen Zeit, in der Husserl sich mit dem Typoskript beschäftigte, im Sommer und Herbst 1927, arbeitete er unter der Mitarbeit von Martin Heidegger intensiv am Artikel für die Encyclopedia Britannica über die transzendentale Phänomenologie.1 Der erste Teil dieses Artikels ist der Ausarbeitung der Idee einer rein phänomenologischen Psychologie gewidmet. Das Problem der Konzeption und methodischen Grundlegung einer das Eigenwesentliche des Bewusstseins erforschenden reinen Psychologie bzw. reinen Phänomenologie hat Husserl in den letzten Jahren seiner Lehrtätigkeit von 1925 bis 1928 intensiv beschäftigt. Im Sommersemester 1925, im Wintersemester 1926/27 und im Sommersemester 1928 hat er drei Vorlesungen über phänomenologische bzw. intentionale Psychologie gehalten, und im April 1928 hat er in Amsterdam und Groningen auf der Grundlage des Artikels für die Encyclopedia Britannica viel beachtete Vorträge zu diesem Thema gehalten.2 Einer eidetischen Psychologie bzw. Phänomenologie des reinen Bewusstseins kam Husserl zufolge eine dreifache Schlüsselstellung im philosophischen Begründungszusammenhang der Wissenschaften zu: für die Reform der Psychologie, für die Grundlegung der Geisteswissenschaften und für die Hinführung zur transzendentalen Phänomenologie als absoluter philosophischer Grundwissenschaft. Dass die „Studien“ als eine zusammenfassende Darstellung von Husserls eigener konkreter phänomenologischer bzw. rein psychologischer Bewusstseinsforschung zu verstehen sind, kommt in einem Brief von Heidegger an Husserl vom 22. Oktober 1927 zum Ausdruck. Sich auf eine Bemerkung Husserls, dass es bis jetzt noch keine reine Psychologie gäbe, beziehend, schreibt Heidegger: „Nun, die wesentlichen Stücke liegen in den drei Abschnitten des von Landgrebe getippten Ms. Diese Untersuchungen müssen zuerst erscheinen und zwar aus zwei Gründen: 1. Dass man die konkreten Untersuchungen vor 1 Siehe hierzu Edmund Husserl, Phänomenologische Psychologie, hrsg. von Walter Biemel, Husserliana IX, Martinus Nijhoff, Den Haag, 1962, S. 590. 2 Die Vorlesung von 1925, Teile der Vorlesungen von 1926/27 und 1928, die verschiedenen Fassung des Artikels für die Encyclopedia Britannica sowie die Amsterdamer Vorträge sind in Husserliana IX herausgegeben.

lx

einleitung

Augen hat und nicht als versprochene Programme vergeblich sucht. 2. Dass Sie selbst Luft bekommen für eine grundsätzliche Exposition der transzendentalen Problematik.“1 Wie die Bezeichnung „Studien“ im Titel jedoch angibt, wird nicht der Anspruch erhoben, eine systematisch ausgearbeitete und vollständige phänomenologische Psychologie vorzulegen, sondern Untersuchungsergebnisse konkreter Bewusstseinsforschung zu bieten, die durchaus offen sind für Weiterführungen, Präzisierungen und Korrekturen. Die von Landgrebe benutzten Manuskripte haben selbst einen ausgesprochenen Forschungscharakter, sie können als Protokolle konkret durchgeführter phänomenologischer Analysen von bestimmten Bewusstseinsphänomenen, von Akt- und Vollzugsformen, Fundierungsverhältnissen, Synthesen etc. angesehen werden. Die Beschreibungen der Phänomene, vor allem die des fühlendwertenden und wollend-handelnden Bewusstseins, haben vielfach einen explorativen und probierenden Charakter. Die Terminologie ist nicht fixiert. Landgrebes Versuch, aus der Vielzahl von solchen Forschungsmanuskripten einen kohärenten Text zu erstellen, konnte deswegen auch nur bedingt gelingen. Das durch ihn angefertigte Typoskript ist nicht frei von Brüchen, terminologischen Verschiebungen und Inkonsequenzen. Was die Beschäftigung Husserls mit dem Typoskript von Landgrebe, betrifft, so beschränkt diese sich weitgehend auf die erste „Studie“. Schon der Entwurf der Einleitung vom August 1927 bricht nach Ausführungen zur ersten Studie ab. Nur Teile der ersten „Studie“ hat Husserl intensiv in Form von Annotationen, stilistischen und terminologischen Veränderungen und Streichungen überarbeitet. Auf einigen dem Typoskript eingelegten Manuskriptblättern finden sich ergänzende Ausführungen. Im Nachlass konnten noch einige kleinere Texte, die sich auf die erste Studie beziehen bzw. durch diese angeregt sind, gefunden werden. Diese Texte kommen zusammen mit dem Entwurf der Einleitung und einer von Landgrebe verfassten „Disposition der I. Studie“ im fünften Teil des ersten Teilbandes der vorliegenden Edition zum Abdruck. 1

Edmund Husserl, Briefwechsel. Band IV: Die Freiburger Schüler, in Verbindung mit Elisabeth Schuhmann hrsg. von Karl Schuhmann, Husserliana Dokumente III, Band IV, Kluwer, Dordrecht/Boston/London, 1994, S. 145.

einleitung

lxi

Das Typoskript der zweiten „Studie“ weist nur noch wenige Bearbeitungsspuren Husserls auf, das Typoskript der dritten „Studie“ überhaupt keine mehr. Über die Gründe für die Konzentration auf die erste „Studie“ lässt sich nur mutmaßen, da hierzu wie auch zur Gesamtbeurteilung des Typoskripts keine Äußerungen von Husserl vorliegen. * Da die Manuskripte, die Landgrebe seinem Typoskript zugrundegelegt hat, alle im Nachlass erhalten sind und mit Hilfe der Angaben im Typoskript rekonstruiert und datiert werden konnten, war es möglich, diese Manuskripte unabhängig von der Weise, wie Landgrebe sie in seinem Typoskript verwendet hat, zu edieren. Die mit Hilfe des Typoskripts identifizierten und rekonstruierten Manuskripte werden in der vorliegenden Edition vollständig wiedergegeben, und sie werden durch weitere, thematisch dazugehörige intentional-analytische Forschungsmanuskripte aus dem Nachlass ergänzt, um auf diese Weise Husserls konkrete Forschungsarbeit auf dem durch ihn selbst entdeckten und methodisch gesicherten Gebiet der rein phänomenologischen bzw. rein psychologischen Bewusstseinsforschung umfassend zu dokumentieren. Dabei werden Husserls Forschungsmanuskripte über die Aktstrukturen und Vollzugsformen in den nichtintellektiven Bewusstseinssphären, über Gefühlsempfindungen, gefühlsmäßige Werterfahrungen, emotionale Reaktionen, Stimmungen, über das Wünschen, über die Willensformen und die passiven Untergründe von Fühlen und Wollen im Begehren, in Trieb und Tendenz nahezu vollständig wiedergegeben. Diese bisher weitgehend unbekannten Untersuchungen Husserls zum Gemüts- und Willensbewusstsein kommen im zweiten und dritten Teilband der vorliegenden Edition zur Veröffentlichung. Husserls Bewusstseinsforschung war ohne Zweifel vor- und überwiegend der Bewusstseinssphäre des Verstandes, d. h. den intellektiven Bewusstseinsphänomenen, gewidmet. Die beiden wichtigsten intellektiven Akte sind für Husserl die sinnliche Wahrnehmung und das Urteilen. Durch die Analyse ihrer Aktstrukturen, ihrer intentionalen Leistungen und ihres Fundierungsverhältnisses gewinnt Husserl die Leitfäden für seine gesamte Bewusstseinsforschung. Die im ersten

lxii

einleitung

Teilband veröffentlichten Forschungsmanuskripte enthalten ausführliche Analysen allgemeiner Strukturen der Verstandesakte wie das Meinen, die Synthesen und das Stellungnehmen mit ihren jeweiligen Formen, Modi und Grundlagen. Die insgesamt 277 Texte der vorliegenden Edition bilden ein weitverzweigtes und verschlungenes, oft schwer entwirrbares Geflecht von phänomenologischen Analysen und Beschreibungen, von denen die frühesten bis in die Zeit vor den Logischen Untersuchungen zurückreichen, die spätesten aus der Mitte der dreißiger Jahren stammen. Die hauptsächliche Entstehungszeit fällt in die Jahre von 1909 bis 1914 und in geringerem Umfang in die erste Hälfte der zwanziger Jahre. Was die Anordnung der Texte betrifft, so wurden diese zunächst in drei thematische Gruppen, die den drei von Husserl unterschiedenen Bewusstseinssphären bzw. Aktklassen der intellektiven Phänomene sowie der Gemüts- und Willensphänomene entsprechen, aufgeteilt. Verstand, Gemüt und Wille sind für Husserl keine Vermögen, sondern Bewusstseinssphären oder Aktklassen; es sind die Grundweisen der intentionalen Gegenstands- und Weltbezogenheit des Bewusstseins: das vorstellend-denkende, fühlend-wertende und wollend-handelnde intentionale Bewusstsein. Diese Grundarten der Intentionalität bestehen nicht getrennt von einander, sondern sind in der konkreten Ganzheit des Bewusstseins in der Vielzahl ihrer Phänomene auf vielfältige und komplexe Weise aufeinander bezogen, miteinander verflochten und wechselseitig motiviert. Die Phänomene der verschiedenen Sphären weisen auch zahlreiche strukturelle Ähnlichkeiten und Übereinstimmungen auf. Dies hat zur Folge, dass die Analysen in vielen Texten sich nicht nur auf Phänomene einer einzigen Bewusstseinssphäre beschränken, sondern dass die Untersuchung sich auch auf Phänomene einer anderen Sphäre erstreckt, sei es vergleichend und analogisierend oder sei es kontrastierend, oder sei es um Fundierungs- und Motivationsverhältnisse zwischen den Phänomenen verschiedener Sphären zu bestimmen. In einigen Fällen hätte so Manuskripte auch in einen anderen als den ihnen hier zugewiesenen Teilband aufgenommen werden können. In jedem der drei Teilbände wurden die Texte im Prinzip chronologisch angeordnet. In einigen Fälle wurde von dieser chronologischen Anordnung jedoch abgewichen. Dies geschah vor allem, um die durch

einleitung

lxiii

Husserls Paginierung in den von ihm zu größeren Konvoluten zusammengefassten Manuskripte bezeichnete Reihenfolge der betreffenden Manuskripte zu beachten. Da die Datierung einer Reihe von Manuskripten nur auf Vermutungen beruht, die sich auf mehr oder weniger starke Indizien stützen, ist die chronologische Anordnung auch nicht immer gesichert. Innerhalb der einzelnen Teilbände wurde versucht, mit Hilfe der in den Husserliana üblichen Gliederungsformen und unterschiedenen Textsorten eine gewisse Übersichtlichkeit zu schaffen. Der erste Teilband mit dem Titel „Verstand und Gegenstand“ ist in fünf Teile mit arabisch nummerierten Texten, denen römisch nummerierte Beilagen hinzugefügt sein können, gegliedert. Der zweite Teilband mit dem Titel „Gefühl und Wert“ und der dritte Teilband mit dem Titel „Wille und Handlung“ sind jeweils in einen Teil mit einer beschränkten Anzahl von römisch nummerierten Haupttexten und einen Teil mit einer größeren Anzahl von arabisch nummerierten Ergänzenden Texten gegliedert. Sowohl den Haupttexten wie den Ergänzenden Texten können ebenfalls römisch nummerierte Beilagen zugeordnet sein.1 Was den ersten Teilband betrifft, so sind die ersten drei Teile in diesem Band jeweils einem wesentlichen Strukturmoment intellektiver Akte gewidmet: dem intentionalen Gerichtetsein, der Synthesis und der Stellungnahme. Der vierte, thematisch eher heterogene Teil befasst vier umfangreichere Texte mit sechs Beilagen aus der ersten Hälfte der zwanziger Jahre. Es handelt sich um bewusstseinsanalytische Studien zu Aspekten, die in den vorangehenden Teilen an verschiedenen Stellen behandelt wurden. Eine Ausnahme bildet allerdings der Text Nr. 25, bei dem es sich um eine Untersuchung des Sprechens und Verstehens handelt. Das Ausdrücken, Aussagen und

1 Dass den Haupttexten Beilagen zugeordnet werden, diese Beilagen aber nicht unter den Ergänzenden Texten aufgeführt werden, sondern direkt zu den betreffenden Haupttexten gestellt sind, während die unter den Ergänzenden Texten aufgeführten Texte selbst wiederum Beilagen zugeordnet haben können, widerspricht allerdings der bisherigen Praxis in den Husserliana. Die Herausgeber haben sich trotz der Merkwürdigkeit, dass es auf diese Weise Beilagen gibt, die keine Ergänzenden Texte sind, für die Beibehaltung der bisher üblichen Bezeichnungen „Beilagen“ und „Ergänzende Texte“ entschieden. Dasselbe gilt für die Beibehaltung der in den Husserliana üblichen römischen Nummerierung der Beilagen, obwohl dies bei Beilagen zu Haupttexten zu einer doppelten römischen Nummerierung der Texte führt.

lxiv

einleitung

Verstehen werden in den Texten der vorliegenden Edition ansonsten nur am Rande behandelt.1 Der fünfte Teil des ersten Teilbandes schließlich befasst die Manuskripte zu Landgrebes Typoskript der „Studien zur Struktur des Bewusstseins“. Was den zweiten und dritten Teilband betrifft, so wurden als Haupttexte Manuskripte auf Grund ihres Umfangs und ihres sachlichen Gewichts ausgewählt. Bei den Ergänzenden Texten handelt es sich um Manuskripte, die meistens nur wenige Blätter, manchmal sogar nur ein einzelnes Blatt umfassen und die häufig in besonderem Maße den Prozess lebendiger Forschung wiedergeben. Bei der Anordnung dieser Ergänzenden Texte wurde der oben erwähnten Zusammenlegung von Manuskripten zu größeren Konvoluten Rechnung getragen. Im zweiten Teilband ergeben sich so vier, im dritten Teilband fünf Gruppen von Ergänzenden Texten, die mit Ausnahme der letzten Textgruppe im dritten Teilband den von Husserl selbst zusammengestellten Konvoluten entsprechen. * Abschließend sei noch kurz auf den Inhalt und die sachliche Bedeutung der Texte der jeweiligen Teilbände und die systematischen Zusammenhänge, in denen sie stehen, eingegangen. Der Schwerpunkt des ersten Teilbandes mit dem Titel „Verstand und Gegenstand“ sind die in den drei ersten Teilen wiedergegebenen Texte, die bis auf zwei Texte mit ihren Beilagen aus den Jahren 1910 bis 1912 stammen. Alle Texte in den ersten beiden Teilen lassen sich, mit Ausnahme des um „allgemeine Unterscheidungen“ und „Grundarten von Akten“ bemühten ersten Textes, der phänomenologischen Urteilstheorie, die das wichtigste Fundament für die phänomenologische Kritik der theoretischen Vernunft ist, zuordnen. Im Mittelpunkt steht die Frage der Objektivation einerseits in der Sphäre der Rezeptivität, des schlichten Erfassens, und andrerseits

1 Der Text Nr. 25 wäre sachlich den Texten zur Umarbeitung der VI. Logischen Untersuchung aus dem Winter und Frühjahr 1914 zuzuordnen. Siehe Edmund Husserl, Logische Untersuchungen. Ergänzungsband. Zweiter Teil. Texte für die Neufassung der VI. Untersuchung. Zur Phänomenologie des Ausdrucks und der Erkenntnis (1893/94– 1921), hrsg. von Ullrich Melle, Husserliana XX/2, Springer, Dordrecht, 2005.

einleitung

lxv

in der höheren Form der schöpferisch-spontanen Erzeugung auf der Grundlage der „Akzeptionen“. Besondere Aufmerksamkeit gilt hierbei den Vollzugsweisen des Urteilens und dem Verhältnis von Rezeptivität und eigentlich schöpferischer Urteilsleistung in der prädikativen Synthesis. Die Analysen des Meinens als des gegenständlichen Gerichtetseins im prägnanten Sinn sowie des thematischen und unthematischen Bewusstseins in den Texten Nr. 4 bis Nr. 6 des ersten Teils, die alle aus dem Frühjahr 1911 stammen, sind unter anderem von Interesse für die Genese und die Interpretation des in den nur ein Jahr später verfassten Ideen I eingeführten Begriffs des Noemas. Die umfangreichen Texte des zweiten Teils untersuchen die vorprädikative Erfassung und Explikation von Gegenständen in ihrem Verhältnis zu den kategorialen Denksynthesen und Denkformen. Ein wichtiges Thema in Husserls Analysen ist der Unterschied zwischen eigenschaftlicher Explikation und beziehender Bestimmung als Teil eines Ganzen. Diese Analysen werden in den Texten Nr. 14 und Nr. 15 zu einer umfassenden phänomenologischen Relationstheorie erweitert. Das Verhältnis von Setzung bzw. Stellungnahme – Husserl spricht auch von „Axiose“ – und Substrat der Setzung bzw. Stellungnahme wird in den Texten des dritten Teils, die in unmittelbarer zeitlicher Nähe zur Niederschrift der Ideen I entstanden sind, ausführlichen Analysen unterworfen. Der Bezugspunkt und Hintergrund dieser Analysen ist die Unterscheidung von Materie und Qualität sowie die kritische Auseinandersetzung mit Brentanos Satz von der Vorstellungsgrundlage aller Akte in der V. Logischen Untersuchung. Es geht Husserl in diesen Analysen zum einen um die richtige Konfiguration der Grundbestimmungen der Intentionalität: der Erscheinung bzw. Vorstellung, der Zuwendung, Erfassung und Aufmerksamkeit auf den Erscheinungsgegenstand sowie der doxischen und parallelen Charakterisierungen des Erscheinenden und Vorgestellten. Zum anderen sucht er die Arten, den Aufbau, die Verflochtenheit, die Vollzugsweisen und die Modifikationen der Stellungnahmen zu beschreiben. Besonderes Interesse gilt hierbei der anaxiotischen, d. h. gedankenhaften, Modifikation, dem neutralen Bewusstsein. Es stellt sich diesbezüglich die Frage, ob es sich bei der Anaxiose um den bloßen Nicht-Vollzug von Stellungnahmen handelt oder um einen eigenen Akt des Sich-Denkens bzw. Sich-Hineindenkens.

lxvi

einleitung

Die Texte in den ersten drei Teilen des ersten Teilbandes sind wichtige Ergänzungen und Fortführungen zu den in anderen Bänden der Husserliana bereits veröffentlichten Analysen der sinnlichen und kategorialen Akte. In erster Linie ist hierbei zu denken an den Band XXIII über Phantasie, Bildbewusstsein Erinnerung,1 an den Band XXXVIII über Wahrnehmung und Aufmerksamkeit,2 an den Band XL zur Urteilstheorie3 und die in Band V der Husserliana. Materialien veröffentlichte Vorlesung über Urteilstheorie von 1905,4 dann aber auch an die in den Bänden XI und XXXI unter den Titeln Analysen zur passiven Synthesis und Aktive Synthesen veröffentlichte Vorlesung über „Transzendentale Logik“ aus dem Jahr 1920/21 bzw. 1923 und 1925/26.5 Diese Vorlesung wurde die Hauptgrundlage für die als Erfahrung und Urteil veröffentlichten „Logischen Studien“. Die im vierten Teil des ersten Teilbandes veröffentlichten Texte dürften wohl aus dem Umkreis dieser Vorlesung stammen. Ganz sicher gilt dies für Text Nr. 26. Die große sachliche Nähe vieler hier in den ersten drei Teilen veröffentlichten Texte aus den Jahren 1910 bis 1912 zu Husserls genetischer Begründung der Logik in Erfahrung und Urteil ist zweifelsohne einer der auffälligsten Befunde, der einmal mehr die Kontinuität in der Entwicklung von Husserls Denken deutlich werden lässt. Sowohl Husserls als Text Nr. 27 im fünften Teil wiedergegebener Entwurf einer Einleitung zu Landgrebes Typoskript als auch die in den darauf folgenden Beilagen XLIII bis XLVIII wieder-

1 Edmund Husserl, Phantasie, Bildbewusstsein, Erinnerung. Zur Phänomenologie der anschaulichen Vergegenwärtigungen. Texte aus dem Nachlass (1898–1925), hrsg. von Eduard Marbach, Martinus Nijhoff, The Hague/Boston/London, 1980. 2 Edmund Husserl, Wahrnehmung und Aufmerksamkeit. Texte aus dem Nachlass (1893–1912), hrsg. von Thomas Vongehr und Regula Giuliani, Husserliana XXXVIII, Springer, Dordrecht, 2004. 3 Edmund Husserl, Untersuchungen zur Urteilstheorie. Texte aus dem Nachlass (1893–1918), hrsg. von Robin D. Rollinger, Husserliana XL, Springer, Dordrecht, 2009. 4 Edmund Husserl, Urteilstheorie. Vorlesung 1905, hrsg. von Elisabeth Schuhmann, Husserliana Materialien V, Kluwer, Dordrecht/Boston/London, 2002. 5 Edmund Husserl, Analysen zur passiven Synthesis. Aus Vorlesungs- und Forschungsmanuskripten 1918–1926, hrsg. von Margot Fleischer, Husserliana XI, Martinus Nijhoff, Den Haag, 1966 und Edmund Husserl, Aktive Synthesen: Aus der Vorlesung „Transzendentale Logik“ 1920/21. Ergänzungsband zu „Analysen zur passiven Synthesis“, hrsg. von Roland Breeur, Husserliana XXXI, Kluwer, Dordrecht, 2000.

einleitung

lxvii

gegebenen Manuskripte, die offensichtlich Vorarbeiten zu diesem Entwurf waren, enthalten wichtige Ausführungen zu den methodischen Problemen einer reinen Psychologie und zu den Grundstrukturen der Intentionalität. Bemerkenswert ist, dass Husserl in dieser späten Phase seiner Philosophie nochmals die kritische Auseinandersetzung mit den Grundbegriffen von Brentanos deskriptiver Psychologie als Ausgangspunkt und Leitfaden seiner Überlegungen nimmt. Besonders hinzuweisen ist in dieser Hinsicht auf die Beilagen XLIV und XLV. Der Text der Beilage XLIV enthält eine Kritik an Brentanos Klassifikation der psychischen Phänomene. Husserl zeigt, dass es bei einer solchen Klassifikation nicht um eine empirischinduktive Klassifikation als Analogon der naturhistorischen Klassifikationen gehen kann. Im Text der Beilage XLV macht Husserl dann geltend, dass die Erforschung der Erlebnisse als zeitliche Realitäten, d. h. die reelle Analyse der Erlebnisse, zwar möglich, aber ein ganz untergeordneter Gesichtspunkt für die Bewusstseinsforschung ist. Das primäre wissenschaftliche Interesse hat der Analyse der Funktionen der intentionalen Erlebnisse im ichlichen Leben zu gelten. * Die im zweiten und dritten Teilband unter den Titeln „Gefühl und Wert“ sowie „Wille und Handlung“ veröffentlichten Texte befassen in größtmöglicher Vollständigkeit Husserls Anstrengungen, um auch die Phänomene des Gemüts- und Willensbewusstseins (der Gefühlsempfindungen, Gefühlsakte und Gefühlsaffekte, des Wünschens und des Wollens in Form des Wählens und Sich-Entschließens sowie des die Handlung initierenden und ausführenden Wollens, des unabsichtlichen Tuns und der passiven Tendenzen und Strebungen) in ihrer intentionalen Leistung und ihren Vollzugsweisen deskriptiv zu erforschen. In den bisherigen Bänden der Husserliana finden sich nur verstreut an vereinzelten Stellen Hinweise auf und kurze Ausführungen zur Phänomenologie des Fühlens und Wollens. Selbst die Husserls Vorlesungen zur Axiologie und Ethik gewidmeten Bände – Band XXVIII mit Husserls Göttinger Vorlesungen zur Axiologie und Ethik sowie Band XXXVII mit Husserls historisch orientierter Freiburger Vorlesung zur Ethik von 1920 bzw. 1924 – enthalten nur

lxviii

einleitung

Weniges von Husserls konkreter Forschungsarbeit an den Gemütsund Willensphänomenen.1 Husserls gemüts- und willensanalytische Untersuchungen entstehen zum größten Teil im Umkreis dieser Vorlesungen zur Axiologie und Ethik, die von Husserl in Analogie zur Logik als apriorische Prinzipienlehren der Vernunftgeltung im Werten und Wollen aufgefasst werden. Als solche bedürfen sie einer Begründung in einer Phänomenologie der fühlend-wertenden und wollend-handelnden Vernunft. Die phänomenologische Analyse der wertgebenden Gefühlsakte und der Willenssetzungen muss zeigen, dass Wahrheit und Vernunftgeltung nicht auf die theoretische Vernunft, auf das Urteilen und Denken, beschränkt sind, sondern dass es eine auf die theoretische Einsicht irreduzible Gefühls- und Willenswahrheit gibt. Die Grundvoraussetzung von Husserls phänomenologischer Forschung ist die synthetische Einheit des Bewusstseins: Das Bewusstsein ist kein ungeordnetes Chaos, kein zusammenhangloser Haufen heterogener Phänomene. Diese synthetische Einheit differenziert sich in die zeitliche Einheit des Bewusstseins, die strukturelle und motivationale Einheit und, was in Texten des dritten Teilbandes ausführlich behandelt wird, die tendenziöse oder Strebenseinheit. Alle Bewusstseinsphänomene haben Teil an und fügen sich ein in diese Einheitsformen und sind dadurch aufs Engste miteinander verflochten. Eine solch enge Verflochtenheit setzt ein hohes Maß an struktureller Homogenität und Affinität der Phänomene voraus. Husserls Forschungsstrategie im Gebiet der besonders schwer fassbaren Gemüts- und Willensphänomene wird durch diese Voraussetzung geleitet, indem er bei den Gemüts- und Willensphänomenen die Parallelen zu den bei den intellektiven Phänomenen bereits vielfach aufgewiesenen und gesicherten Strukturen zu fassen sucht. Dieser Forschungsansatz sieht sich konfrontiert mit der in den Logischen Untersuchungen aufgeworfenen Grundfrage nach der Unterscheidung und dem Verhältnis zwischen objektivierenden und nicht-objektivierenden Akten, d. h. nach der Intentionalität und Konstitutionsleistung der Gemütsund Willensphänomene, nach ihren je spezifischen Objektivitäten. 1

In den „Vorlesungen über Grundfragen zur Ethik und Wertlehre“ von 1914 findet sich ein Abschnitt zur Phänomenologie des Willens, in dem Husserl seine willensanalytischen Forschungen zusammenfasst. Siehe Husserliana XXVIII, S. 102–125.

einleitung

lxix

Hierbei ergibt sich nun jedoch ein grundlegender Unterschied zwischen Gemüt und Willen: Bestimmte Gemütsakte erfüllen eine kognitive Funktion, sie haben den Charakter eines nicht-intellektiven Erkennens von spezifischen Gefühlsobjekten, den Werten. Husserl parallelisiert den Akt ursprünglicher Wertgegebenheit terminologisch öfters mit dem sinnlichen Wahrnehmen und bezeichnet ihn als Wertnehmen oder Wertnehmung. Es handelt sich hierbei um einen Gefühlsakt, den Husserl in der Regel als „Gefallen“ bezeichnet. Die spezifische Willensobjektivität demgegenüber ist die Handlung, ein durch einen einleitenden Willensimpuls, das fiat, bewirkte und durch einen Handlungswillen inszeniertes leibliches Verhalten. Das Wollen ist fundiert in und motiviert durch ein wertendes Gefallen, aber es ist offensichtlich nicht selbst ein gegenstandsgebender und erfassender Akt. Das Wollen als spontaner Akt hat in Bezug auf das gewollte Ziel und die Wahl des dazu geeigneten Mittels und selbst in Bezug auf den Handlungsvollzug vielmehr den Charakter einer den doxischen Setzungen analogen Willenssetzung in Form der Entscheidung, des fiat und des Handlungswillens Wie schon in den Beschreibungen des Meinens und der Zuwendung, des Substratbewusstseins und der Stellungnahmen in den Texten des ersten Teilbandes spielen auch in den Analysen der Gemütsund Willensphänomene die Vollzugsweisen und damit verbunden das Thema des Verhältnisses von Aktivität und Passivität eine wichtige Rolle. Als Gemütspassivität werden in erster Linie die Gefühlsempfindungen wie Lust und Unlust aufgefasst, während die Willenspassivität unter den Titeln Neigung, Trieb, Tendenz und Streben zum Thema wird. * Was die Gemütsanalysen im zweiten Teilband betrifft, so steht der Gefühlscharakters des Wertens, die originale Gegebenheit von Werten in Gefühlen, im Mittelpunkt dieser Analysen. Das Problem, mit dem Husserl hierbei ringt, ist die Frage, wie sich der Gefühlscharakter mit einer Vorstellungsleistung des Fühlens vereinbaren lässt. Husserl versucht, das wertgebende Fühlen nach Analogie mit dem Wahrnehmen als eine Auffassung von Gefühlsempfindungen, als eine Wertapperzeption, zu fassen. Dies impliziert jedoch eine weitgehende

lxx

einleitung

Intellektualisierung der Werterfahrung, was Husserl dazu führt, um zwischen den Wertapperzeptionen und den Gefühlsreaktionen auf die erfahrenen Werte zu unterscheiden. Diese Gefühlsreaktionen sind dann die eigentlichen Gefühlsaffekte, die sich nach ihrem Ablauf zu Stimmungen ausweiten und als solche nachwirken können. Es stellt sich dann allerdings die Frage nach der Intentionalität dieser Gefühlsreaktionen und Stimmungen und damit nach ihrer konstitutiven Leistung. Husserl spricht davon, dass sie Gegenstände in ein bestimmtes Gefühlslicht tauchen und ihnen eine bestimmte Gefühlsfärbung verleihen. Eine besondere Erwähnung verdienen die im zweiten Teilband in der Gruppe A unter dem Titel „Wert und Billigung“ zusammengefassten Texte. Unter diesen befinden sich die drei frühesten, noch aus der Zeit vor dem Erscheinen der Logischen Untersuchungen stammenden Texte der vorliegenden Edition, wovon allerdings nur noch der Text Nr. 1 in der ursprünglichen Niederschrift vorliegt. Die Texte Nr. 2 – Nr. 5 sind nach Husserls eigenen Angaben umgearbeitete und ergänzte Abschriften aus den Jahren 1907/08 bzw. 1909/10 von vermutlich zwei Manuskripten, die vor 1900 entstanden sind. Wann genau und in welchem Zusammenhang diese frühesten Texte entstanden sind, lässt sich nicht sicher sagen. Man könnte vermuten, dass sie aus dem Umkreis der Vorlesung über „Ethik und Rechtsphilosophie“ aus dem Jahr 1897 stammen.1 Der Begriff der „Billigung“ verweist auf Humes Moralphilosophie, mit der Husserl sich in seiner Vorlesung über Ethik von 1902 intensiv auseinander gesetzt hat. Im Wintersemester 1908/09 hat Husserl, parallel zu seiner Vorlesung über „Grundprobleme der Ethik“, zudem ein Seminar zu Humes Schrift Eine Untersuchung über die

1 Von dieser Vorlesung ist nur ein wenige Seiten umfassendes Fragment erhalten, das als Ergänzender Text Nr. 1 in Husserliana XXVIII, S. 381–384 veröffentlicht ist. Das Fragment liegt im Konvolut F I 20, in dem sich auch die als Ergänzende Texte Nr. 2 und Nr. 3 in Husserliana XXVIII veröffentlichten Stücke aus Husserls Vorlesung „Grundfragen der Ethik“ von 1902 befinden. Im ersten dieser Stücke setzt Husserl sich kritisch mit Humes Moralphilosophie auseinander (siehe Husserliana XXVIII, S. 384–402). Den Blättern mit dieser Hume-Kritik liegt eine kurze Zusammenfassung von Humes Argumenten für eine Gefühlsmoral voran, die wohl dem Schriftbild nach einige Jahre früher, also vor 1900, verfasst wurde (siehe hierzu Husserliana XXVIII, S. 514).

einleitung

lxxi

Prinzipien der Moral gegeben.1 Billigung bzw. Missbilligung sind die moralischen Gefühle, in denen die Quelle der ethischen Unterscheidungen liegt. Die fundamentale Frage ist nun, so Husserl, ob „die Gründung der Moral auf das Gefühl, genauer gesprochen, auf Gemütstätigkeiten überhaupt die Dahingabe der strengen Allgemeingültigkeit oder allgemeinen Verbindlichkeit der ethischen Normen zur notwendigen Folge hat?“2 Es geht Husserl in den Ergänzenden Texten Nr. 1–5 und Nr. 8 um die Bestimmung der Gemütsevidenz in der Werterfahrung in Analogie mit der Bestimmung der Urteilsevidenz. Im reflektiven Akt der Billigung eines Aktes wird sowohl dessen Richtigkeit als auch dessen Werthaftigkeit festgestellt und anerkannt, wobei diese Anerkennung ein positives Gefühl, ein Gefallen, ist. In diesen Texten setzt Husserl sich offensichtlich, ohne dies jedoch explizit zu benennen, mit Brentanos Bestimmung der Gemüts- und Urteilsevidenz, vor allem auch mit dessen Auffassung, dass die Begriffe von Wert und Wahrheit ihre Quelle in einer inneren Anschauung von als richtig charakterisierten Gemüts- und Urteilsakten haben, auseinander. Bemerkenswert ist, dass der Akt der Billigung in Husserls übrigen Analysen der Gemütsphänomene und der Werterfahrung keine nennenswerte Rolle mehr spielt. * Was nun den dritten Teilband betrifft, so sind die ersten drei, aus den Jahren 1910 bis 1914 stammenden Haupttexte der Analyse der verschiedenen Willensformen und Handlungsarten gewidmet. Husserl unterscheidet zwischen drei wesentlich verschiedenen Willensformen: dem Entschlusswillen, dem fiat als dem eine Handlung in Gang setzenden Willen und dem die Handlung tragenden und ausführenden Willen. Was die Handlungen betrifft, so gilt es, die schlichte Handlung von den zusammengesetzten Handlungen zu unterscheiden. In den Haupttexten IV und V aus den Jahren 1909/10 setzt Husserl sich mit dem Problem der Bestimmung des Unterschiedes und 1 2

Siehe Husserl-Chronik, Husserliana Dokumente I, S. 121. Husserliana XXVIII, S. 390.

lxxii

einleitung

des Verhältnisses zwischen Willens- und Naturkausalität auseinander. Inwieweit ist schöpferisches Wollen und Handeln verträglich mit der universalen kausalen Gesetzmäßigkeit der Natur? Die Weise, wie die Handlung aus dem Wollen hervorgeht, ist nicht die der Verursachung einer Tatsache durch eine andere, davon getrennte Tatsache, auch wenn das Wollen nicht notwendig in die gewollte Handlung übergeht; das Wollen kann an seiner Ausführung in der Handlung gehemmt werden. Man kommt Husserl zufolge zu „schiefen Problemen“, wenn man nicht sieht, dass es unterschiedliche Formen von Kausalität gibt. Nur die naturwissenschaftlich-physikalische Kausalität hat die Form der Exaktheit, und diese exakte Natur ist ein ideales Konstruktionsgebilde. Die funktionalen Beziehungen zwischen Naturdingen und psychischen Vorgängen, die unter psychophyischen Gesetzen stehen, entbehren der Exaktheit. Der Wille als psychisches Geschehen ist kein Naturvorgang, er ist zwar wie alles psychische Geschehen funktional abhängig vom Nervensystem, aber er selbst übt keine Kausalität weder im naturwissenschaftlich-exakten noch im funktionalpsychophysischen Sinn. Die Weise, wie aus dem einleitenden fiat die Handbewegung hervorgeht ist ein ganz anderes „infolge“ als das zwischen Nervensystem und Psychischem. Der bedeutende Haupttext VI stammt aus dem sogenannten Pfänder-Konvolut, dessen übrige Manuskripte in der Gruppe D der Ergänzenden Texte wiedergegeben sind. Es handelt sich um Manuskripte, die durch die Lektüre von Alexander Pfänders Abhandlung „Motive und Motivation“ von 19111 angeregt wurden. Der dem PfänderKonvolut zugehörige Ergänzende Text Nr. 42 hat den Charakter eines fragmentarischen Entwurfs einer Einleitung, was darauf schließen lässt, dass Husserl im Sommer 1914 eine eigene Abhandlung zu den Willensmodalitäten und ihren Abwandlungen plante. Die Untersuchungen sollen sich dabei „innig an eine allgemeine Untersuchung der möglichen Strukturen des Wollens“ anschließen; sie sind „ganz

1 Vgl. Alexander Pfänder, „Motive und Motivation“, in: Münchener Philosophische Abhandlungen, Theodor Lipps zu seinem sechzigsten Geburtstag gewidmet von früheren Schülern, hrsg. von A. Pfänder, Leipzig 1911, S. 163–195. Zum PfänderKonvolut siehe auch Karl Schuhmann, Die Dialektik der Phänomenologie I: Husserl über Pfänder, Martinus Nijhoff, Den Haag, 1973, S. 98–112.

einleitung

lxxiii

unerlässlich, um die Grundbegriffe der Ethik einer entscheidenden Klärung entgegenzuführen“.1 Husserl rühmt Pfänders Abhandlung, sie lässt „durch Tiefe und Sorgsamkeit der Analyse“ alles Bisherige auf dem Gebiet der deskriptiven Erforschung der Willenssphäre weit hinter sich. Vielem kann Husserl beistimmen. Gleichwohl bildet die Abhandlung angesichts der „außerordentlichen Schwierigkeiten der Materie nicht das Ende, sondern den Anfang einer Fundamentalforschung der Willenssphäre“.2 Husserl will sich nicht im Einzelnen mit Pfänders Analysen auseinandersetzen, sondern durch sie angeregt seine eigenen Forschungen durch- und fortführen. Er will dabei ausgehen von den Strukturen in der doxischen Sphäre, um von daher zu versuchen, die Parallelen in der Willenssphäre und dann auch „in der Sphäre der Fühlungen und Begehrungen“ zu erfassen. Der Entwurf bricht nach einigen Analysen der einfachsten Bewusstseinsgestaltungen in der doxischen Sphäre ab. Der aus dem Pfänder-Konvolut stammende Haupttext VI enthält ebenfalls Parallelbetrachtungen zwischen den doxischen Akten und den Willensakten; diese erfolgen jedoch vor allem im Hinblick auf das Husserls spätere Willensanalysen beherrschende Thema des Verhältnisses zwischen Passivität und Spontaneität in der Willenssphäre. Wie verhält sich das Wollen als spontaner Akt, als Ichvollzug, zum unwillkürlichen Tun? Was sind die Formen und Antriebe dieses unwillkürlichen Tuns? In den Ergänzenden Texten der Gruppe C, die einem Konvolut entstammen, das die Signatur „Td“ für „Tendenz“ trägt, versucht Husserl den dynamischen Spannungscharakter des Bewusstseins in allen seinen Akten zu erfassen. Von Reizen gehen Tendenzen zur Zuwendung aus, zum Vollzug von aufmerkenden Ichakten, in denen dann selbst wiederum Tendenzen zum Fortgang wirksam sind. Wenn

1 Dritter Teilband, S. 391. Diese Bemerkungen können als impliziter Verweis auf Husserls Vorlesungen über „Grundfragen zur Ethik und Wertlehre“ vom Sommersemester 1914, in dem er die Ergebnisse seiner Analyse der Willensformen in einer allgemeinen Strukturbeschreibung zusammengefasst hat, verstanden werden. Die Vorlesung ist in Husserliana XXVIII, S. 3–153 veröffentlicht. 2 Dritter Teilband, S. 392.

lxxiv

einleitung

Tendenzen als Willenspassivität gelten, muss dem Bewusstsein als ganzem ein Willenscharakter zugesprochen werden. Husserl behandelt die Willenspassivität unter verschiedenen Bezeichnungen: Tendenz, Neigung, Drang, Streben, Trieb. In verschiedenen Manuskripten aus den zwanziger Jahren, unter anderem im Haupttext XII, hebt Husserl den universalen Strebenscharakter des Bewusstseinslebens hervor. Besondere Aufmerksamkeit widmet er in mehreren Texten dem Erkenntnisstreben. Das Willens-Ich verhält sich zu diesem vorichlich-unwillkürlichen Streben, dem Spiel der Neigungen bzw. Tendenzen: Es erfährt Affektionen, es verwandelt ein unwillkürliches Tun in ein willkürliches oder es widersetzt sich einer Tendenz, es entscheidet einen Konflikt zwischen verschiedenen Neigungen, es überwindet eine Hemmung durch eine Willensanstrengung etc. * Die vorangehenden Hinweise zum Inhalt von Husserls Bewusstseinsdeskriptionen in den Forschungsmanuskripten, die in den drei Teilbänden der vorliegenden Edition wiedergegeben werden, erschließen keineswegs den Reichtum und die Differenziertheit der Analysen. Sie werden vor allem dem lebendigen und explorativen, öfters mit Unterscheidungen und Benennungen experimentierenden Charakter von Husserls Deskriptionen nicht gerecht. An vielen Stellen seiner Texte gibt Husserl noch bestehenden Bedenken und Zweifeln oder dem Bewusstsein noch bestehender Undeutlichkeit und Unabgeschlossenheit Ausdruck. Es wird aus diesen Texten verständlich, warum Husserl immer wieder die Schwierigkeit des phänomenologischen Sehens und den Arbeitscharakter des phänomenologischen Forschens betont hat und er sich selbst als Entdeckungsreisenden in einem neu entdeckten Kontinent verstanden hat. * Die Arbeit an dieser Edition hat sich über ein viertel Jahrhundert erstreckt. Wer in dieser langen Zeit auf welche Weise der Edition behilflich war, entzieht sich leider vielfach der Erinnerung. Den vielen Helfern sei deshalb hier ungenannt gedankt. Dr. Thomas Vongehr

einleitung

lxxv

hat die mühsame Arbeit der Erstellung des textkritischen Apparats einschließlich der umfangreichen Tabelle auf sich genommen. Er hat auch maßgeblich zur Herstellung der Textgrundlage der Edition beigetragen. Ich danke ihm für die gute Zusammenarbeit. Die Konzeption der Edition, die Auswahl und Einteilung der Texte sowie alle Titel stammen von mir. Für hilfreiche Anmerkungen zur „Einleitung“ danke ich meinem ehemaligen Kollegen und vormaligen Direktor des Husserl Archivs Prof. Dr. Rudolf Bernet. Leuven, März 2018 Ullrich Melle

I. ZUR INTENTIONALITÄT DER OBJEKTIVATION IM URTEILEN, MEINEN UND STELLUNGNEHMEN

Nr. 1 A l l g e me i n e U n te r sc he id u n g e n b e i a l le n A kt en. Gru nd a rt e n v on A kte n u nd G e g ens tä nd e n 1

5

Inhalt: 1) Allgemeine Unterscheidungen bei allen Akten. Das Intentionale, Objektionale, Apparenziale. Attentionale Modifikationen. 2) Akte erster und höherer Stufe, wobei Akt = „cogito“. Gegenstände erster und höherer Stufe. 10 3) Primäre Gegenstände und Reflexionsgegenstände, ebenso für Bewusstsein. Phanseologische Reflexion und semasiologische, apperzeptive Reflexion. Reine Reflexionsgegenstände. Gemischte Reflexionsgegenstände. 4) Immanente und transiente Gegenstände. Immanenz = reines Be15 wusstsein. Empirisches Bewusstsein. Natur – Geist (phanseologische Reflexion).

§ 1. Die Unterscheidung zwischen Intentionale, Objektionale und Apparenziale. Der gebende Akt und sein Intentionale als Erscheinung. Schlichte und höherstufige Akte2

20

Wir gehen aus vom Bewusstsein, und zwar setzen wir voraus den durchgehenden Unterschied zwischen Im pre ssi on u nd Re pro d u kt i o n. Jedes Bewusstsein ist entweder impressionales (aktuelles Vorstellen, Denken, Wünschen etc.) oder reproduktives (gleichsam 1

Wohl aus 1910. Mit späteren Anmerkungen, möglicherweise aus 1918. – Anm. der Hrsg. 2 Intentionale, wohl = Noema.

© Springer Nature Switzerland AG 2020 U. Melle, T. Vongehr (Hrsg.), Studien zur Struktur des Bewusstseins, Husserliana: Edmund Husserl – Gesammelte Werke 43-I, https://doi.org/10.1007/978-3-030-35788-7_1

1

2

5

10

15

20

25

30

zur intentionalität der objektivation

Vorstellen, Denken etc.), und zu jeder Bewusstseinsartung gehören diese zwei genau parallelen Möglichkeiten. Wir beschränken uns auf impressionales Bewusstsein und dabei wieder auf „meinendes“ Bewusstsein.1 Wir schließen Hintergrundbewusstsein aus, wir beschränken uns auf „Ak t e“ (im spezifischen Sinn meinende), intentionale Erlebnisse. Wir denken uns entworfen eine Klassifikation derselben. Jedes solche Erlebnis hat sein In te n t i ona le2 (seinen intentionalen Inhalt) und bezieht sich dadurch auf einen in te nt iona l e n G ege n st an d (den intendierten). Wir sagen dann: Wenn das Intentionale ein gültiges ist (Wahrheit), so entspricht der vermeinten Gegenständlichkeit als solcher (X) in „Wirklichkeit“ oder in „Wahrheit“ eine „ebensolche“ Gegenständlichkeit (das wahre X). Wir müssen hier noch einen Unterschied machen, nämlich zwischen der eventuell w ah ren Gegenständlichkeit einerseits, a ls genau dem Sinn, dem Intentionale entsprechende: das Gegenständliche als so und so, i n d e r un d de r Be deu tun g in t en di e rte s3 – z. B. ich nehme ein rotes Haus wahr, und es ist das Vermeinte in Wirklichkeit, die entsprechende Wirklichkeit, das wahrhaft seiende rote Haus, das Wahrhafte genau in der Form „rotes Haus“4 –, und andererseits dem Ge g e n s t a n d sc hl ech t h i n: das identisch gemeinte „dieser“ mit anderen Bedeutungsinhalten. In erster Hinsicht stellen wir dem Intentionale (und dann auch dem Akt) gegenüber das O b je kt io na l e und unterscheiden es vom O b je kt. Man könnte auch unterscheiden das Objektionale als das W a hr e, das Objekt als das S e ie n de.5 Es gibt nun so viele grundverschiedene Gattungen von Akten, als es grundverschiedene Gattungen von Intentionalien gibt, und jeder solchen entspricht eine grundverschiedene Gattung von Objektionalien (von entsprechenden Wahrheiten) und wieder von Objekten selbst. Noch einen Begriff wollen wir hier einführen (ohne damit zu sagen, dass nicht noch andere analoge Unterscheidungen möglich

1

Wohl cogito im Sinn der Ideen. Wohl = Noema. Das X. 3 Wohl: Das Wahre = das wahre Intentionale = das wahre Noema. 4 Das Intentionale und Objektionale, der ganze gegenständliche Sinn, und Objekt, der Gegenstandspol selbst. 5 Objekt in unmodifizierter Rede. 2

text nr. 1

5

10

15

20

25

30

3

sind).1 Wenn das Intentionale gültig ist, so entspricht ihm mögliche Gegebenheit, „psychologisch“ gesprochen: ein möglicher „wahrnehmender“ Akt. Wir können a priori und allgemein sagen: Zu jeder Grundgattung von Akten gehört die fundamentale Unterscheidung zwischen selbstgebenden und nicht-gebenden, wahrnehmenden und nicht-wahrnehmenden Akten. Jedem nicht-wahrnehmenden Akt entspricht zwar nicht ein möglicher wahrnehmender, aber jedem möglichen wahrnehmenden ein oder viele nicht-wahrnehmende Akte von gleichem Intentionale. Der wahrnehmende Akt, der „gebende“, hat sein Intentionale, er ist Bewusstsein von einem Inhalt, aber nicht bloß das; es „er sch ei nt“ darin auch das Objektionale, es ist bewusst eine „Erscheinung“ desselben. Unter E r s c he in u n g verstehen wir nicht das gebende Bewusstsein, sondern das in ihm bewusste Was, aber nicht verstanden als bloß Vermeintes (das identisch dasselbe sein könnte in einem nichtgebenden Akt), sondern das Er s c he in end e a ls s ol c he s, so wie es da erscheint. Zum Beispiel im Dingwahrnehmen erscheint das Ding, und das Ding-Erscheinende als solches ist nicht das Ding selbst (das vielleicht gar nicht existiert), sondern die Erscheinung, die die und die erscheinenden Farben, Formen etc. impliziert, während zum Beispiel von der „Rückseite“ und ihren Bestimmtheiten nichts eigentlich erscheint und doch in einer bevorzugten Weise „mitwahrgenommen“ ist. Wir nennen dieses vom bloßen Intentionale unterschiedene W a s der gebenden Akte die A p p a r e nz i a l i e n. Wir können noch hinzufügen: Jeder Akt kann gewisse attentionale Modifikationen erfahren, wodurch er schließlich aufhört, ein „meinendes“, „intendierendes“ Bewusstsein zu sein. Er geht in ein verworrenes, meinungsloses Hintergrundbewusstsein über und von da eventuell wieder in ein Vordergrundbewusstsein, wobei hinsichtlich der Meinung Unterschiede bestehen können zwischen bevorzugend Gemeintem und in zweiter Linie Gemeintem etc. (Unterschiede der Aufmerksamkeit und negative Aufmerksamkeit).2

1

Apparenzialien. Der Unterschied zwischen Verworrenheit und Deutlichkeit und Klarheit und Unklarheit (Evidenz) gehört zu allen Akten. Er gehört daher in die allgemeinste Bewusstseinslehre neben den Unterschied von Impression und Idee und den Unterschied der Akte, in die ein Vermeinen sich hineinlebt (und so ein Objektivieren erzeugt), und 2

4

zur intentionalität der objektivation § 2. Schlichte und fundierte Akte – Gegenstände erster und höherer Stufe

5

10

15

20

25

30

Wir nennen einen Akt (worunter wir immer ein Meinen, ein Zugewendetsein verstehen, wenn auch nicht gerade eine primäre Zuwendung) einen A kt s c h li c h t er A r t o d er u nt er st e r St uf e, wenn er keinen „Akt“ als Unterlage voraussetzt.1 Eine Wahrnehmung im gewöhnlichen Sinn (sinnliche Wahrnehmung) ist ein schlichter Akt; zwar hat er notwendig einen „Hintergrund“, er ist ein meinendes Bewusstsein, das gleichsam in einem umfassenden Bewusstsein meinend eine Grenze setzt.2 Wir können zwar auch sagen, das Objekt sei herausgemeint aus einem Zusammenhang, aber das Hintergrundbewusstsein ist kein meinendes, und der Akt als solcher ist schlicht. Ist aber aus dem Gesamthintergrund ein Vorzug gesetzt, etwa als Herausgreifen einer Gruppe von Gegenständen, die als gemeinte dastehen, und ist da wieder ein Gegenstand herausgemeint als Gegenstand aus dieser Gruppe, so ist das Bewusstsein schon fundiert. Ebenso, wenn an einem erscheinenden Gegenstand die Farbe beachtet wird. Zunächst sei etwa der Gegenstand wahrgenommen (gemeint), und dann wende sich das Meinen dem Moment Farbe zu. Ist diese Meinung eine ausschließliche (nicht ausschließend im Sinn eines Ausschließungsbewusstseins, sondern in dem Sinn, dass ausschließlich auf diesen Inhalt „rot“ geachtet wird), so ist dieses Bewusstsein ein schlichtes, wenn nicht in eins damit das Aktbewusstsein des konkreten Gegenstandes (meinend) erhalten bleibt, etwa in der Form, die wir zirkumskriptiv andeuten mit den Worten: das Rot am Gegenstand, das Rot dieses Dinges. Ein solches Bewusstsein wäre nicht ein schlichtes, ein Bewusstsein unterster Stufe, sondern schon ein als Akt fundierter Akt. Und er hätte als solcher schon einen „G e g e n st a n d h ö h e r e r S t uf e“. Denn das Eigentümliche der höherstufigen Akte ist, dass sie, auf Akte neu bauend, ein intentionales Ganzes, ein Ganzes der Art Akt herstellen, in dem nicht

der Akte, die diesen Vorzug nicht haben. Wobei jeder Akt von der einen in die andere Einstellung kommen kann, bei Erhaltung eines abstrakt gemeinsamen Wesens. 1 „Akte“ erster und höherer Stufe. 2 Akt = „Meinen“ = „cogito“ im Sinn der Ideen.

text nr. 1

5

nebeneinander und gesondert verschiedene Gegenstände gemeint sind, sondern ein Gegenständliches, das sich gewissermaßen durch all die Aktmomente aufbaut. Bei den im Sinn höherer Ordnung fundierten Akten können Akte als Unterlagen fungieren, die ge5 geneinander selbständig sind, sofern sie auch für sich sein könnten. Aber eine Einheit der Meinung geht durch sie hindurch, und das tut sie vermöge eines verbindenden Aktmoments (z. B. Kollektion, darüber Logische Untersuchungen). Dem entspricht die Einteilung der Gegenstände in Gegenstände erster Stufe und solche höherer 10 Stufe. Die ersteren sind solche, die nur in einem schlichten Akt zur Gegebenheit1 kommen können; die anderen, die nur in einem Akt höherer Stufe zur Gegebenheit kommen können.

§ 3. Primäre Gegenstände und sekundäre Reflexionsgegenstände. Verschiedene Arten der Reflexion: die phanseologische Reflexion auf Akte und die Reflexion auf Bedeutungen und Erscheinungen. Das reine Ich als ein reines Reflexionsobjekt

15

Die Gegenstände können wir ferner einteilen in p ri m ä r e Ge g e n st ä n de und R e f l e x i o ns g e g e n st än de. Ein Ding ist ein pri20 märer Gegenstand; der undeutliche sinnliche Inhalt im verschwommenen Sehen, im unfixierten Sehen ist ein primärer Gegenstand. Ein Reflexionsgegenstand ist hingegen das wahrnehmende Meinen, das Moment der Setzung oder Nichtsetzung (zum Beispiel, wenn ich ein Bildobjekt betrachte). Zum Wesen des Ak t be w us s ts ei n s 25 d e r R efl e x i o n gehört es, dass es sich anschließt an ein vorgängiges Aktbewusstsein, das ihm in gewisser wesentlicher Weise als Voraussetzung vorangegangen ist.2 Es bedarf einer Basis, einer Basis der Reflexion. Andererseits konstituiert sich nicht wie in einem Bewusstsein höherer Stufe (das hier nicht vorliegt) ein Gegenstand höherer 30 Stufe. Selbst wenn ein Ich ein Meinen zum Objekt macht, habe ich nicht ein fundiertes Bewusstsein; das Gemeinte ist nicht Bestandstück

1 2

Zur Gegebenheit oder zu einer deutlichen, expliziten Gemeintheit. Akt immer = cogito.

6

5

10

15

20

25

30

zur intentionalität der objektivation

des meinenden Aktes der Reflexion. Der Akt, auf den ich hinblicke, bzw., wie es besser heißt, auf den ich reflektiere, und der Akt der Reflexion selbst bilden nicht zusammen einen Akt höherer Stufe. Genauer ist aber noch zu sagen: Ein p r im är er G e ge ns t an d ist ein Gegenstand, der in einem nicht-reflektierenden Bewusstsein zur Gegebenheit kommt. Ein Reflexionsgegenstand kommt in einem reflektierenden Bewusstsein zur Gegebenheit. Natürlich gibt es aber auch Reflexionsgegenstände höherer Stufe. Wir können von einem primären Gegebenheitsbewusstsein sprechen. So ist z. B. das Urteilsbewusstsein „Dieses Papier ist weiß“, wenn es sich um ein sinnliches Wahrnehmungsurteil handelt, ein primäres Gegebenheitsbewusstsein. Natürlich ist auch jede sinnliche Wahrnehmung eine primäre Wahrnehmung. Loc kes Reflexion ist eine reflektierende Wahrnehmung, ein reflektierendes Gegebenheitsbewusstsein. Der Unterschied geht natürlich über in die Modifikationen; primäres und reflektierendes Anschauungs- (Phantasie-)bewusstsein. Es fragt sich dann, ob man nicht ve rs ch ie de ne Ar t en de r R e f l e x i o n unterscheiden muss: 1) die phanseologische Reflexion, die auf „Akte“ und Aktmomente. Aber auch: 2) die Reflexion auf die Intentionalien (Bedeutungen), auf die Apparenzialien (Erscheinungen im ontischen Sinn) und sogar auf die Objektionalien. Auf das Gemeinte als solches muss „reflektiert“ werden; es ist nur ein sekundär zu Gebendes durch Änderung der ursprünglichen Blickrichtung, die nicht zufällig vorangeht. Aber auch auf das Gegebene als solches muss reflektiert werden; denn zum Gegenstand muss es erst werden, vorher ist das Objekt der Gegenstand.1 3) Man möchte sagen, jedes „immanente“ Objekt ist ein Reflexionsobjekt. Das sinnliche Datum, das ich empfinde, ist ein sekundäres Objekt. Es erscheint ein Gegenstand, ein Ding und an ihm etwa die Farbe. Aber die Empfindungsfarbe wird Objekt erst durch Reflexion. 4) Wie steht es mit der Einheit des Gegenstandes gegenüber der erfüllten Dauer und ihren erfüllenden Momenten? Ist das Letztere auch durch Reflexion gegeben? Da wird man nicht so einfach Ja sagen und das in eine ganz andere Linie rechnen.

1 2a) Alle Hintergrunderlebnisse sind natürlich Reflexionsgegenstände, sind es doch schon die Vordergrunderlebnisse als „Erlebnisse“.

text nr. 1

5

10

15

20

25

30

35

7

Sind alle „Reflexionen“ von einem gemeinsamen allgemeinen Wesen? Man wird aber jedenfalls doch einen guten Grund haben, das Primäre gegenüber dem Reflektierten zu unterscheiden und von diesem Gesichtspunkt aus die Objekte möglicher Erkenntnis zu gruppieren. Diese Einteilung in primäre und sekundäre Gegenstände kreuzt sich mit der Einteilung der Gegenstände in schlichte Gegenstände und Gegenstände höherer Stufe. Jede phanseologische Reflexion, die z. B. auf Akte der Freude, ist ein Akt erster Stufe. Denn nicht das Fundiertsein macht einen Akt zu einem Akt höherer Stufe, sondern ein so Fundiertsein, dass der Gegenstand des Aktes höherer Ordnung die Gegenstände der fundierenden Akte zu einer höheren Gegenständlichkeit verknüpft und gewissermaßen in sich fasst. Wenn ich auf die Freude darüber, dass warmes Wetter eingetreten ist, reflektiere, so ist dieser Gegenstand „Freude über den und den Sachverhalt“ nicht ein Gegenstand, der den seienden Sachverhalt selbst einschließt. Er schließt das urteilende Vermeinen, dass schönes Wetter sei, ein, aber nicht den Sachverhalt selbst. Nun wird man fragen, ist das Sich-Freuen nicht ein Gegenstand höherer Stufe, da es doch gebaut ist auf ein Meinen, es sei schönes Wetter, und dieses nicht nur voraussetzt, sondern einschließt? Das ist verführerisch. Es ist aber dagegen zu sagen: Die Reflexion, die als „phänomenologische Wahrnehmung“ das konkrete Freudenerlebnis zum Objekt macht, richtet sich auf das verwobene Ganze dieses Aufeinander beider Akte. Die Gegenstände beider gehen in ihren Gegenstand nicht ein. Aber auch davon abgesehen: Die Reflexion ist nicht ein komplexes Gebilde, das irgendwelchen Akt zunächst vollzieht, darauf eine höhere Aktstufe baut, die nun den Gegenstand der unteren mit dem, was die höhere, vergegenständlichende, leistet, in sich fasste. Es ist nicht so, dass etwa zuerst auf den urteilenden Akt reflektiert werden müsste (als Unterlage) und dass nun der Gegenstand der Gesamtreflexion stufenweise auf diesen Gegenstand gebaut wäre, sondern in einer und derselben Aktstufe, und zwar in schlichter, ist die Freude da, und die Freude voll genommen impliziert das Vermeinen, es sei schönes Wetter. Das gilt nun von allen Akten. Sie sind schlichte Gegenstände, als Gegenstände erster Stufe gegeben. Zum Beispiel: Reflexion auf ein Urteil, mag das Urteil selbst noch so kompliziert sein, ist ein einstufiges „Wahrnehmen“ usw.

8

5

10

15

20

25

30

35

zur intentionalität der objektivation

Man wird nicht dasselbe behaupten dürfen von der Reflexion auf die Intentionalien und die Apparenzialien. Eine „Bedeutung“ ist bald eine Bedeutung erster und bald eine solche höherer Stufe; eine Erscheinung ist eine solche bald erster Stufe, bald höherer Stufe. Nun kann man demgegenüber natürlich auch sagen: Ein Akt ist ein Akt erster und bald ein Akt höherer Stufe. Und so sei alles beiderseits gleich, z. B. ein schließender Akt ein Akt höherer Stufe. Indessen, das ist eine schwierig zu merkende Täuschung. Der Akt höherer Stufe, wie z. B. der schließende Akt, ist ein dahinfließendes, so und so gebautes Erlebnis, das „Akt höherer Stufe“ heißt, weil sich in ihm ein Gegenstand höherer Stufe konstituiert. Aber damit ist nicht gesagt, dass er selbst ein Gegenstand höherer Stufe ist und dass, um ihn selbst zur Gegebenheit zu bringen, ein Akt nötig ist, der in der Weise eines Aktes höherer Stufe objektiviert! Hier ist die Sache also klar: Di e A k t e si nd n ic h t „ G e ge ns t änd e höh e rer Or dnu ng “. W i e nun b e i de n B ed e ut u n gen? Sind nicht die Sätze, die vermeinten Wahrheiten als solche, Gegenstände höherer Ordnung? Kommen sie nicht zur Gegebenheit in Akten höherer Ordnung? Und ebenso die „Begriffe“ (Vorstellungen an sich)? Zum Beispiel der Satz „Ein Viereck ist rund“ oder der „Begriff“ „ein rundes Viereck“: Hier muss ich einen Akt höherer Ordnung vollziehen, und die Bedeutungsreflexion muss durch alle seine Gliederungen hinein- und hindurchgehen, und ebenso bei den Erscheinungen höherer Ordnung. Mit Rücksicht auf die grundverschiedene Art, wie Akte, Erlebnisse zu Gegenständen werden und wie Intentionalien und Apparenzialien es werden, derart, dass die Reflexion einmal Reflexion auf die Akte ist und ein Analogon der schlichten Wahrnehmung bei Sinnendingen ist, das andere Mal eine Reflexion ist, die gewissermaßen von der objektiven Einstellung, die in den Akten lebt, zu anderen Einstellungen übergeht, die in den Akten leben, möchte man den einheitlichen Terminus Re fl e x i o n beanstanden. Für das Erstere könnte man sagen: phanseologische Wahrnehmung (eventuell psychologische, wenn die Reflexion eine unreine ist), für das andere: ursprünglich gebendes Bedeutungsbewusstsein, ursprünglich gebendes Erscheinungsbewusstsein, die sich gegenüberstellen dem gebenden Objektbewusstsein der betreffenden bedeuteten (intendierten) und erscheinenden Objekte.

text nr. 1

5

10

15

20

25

30

35

9

Der natürliche Begriff von Wahrnehmung ist der eines einstufigen Aktes. Es ist noch die Frage, ob die Bedeutungen erster Stufe Gegenstände erster Stufe sind. Hier möchte ich auf Folgendes aufmerksam machen. Prä di k at i ve B ede ut un gen, Bedeutungen der Urteilssphäre, der Sphäre des begreifenden Denkens, sind, auch wenn sie prädikative Bedeutungen erster Stufe sind, sch o n Ge g e ns tä nd e hö her er S t uf e. Wenn ich auch nur sage „Hans“ oder „dies“, so ist zu unterscheiden zwischen unterliegendem und daraufliegendem Akt, und das Vorgestellte der unteren Stufe fließt ein in das der höheren Stufe. Es ist das, was begriffliche Fassung erfährt und in dieser begrifflichen Fassung in den Urteilsgegenstand eintritt. Und das bleibt erhalten für die Bedeutungseinstellung. Die Einteilung der Gegenstände in primäre und Reflexionsgegenstände zeigt ihre Wichtigkeit darin, dass nun auf Seiten der Reflexion alle wissenschaftliche Untersuchung steht, welche im weitesten Sinn das „Bewusstsein“ betrifft, d. i. alle Akte, alles Hintergrundbewusstsein, aber auch alles den Akten in der Weise der „repräsentierenden“ Inhalte, der Bedeutungen, der Erscheinungen etc. „Immanente“. Aber es fragt sich, wie wir Beziehungsgegenstände, die primäre und Reflexionsgegenstände miteinander verbinden, ansetzen sollen. Natürlich sind sie ex definitionem Reflexionsgegenstände; andererseits können wir unterscheiden r e i n e R e f lexi on sg e gen s t änd e, die nicht in der Weise von Synthesen, von irgendwelchen Verbindungen, primäre Gegenstände enthalten, und g e m i s cht e R e fl ex i o nsg eg e n stän d e. Zu bemerken ist noch, dass das, was man unter dem Titel „Immanenz“ (immanente Philosophie etc.) oder i m m a ne nt e r In ha lt, immanenter Gegenstand zu befassen hätte und befasst hat (ohne freilich die darin beschlossenen wesentlichen Unterschiede überhaupt zu sehen), sich, wenn nicht decken würde mit den reinen Reflexionsgegenständen, so mindestens unter diesen Titel gehören würde. Ob das eine oder das andere, das ist erst näher zu überlegen. I s t m e i n Ic h f ü r mi c h s e l bs t e i n Re f l e x i on s g e g e n st an d? Ist es ein reiner oder gemischter? Mit anderen Worten also, wie bin ich mir selbst gegeben? Ich, das Subjekt der Wahrnehmung, Erinnerung, des Urteils etc., das heißt, ich, der ich jetzt das und das wahrnehme, mich dessen erinnere, das und das meinend glaube, auf das und das aufmerke, die und die Wünsche habe und Wollungen bzw. Handlungen vollziehe. Das ist natürlich ein Reflexionsobjekt.

10

5

10

15

20

25

30

35

zur intentionalität der objektivation

Aber während das Ich hier als Einheit dieser Akte gesetzt ist, ist es nicht immer und notwendig bezogen auf primäre Objekte. Ich nehme Gegenstände wahr, denke an Objekte etc. Aber müssen es immer primäre Objekte sein? Muss ich mich der Natur gegenüberstellen und muss ich unter dem Titel „Ich“ auch an „meinen“ Leib denken, der als Leib ein bevorzugtes primäres Objekt ist und ein solches, das gegeben ist? Andere Personen sind gegeben, mindestens als gemischte Reflexionsobjekte oder in gemischten Reflexionsobjekten, da die Einfühlung den Hinblick der Wahrnehmung auf den fremden Leib erfordert. Auch beim eigenen Ich nehme ich in der Regel den Leib, an den es „gebunden“ ist, mit. Andererseits aber kann man fragen, ob nicht ein reines Ich (mein eigenes reines Ich) abzugrenzen ist als ein rein immanentes, reines Reflexionsobjekt, in dem eben von der empirischen Verflechtung desselben mit dem Leib und von der Beziehung auf „seine“ intentionalen primären Objekte, seine Naturumgebung abgesehen wird. Aber die Persönlichkeit, der Charakter? Das identische Ich im natürlichen Sinn: Der Charakter bewährt, bildet sich, entfaltet sich in der Natur- und Menschenwelt. Sowie wir das Ich als den empirischen Charakter nehmen oder das Ich, das Charakter hat, haben wir schon ein gemischtes Reflexionsobjekt. Dieses Ich ist das der Psychologie als Naturwissenschaft. Aber es fragt sich, ob nicht in der Beschränkung auf den reinen Reflexionsbestand,1 auf die dahinfließenden Akte, auf den Fluss des meinenden oder verborgenen Bewusstseins, eine Einheit zu entnehmen ist (wie mir in der Tat scheinen möchte), eine Einheit, die also ein Identisches ist, das soweit reicht, als der Fluss des Bewusstseins zu verfolgen und in der Wiedererinnerung wieder zu verfolgen ist. Dieses Identische wäre das r e i n e I ch als ein im Reflexionsbestand vorfindliches, reines Reflexionsobjekt: E s hä t te de n G ru n dc h a r a kt e r al l e r i mma n e n te n O bj e k te , „ a dä q ua t ge ge be n “ zu s e i n oder gegeben sein zu können. Doch ist dieser Grundcharakter hier noch nicht (in der Weise der cartesianischen Betrachtung) festzustellen. Vielleicht ist es aber doch gut, schon hier darauf hinzuweisen, weil sich in der Tat für alle Reflexionsobjekte

1

„Reines“ Ich?

text nr. 1

11

hier vielleicht etwas Grundwichtiges in Gemeinsamkeit herausstellt. Nicht alle sind immanente Objekte, sofern sie auch „empirisch“ aufweisbar sind. Aber die empirische Auffassung ist eine solche, dass das empirische Objekt das entsprechende immanente Objekt in sich 5 fasst. Jedes Reflexionsobjekt hat einen immanenten Kern (zu ihm selbst gehörig), der nur auf Transzendenz bezogen wird. Aber ist das korrekt? Gehen wir nun weiter.

§ 4. Immanente und transiente (empirische) Gegenstände. Naturobjekte im primären und sekundären Sinn 10

15

20

25

30

35

Wir stellen nun eine neue Unterscheidung hin, die wir zunächst auf die Gegenstände der ersten Stufe beziehen, von denen aus sie sich auf die Gegenstände höherer Stufe überträgt. Ich meine die Unterscheidung zwischen i m m a nen t en und t r an s ien t en (empirischen) Gegenständen. Sie korrespondieren der Unterscheidung des Bewusstseins in e mp i r i s c he s und n ic ht -e m pi r is c he s ( und i n di e s e m Si n n re i n e s) Be w us st sei n. Es ist nicht etwa so, dass Reflexionsgegenstände von vornherein immanente Gegenstände sind. Die psychologischen Gegenstände sind Reflexionsgegenstände und doch empirische Gegenstände, nämlich die „psychischen Akte“, psychischen Erlebnisse in dem Sinn, in dem der Psychologe von ihnen spricht, als Akte oder Zustände von empirischen Subjekten. Auch wo der Psychologe, was er nicht vermeiden kann, von dem Vermeinten als solchen spricht, von dem, worauf sich ein Akt des Vorstellens z. B. bezieht, da ist das Vermeinte (das Intentionale) empirisch aufgefasst, sofern es bezogen ist auf einen Akt, der selbst als ein Empirisches gemeint ist. W ie es s ch e i n t , s i n d a l l e i mma ne n te n G e g e ns t ä nd e R ef l e x io ns g e g e ns t ä nd e. Ein Zweifel könnte hier (mit Beziehung auf psychogenetische Überlegungen) bestehen für die sinnlichen Inhalte, die ich in meinen früheren Schriften geradezu als primäre Inhalte bezeichnet habe. (Reflexionsinhalte nannte ich damals nur die Akte und ihre Modifikationen gegen den Hintergrund hin.) Ist es nur zufällig, dass ich einen sinnlichen Inhalt nur rein immanent erfasse durch Rückwendung von einem empirischen Objekt? Selbst beim Ton, der ja im Sinn der natürlichen, d. i. empirischen Auffas-

12

5

10

15

20

25

30

35

zur intentionalität der objektivation

sung, derselbe ist beim nahen und ferneren Erklingen; wobei eine eigene Einstellung dazu gehört, den jeweiligen „immanenten“ Toninhalt zu fassen, der seinerseits für die reflektive Auffassung als „Repräsentant“ dasteht, als darstellend für den objektiven Ton. Es ist also eine Einstellung hier vorhanden, die reflektierte Einstellung ist, sofern sie aus einer „natürlichen“, unreflektierten hervorgegangen ist, und das ist ein wesentliches Verhältnis, wie sich daraus ergibt, dass daraus ein Verhältnis von Repräsentant und Repräsentiertem sich konstituiert und dass wir dabei die Worte nicht umgekehrt werden gebrauchen wollen. Hat, wird ein Psychologe einwenden, das erwachende Bewusstsein schon Dingbewusstsein, wenn es einen Ton hört oder eine Farbe sieht? Wenn das Tönende sich entfernt, hört das erwachende Bewusstsein schon „denselben Ton, nur entfernter“ – nota bene: denselben unveränderten – und hört es nicht vielmehr einen sich verändernden? Ü be r ha up t bi n ic h hi n si c ht li ch d er B e gri f f e „ Re f l ex i o ns g e g e ns t a n d “ u n d „ R ef le xio ns be w u ss t se in “ z w e if e lh a f t. Beim Dingwahrnehmen, könnte man z. B. sagen, sei das identische Ding primärer Gegenstand, das Ding als Einheit der Dauer. Dagegen wenn ich auf die Phasen achte, z. B. auf die Phasen der Veränderung und auf ihre Verteilung in der Dauer, so sei das schon eine Art Reflexion. So fragt es sich, ob der Gesichtspunkt der „Reflexion“ etwas Grundwesentliches ist, sowohl hinsichtlich der Einteilung des Bewusstseins und insbesondere wesentlich für eine Einteilung der Gegenstände. G r un d we s e nt l i c h i s t da g e g e n di e S che i d u ng i n im m an e n te u nd e mp i ri s c h e Ge g e n s t än de. Was charakterisiert die einen und anderen? Wir weisen da hin auf die äußeren Wahrnehmungsobjekte. Dinge kommen zur Gegebenheit in jeder Dingwahrnehmung. Aber jede Dingwahrnehmung ist eine „einseitige“ Gegebenheit und im Übergang von Wahrnehmung zu Wahrnehmung, von Wahrnehmungskontinuität zu Wahrnehmungskontinuität, die zu einem und demselben Ding gehört, kommt das Ding immer von neuen Seiten und doch niemals (und das ist unaufhebbar) allseitig zur Gegebenheit. Jedes Gegebenheitsbewusstsein ist ein Vermeinen des Dinges, das Bewusstsein vom Selbstdasein desselben ist. Aber in diesem „selbst da“ steckt notwendig ein „nicht selbst da“ von verschiedenen Seiten, Komponenten des Dinges etc.

text nr. 1

5

10

15

20

25

30

35

13

Was ein immanentes Objekt anlangt, so ist es, wenn es gegeben ist, absolut gegeben, nicht einseitig, nicht so, dass neue Wahrnehmungen mit neuem Erscheinungs- und Bedeutungsgehalt dasselbe Objekt geben und nach neuen Seiten geben könnten usw. Das immanente Objekt hat keine Seiten, keine Darstellungen etc. Ein empirisches (transientes) Objekt stellt sich durch „Erscheinungen“ dar (in jedem ihm zugehörigen empirisch gebenden Bewusstsein). Ein immanentes Objekt steht in der Gegebenheit einfach da ohne „Darstellung“, ohne Erscheinung. Im Ersteren liegt: Jedes empirische Bewusstsein lässt Reflexion von solcher Art zu, dass daraus ein immanentes Bewusstsein einer „Erscheinung“ erwächst und in weiterer Reflexion ein immanentes Bewusstsein von „repräsentierenden Inhalten“. Das reine Bewusstsein lässt solche Reflexion nicht zu. Es lässt zu die Reflexion auf den Akt. Prekär ist die Frage nach der „Bedeutung“, nach dem Intentionale des immanenten Aktes, inwiefern und ob es hier ein eigenes Intentionale gibt gegenüber dem Objekt. Soll man sagen, so wenig als es hier ein Apparenziale gibt, so wenig ein Intentionale, oder soll man sagen, das letztere falle hier in eins zusammen mit dem Objekt? Jedes immanente Objekt lässt sich in gewisser Weise in ein empirisches verwandeln, z. B. das immanente Objekt „Wahrnehmung“, „Urteil“ usw. in das empirische: Wahrnehmung als Zustand eines Menschen, Urteil als Akt einer urteilenden Person, Nächstenliebe als Ausfluss eines sittlichen Charakters usw. Ebenso ein Intentionale, als intentionaler Inhalt meines Vorstellens oder Wünschens, ein intuitiver Inhalt, eine Erscheinung als Erscheinung, die ich habe usw. Die immanenten Objekte erhalten durch Beziehung auf empirische Objekte eine Einordnung in die Natur, in die empirische Welt, und in verschiedener Weise. Die Bedeutungen haben Beziehung zum Akt des Bedeutens, zum Akt, dessen Inhalt sie sind, und dieser wieder lässt unmittelbar die psychologische Auffassung zu, die Bedeutungen schon mittelbar. Ob alle empirische Auffassung der Akte und damit auch der übrigen immanenten Inhalte letztlich nicht vermittelt ist durch die Beziehung auf das empirisch-sinnliche Objekt Leib, das kann hier nicht erwogen und entschieden werden. Alle diese empirischen Objekte haben das Charakteristische, dass sie empirische „Wendungen“ von reinen Objekten sind, das heißt, das reine Objekt bleibt, was es ist, und ordnet sich dem empirischen

14

5

10

15

20

25

30

zur intentionalität der objektivation

als Kernstück, als reeller Teil ein. Es erhält nur durch Beziehung auf Empirisches selbst einen empirischen und damit transzendenten Charakter. Oder: In sich ist es reines Objekt, und nur seine Beziehung zum empirischen gibt ihm Stellung in der empirischen Welt. Und alle diese Objekte sind Reflexionsobjekte. Können wir nicht sagen: Es sind entweder selbst Akte bzw. psychische Objekte oder Objekte, die an Akte gebunden sind? Die primären Objekte, die Objekte erster Stufe, die nicht immanente Objekte sind, können aber auch e m pi r is c he Ob je kt e s e i n , d i e n ic ht b l o ße W e ndu nge n vo n im m an ent e n si nd. Im Gegebenheitsbewusstsein eines Dinges (in jeder äußeren Wahrnehmung) finden wir zwar verborgen mancherlei immanente Objekte, die durch Reflexion herauszuholen sind, z. B. außer dem Gegebenheitsbewusstsein selbst die Erscheinung, die Meinung, die Empfindung; aber diese sind in keiner Weise dem Dingobjekt selbst angehörig. Das Empfindungsrot ist nicht wahrgenommenes Rot, sondern stellt es bloß dar. Die Erscheinung einer Seite des Dinges ist nicht selbst Seite des Dinges, sondern stellt sie nur dar (jetzt in dem Sinn: ist Erscheinung davon) usw. Das sind die N a t ur o bj e k t e. Naturobjekte sind du r ch u nd du r c h t ra n s z e n de n t und enthalten nichts, was immanent ist, was durch Abscheidung von irgendwelchem Mitverbundenen, von Beziehungen rein Immanentes werden könnte. Naturobjekte sind Objekte des Bewusstseins erster Stufe (sie sind Gegenstände erster Stufe) und näher pr i mä r e Ob j e k t e (nicht Reflexionsobjekte), oder auch Objekte erster Stufe, und zwar r e i n t r an s i e nt e, die nichts von Immanentem enthalten. N a t u r ob j e k t e i m s e k un dä re n S i nn od e r e mp i r i s ch e O bj e k t e i m s e kun dä r e n S i nn sind unreine Reflexionsobjekte, nämlich Reflexionsobjekte, die durch gewisse Verknüpfungen mit primären Naturobjekten selbst empirisch, naturhaft werden, aber nur mittelbar, unrein. Danach haben wir a l s e r s t e s u n d f und a me n ta l s te s e mp i r i s c h es Ob j e k tg e b i et d i e N a t u r und in Bezug auf sie a ls s e ku ndä re s d e n G e i s t, d i e S p h ä re d e r Ps y c hol o g i e.

Nr. 2 B ew usst sei n - v on u n d d as o b je k ti vi er en de Z u m - Geg en stan d - M a ch en im Ur t ei le n 1

§ 1. Das Erscheinende und sein Charakter. Impressionen als Unterlage eines objektivierenden Begreifens und Beurteilens. Der Unterschied der Urteilsqualitäten

5

10

15

20

25

30

Wohl zu beachten ist Folgendes: In der Anmutung „erscheint“ ein Satzinhalt in einem objektiven Charakter, der in reflektiver Prädikation auf ihn bezogen werden kann: Der Inhalt „dass S p ist“ ist Inhalt einer Anmutlichkeit, einer Möglichkeit. Ebenso: Dass S p ist, ist wahrscheinlich. Im Für-wahrscheinlich-Halten ist der Inhalt charakterisiert als Wahrscheinlichkeit. Ebenso nun „e r s ch e i n t“ in jeder Behauptung (Urteil im gewöhnlichen Sinn) der propositionale Inhalt in einem objektiven Charakter, und das ist der Charakter der Wahrheit. Das ist der Begriff der Wahrheit im ursprünglichsten Sinn.2 Um diesen Begriff zu gewinnen, haben wir bloß zu urteilen und die bezeichnete Reflexion zu üben; ebenso wie wir, um den Begriff der Wahrscheinlichkeit zu bilden, nur vermuten müssen. Es ist keineswegs erforderlich, dass wir „die Wahrheit selbst“ gegeben haben, das heißt, dass wir das Urteilen in ein evidentes überführen müssen, in dem das Geurteilte, die Wahrheit, „gegeben“ ist. Das Geurteilte ist Wahrheit im Sinn von Sachverhalt (gerade in der und der Denkform natürlich). Das Geurteilte als solches ist der vermeinte, urteilsmässig vermeinte Sachverhalt. Das im evidenten Urteil Gegebene ist der „Sachverhalt selbst“, die „Wahrheit selbst“. Wir müssen nun unterscheiden: die im urteilenden Vermeinen vermeinte Wahrheit, das ist der vermeinte Sachverhalt, der erscheinende, so wie er eben erscheint, wenn wir urteilen, und das Prädikat „wahr“, von dem oben die Rede war. Wenn wir Reflexion üben und dem Inhalt

1 2

Oktober 1910. Ursprung des Begriffes der Wahrheit und des Begriffes der Wahrscheinlichkeit.

16

5

10

15

20

25

30

35

zur intentionalität der objektivation

der Wahrheit, dem Satzinhalt, gegenüberstellen das Prädikat „wahr“, das heißt, Inhalt einer Wahrheit zu sein (ebenso beim Vermuteten, der Wahrscheinlichkeit, dem Inhalt gegenüberstellen das Prädikat „wahrscheinlich“). Genauso ist im impressionalen Vorstellen, etwa im Wahrnehmen, eine Objektität bewusst, es erscheint etwas, ein Gegenstand, eine Existenz, wie wir auch sagen können, und auch hier können wir den bloßen Inhalt möglicher Existenz für sich herausheben und auf ihn das Prädikat „existiert“ beziehen: Er ist Inhalt einer Existenz. Wir sagen: Der Gegenstand (hier: das Ding) existiert. Aber der Subjektausdruck ist hier modifiziert. Der Gegenstandsinhalt ist ein existierender, er ist Inhalt eines Gegenstandes im existenzialen, unmodifizierten Sinn. So wie wir oben auch sagen, der Sachverhalt besteht, statt zu sagen, ein Satz-Inhalt besteht, ist Inhalt eines Bestehens. Müssen wir dann nicht konsequenterweise so weiter gehen? Jedes „Bewussstsein“ ist Bewusstsein von etwas, jedes impressionale Bewusstsein ist „Erscheinung“ von etwas, und je nach Art des Bewusstseins hat das Erscheinende seinen „Charakter“ und seinen „Inhalt“ (intentionale Qualität – intentionale Materie). So wie wir hatten Vorstellung, Urteil als Behaupten, Für-wahrscheinlich-Halten und demgegenüber den Seins- oder Existenzcharakter, Wahrheitscharakter, Wahrscheinlichkeitscharakter (bzw. Existenz, Wahrheit, Möglichkeit und Wahrscheinlichkeit), so haben wir im Gemütsakt einen Gemütsinhalt „erscheinend“ mit seinem jeweiligen „Charakter“: Im Werten erscheint etwas als wertlich, als lieblich, schön, etc. Im Wünschen erscheint etwas als „wünschlich“, ein Inhalt steht da im Charakter des wünschlich (erwünscht im objektiven Sinn) oder erscheint als seinsollend, im Bedauern etwas als bedauerlich etc., und „etwas“ ist dabei der bloße Inhalt. Der Wille allerdings steht nicht in dieser Reihe. Wir können vielleicht das der Sprache zuschreiben und sagen, im Entschließen erscheint ein Inhalt als Inhalt eines Entschlusses, als praktisch seinsollend. Doch nun kommen wir in eine sonderbare Schwierigkeit: Ist denn nicht in jeder Impression irgendetwas „gesetzt“? Einmal das Sein (der Gegenstand im engeren Sinn), das andere Mal der Sachverhalt, dann Wahrscheinlichkeit, Möglichkeit, Zweifelhaftigkeit, Seinsollen etc., jederlei Wertlichkeit. Immer können wir einen Sachverhalt und den Charakter des Seins unterscheiden, und dieser Charakter des Seins ist ja nichts weiter als das Korrelat der Impression als solcher.

text nr. 2

5

10

15

20

25

30

35

17

Einmal haben wir eine schlichte Vorstellungsimpression, das andere Mal eine prädikative Impression (Urteil genannt), das dritte Mal eine Gefühlsimpression, eine Wunschimpression, eine Wertungsimpression usw., und überall haben wir den ganzen Inhalt des Bewusstseins im Charakter des Seins, weil nämlich doch überall gegenübergestellt werden kann die Aktmodifikation: die Phantasie-Vorstellung, das Quasi-Urteil, die Wunsch-Modifikation etc., und da „schwebt derselbe Inhalt“ vor im Charakter der „Einbildung“. Die Schwierigkeit löst sich, wenn wir Folgendes beachten: Jedes impressionale Bewusstsein kann als „Unterlage“ eines Urteilens fungieren, eines Ergreifens, Begreifens und prädikativen „Beziehens“. Und allein dieses Ergreifen und Begreifen ist im echten Sinn objektivierend, zum Mindesten das Ergreifen oder, wie es auch heißt, „Me i ne n“, Zum-„Gegenstand-Machen“. Insoweit im Wahrnehmen in der Tat schon dieses Meinen, dieses Einen-Gegenstand-Erfassen steckt, insofern ist es wirklich ein „Vorstellen“, „Perzipieren“. Es muss aber nicht darin sein (Hintergrundbewusstsein). Ebenso, ich kann eine Vermutung haben, „setze“ aber nicht das Wahrscheinlichsein; ich kann wünschen, „lebe“ aber nicht im Wünschen und stelle nicht das Seinsollen gegenständlich hin. Ich kann es jederzeit, und dann habe ich eben einen Gegenstand, und was immer „ergriffen“, perzipiert wird, das hat dann, wenn es ein Ergreifen auf dem Grund einer Impression ist, den Charakter des Seins, der der eine und selbe überall ist. Der Unterschied zwischen Dasein und sonstigem Sein liegt nur darin, dass ich einmal eine empirische Impression habe, das andere Mal eine andere. D a s ä n d e r t a be r ni c hts da r a n, da s s w i r e b en g ru n d v e r s c h i e d e ne I m pr e s s i o ne n zu u nt er s ch ei de n ha be n , „ W e i se n d e s B e wu s s t s e in s “, denen grundverschiedene Regionen und Kategorien von Gegenständlichkeiten entsprechen, und dass in jeder Impression eben die eigentümliche Änderung vorgenommen werden kann, die wir Objektivieren nennen, ZumGegenstand-Machen. Eben damit wird jede Impression zur möglichen Unterlage eines Begreifens und Beurteilens. Untersuchen wir nun die Impressionen, die verschiedenen Grundartungen des Bewusstseins, so finden wir als zusammengehörig das Urteilen als Für-wahr-Halten, als Behaupten, ferner das Für-falschHalten, Im-Bewusstsein-der-Nichtigkeit-Haben, und das Vermuten. Was immer wieder täuscht und gegen die gattungsmäßige Einheit

18

5

10

15

20

25

30

zur intentionalität der objektivation

einnimmt, ist, dass scheinbar der Vermutungsakt ein fundierter ist gegenüber dem scheinbar einfacheren Urteilsakt. Das liegt daran, dass wir das Vermuten prädikativ zum Ausdruck bringen, indem wir dem Vermutungsinhalt das Prädikat „wahrscheinlich“ geben oder „möglich“: „Dass S p ist, ist möglich.“ Demgegenüber sprechen wir das Urteil aus „S ist p!“ und nicht „Dass S p ist, ist wahr“, was ein Urteil nicht über das Urteil, aber aufgrund des ursprünglichen Urteils wäre, ein reflektives Urteil. Ebenso beim Für-nichtig-Halten. Der Vermutungsakt selbst, und ebenso der Akt des Für-nichtig-Haltens, ist aber keine Prädikation (keine Behauptung); das Wahrscheinlichkeitsurteil ist eine auf dem Grund des Vermutungsaktes gebaute Behauptung. Warum wir so verfahren und keinen direkten Ausdruck haben (man wird schwerlich die Rede „S ist wohl p“, „S ist möglicherweise p“ für anderes halten als für eine Behauptung aufgrund der Vermutung),1 das führt auf die alten Schwierigkeiten der nichtprädikativen Aussagen. Die Unterschiede zwischen Urteil, Nichtigkeitsbewusstsein und Anmutung, so wie die entsprechenden Unterschiede der darin fundierten Akte, welche Beziehungen zwischen vermeinten Wahrheiten und vermeinten Möglichkeiten konstituieren, nennen wir Unterschiede der Urteilsqualität. Sie machen zum Teil in einem Sinn den traditionellen Gehalt der Rede von modalen Unterschieden aus. (In einem anderen Sinn ist auch das ein modaler Unterschied, aber innerhalb der Sphäre der Behauptungen, dass ein Urteil einmal gesondert und frei ist, das andere Mal eingeflochten in einen „kausalen“ Zusammenhang.) Modale Unterschiede in einem anderen Sinn beziehen sich auf die „Art und Weise der Überzeugung“ bzw. auf die Art und Weise der Vermutung, auf die mitverflochtenen Färbungen etc. Die letztere Rede soll bevorzugt werden. Nota. Entspricht dem Unterschied zwischen Behaupten als Fürwahr-Halten und Für-falsch-Halten (Nichtigkeitsbewusstsein) ein Unterschied zwischen affirmativem und negativem Vermuten bzw. Anmuten? Entspricht dem Anmuten, dass etwas nicht sei, vielleicht ein anmutendes Nichtigkeitsbewusstsein, so dass, wie das Anmuten,

1 Oder nicht?! – Ich bin wieder zweifelhaft und habe anderweitig ja entgegen entschieden!

text nr. 2

19

dass etwas sei oder nicht sei, ein Für-wahr-Anmuten wäre, so das negative Anmuten, dass etwas sei oder nicht sei, ein Für-falsch-Anmuten?1

5

10

15

20

25

§ 2. Objektivierende Setzung als Urteil im weitesten Sinn – Apophansis als Urteil im engsten Sinn. Jedes Erlebnis kann Grundlage eines apophantischen Urteilens werden2 Da fragt es sich aber, ob ich meine Urteilslehre nicht noch in einer Richtung weiterführen muss, die im Obigen schon angedeutet ist. Ich sprach oben von Ergreifen, Begreifen, ich sprach aber auch von Meinen = Zum-Gegenstand-Machen. Ich sagte, jedes impressionale Bewusstsein kann Unterlage eines objektivierenden, eines vergegenständlichenden und urteilsmäßigen Meinens sein.3 Nun ist jedes Urteil im gewöhnlichem Sinn ein fundierter Akt, ein fundiertes Meinen, Objektivieren, Setzen, dem doch schlichte Setzungen zugrunde liegen. In den Logischen Untersuchungen habe ich anerkannt, dass im Wahrnehmen ein verwandtes Setzen vorliege wie im Urteilen, wobei ich unter Urteilen ein Prädizieren verstanden wissen wollte. Dabei ist doch zugleich der Unterschied zwischen den ausdrücklichen Erlebnissen, speziell den ausdrücklichen Urteilen, und den nichtausdrücklichen (und den verwandten Akten) zu beachten. Schon vor dem Ausdruck mit seinen verbalen Bedeutungen haben wir doch positionale Akte (= Akte im spezifischen Sinn des ego cogito), jene vermeinenden, aus anderen Akten herausmeinenden Akte,4 z. B. das in ein Wahrnehmen sich einlebende Meinen, das wir in der Regel zur Wahrnehmung selbst mitrechnen. Ebenso höhere synthetische Meinungen: Ich erfasse einen Gegenstand in der Wahrnehmung, ich erfasse an ihm ein Glied, einen Teil-Gegenstand etc.; ich erkenne ihn als denselben, als denjenigen, den ich in einer Wiedererinnerung, aber in anderer Erscheinungsweise wahrgenommen hatte. 1 Darüber cf. N und darin die Blätter q, p. 2 = Husserliana XLIII/3, Text Nr. 4, S. 214,22–215,38. 2 16.X.10. – Urteil und Vermeinen (Setzen). 3 Vgl. aber Q (objektivierende Akte und wertende), p. 25 = Husserliana XLIII/2, Haupttext I, S. 35,25–37,25. Dazu überhaupt Q, wo ich schon verwandte Stellung habe. 4 Vgl. dagegen noch die Bedenken in Q 25 = Husserliana XLIII/2, Haupttext I, S. 35,25–37,25

20

5

10

15

20

25

30

35

zur intentionalität der objektivation

Wir haben ja auch hier bei den vorbegrifflichen Meinungen verschiedene Weisen des Urteils; nämlich der „gewissen“, sicheren Gegenstandserfassung, Identitätssetzung, steht gegenüber die anmutende, vermutende. Auch steht gegenüber der Setzung die negative Setzung, dem Seinsbewusstsein ein Nichtigkeitsbewusstsein und natürlich auch die Modifikationen subjektiver Art, von denen wir gesprochen haben. Also U r t e il im w e it es te n S in n umfasst alle Positionen (Negationen) mit ihren qualitativen Unterschieden der Gewissheit oder Anmutlichkeit (Für-Sein-Haltungen, Für-möglich-Haltungen), mögen sie nun einfache, schlicht thetische sein oder höhere, mögen sie ferner ausdrücklich sein und damit zugleich „erkennend“, begreifend oder nicht. Und dabei wieder partiell begreifend oder durchaus begreifend. U r t e i l i m e n g st en S i nn i st die Ap oph ans i s, Urteil im Sinn der Logik ist die Gesamtsphäre der ausdrücklichen Akte, die entweder apophantisch sind oder mit diesen von demselben, also apophantischen Inhalt, nur qualitativ verschieden. Ur t e i l i m w e i t e st e n S i n n is t dan n so v i el w i e o bj e kt iv i er e n de r ( = i nt e ll e k t i v e r i m we it es te n Si nn) Ak t. Alle Objektivationen (Setzungen) weisen zurück auf nicht-objektivierende Erlebnisse. Aber nun fragt es sich, wie der Akt be g ri f f zu fassen ist. Sollen wir etwa so ausführen: Jedes „Erlebnis“, jedes immanente individuelle Datum, in seiner vollen Konkretion genommen, ist Bewusstsein und ist als Bewusstsein Bewusstsein von etwas.1 Es ist entweder selbst Objektivation, ein „Urteil“ im weitesten Sinn, der oben bezeichnet war, oder wenn nicht, so kann sich in dasselbe ein „Urteil“, ein Vermeinen hineinleben, derart, dass wir mit Evidenz aussagen können, das Urteil expliziere nur, was in dem Erlebnis seinem Wesen nach bewusst war. Es sei jedes Erlebnis eben an sich, auch wenn es nicht vermeinendes sei, Bewusstsein „von etwas“; es habe ein jedes in seiner Art eine immanent ihm einwohnende und herauszumeinende Bedeutung, und wieder, es beziehe sich eben dadurch ein jedes in seiner Weise auf Gegenständliches, oder je nach seiner Gattung auf eine gattungsmässig zu charakterisierende Gegenstandsregion, auf 1 Vgl. p. 30 = S. 3,25–5,12, wo zum Begriff des Aktes im spezifischen Sinn das „Meinen“ hinzugerechnet wird.

text nr. 2

5

10

15

20

25

30

35

21

die es, wenn es zum vermeinenden wird, in der Urteilsweise gerichtet sei (oder auf die sich das darin fundierte Urteilen, Setzen dann richte: in der Urteilsweise). Und wir können auch so sagen: Zum Wesen des Objektivierens gehört die Möglichkeit, mit anderen Objektivationen in wesensgesetzmäßiger Weise zur Einheit („Synthese“) der Identifizierung zu kommen und eventuell zu „evidenter“ Identifizierung. Vor allem jede schlichte Objektivation, überhaupt jede Objektivation der unteren, vor allem Begreifen liegenden Schicht, lässt sich auf die Stufe der spezifisch urteilsmäßigen erheben, wie wenn eine schlichte Wahrnehmung zur Grundlage einer Dies-Setzung und eventuell schon attributiven, begrifflichen Fassung wird (dieses Papier) und so zum Subjektakt eines Prädizierens. Es ist dann mit evidentem Recht und Sinn zu sagen, die schlichte Wahrnehmung sei Warnehmung eines Gegenstandes, des in ihr schlicht erfassten, und dieser selbe Gegenstand sei in der DiesSetzung gesetzt und sei nun Gegenstand der Subjektsetzung des Urteils, sei im Urteil Gegenstand-worüber. In dieser Weise kann evidenterweise jede Setzung in eine Subjektsetzung übergeführt und dann prädikativer Gegenstand, Gegenstand der urteilenden apophantischen Erkenntnis werden. Dies gilt auch von der synthetischen Gesamtsetzung, die das Urteil als Apophansis im Ganzen vollzieht, auch sie kann in eine Subjektsetzung verwandelt werden, und wir sagen mit Evidenz, dass der Gesamtgegenstand des Urteils, der Sachverhalt, die in ihm vermeinte Wahrheit, nun zum Gegenstand-worüber in neuen Erkenntnissen wird. Wir finden nun n e b e n den Urteilen im engeren und weiteren Sinn noch andere Erlebnisse und jedes, sagten wir, ist ein „Bewusstsein von“. Jedes kann Grundlage nämlich eines urteilenden Setzens und somit auch eines denkenden, apophantischen Urteilens werden, und zwar so, dass mit jeder Grundklasse von Bewusstsein eine neue Grundartung von Gegenständlichkeiten und somit auch von Bedeutungen sich herausstellt. Sagen wir „Jedes Bewusstsein ist Bewusstsein von“, so liegt darin also, dass jedes in sich implizite schon auf so etwas wie eine Gegenständlichkeit „gerichtet“ ist, aber dass das Urteil es gleichsam sehend macht und diese Gegenständlichkeit ihm entnimmt und zur Erkenntnis bringt.

22

Beilage I Die Urteilsbedeutung und die Bedeutung der unterliegenden Akte. Die Urteilsgeltung übergreift alle anderen Fälle von Geltung. Die Bestimmung des Bewusstseins durch die Grundarten der Bedeutungen1

5

10

15

20

25

30

35

zur intentionalität der objektivation

Gehen wir von den Domänen von Akten aus, so entspricht jeder eine eigene Domäne von Bedeutungen, und diese unterstehen, so wie die Urteilsbedeutungen, der Frage nach der Gültigkeit. Als Parallele der Logik haben wir also andere „formale“ Disziplinen. Aber wie, is t Ge lt ung n ich t sp e z ie ll S ac h e ei n es U r tei l s? Nun, das Urteil hat seine Geltung: Das Urteil ist wahr, der Wunsch ist nicht wahr, aber doch berechtigt, gültig; auch in der Sphäre des schlichten „Vorstellens“, des Wahrnehmens, des Erinnerns, des vollen und leeren, gibt es eine Geltung, die freilich wie jede Geltung nur prädiziert werden kann eben in der Prädikation. Sind schlichte „Vorstellungen“ (Seinssetzungen) Grundlagen für synthetische Identifizierungen, Prädizierungen, Beziehungssetzungen, so haben diese neuen Gebilde (Urteilsbedeutungen im speziellen Sinn) eben wieder ihre Geltungsweise: eben die der Prädikation (doch haben wir zu unterscheiden die Synthesis vor dem Ausdruck und die ausdrückliche Synthesis). Auch im Fragen und Vermuten „erscheint“ etwas, das ist, auch hier haben wir Bedeutungen, die ihre Weise der Geltung haben, ebenso Wünsche usw. Jeder solchen „Bedeutung“ entspricht eine „Urteilsbedeutung“ (prädikative Bedeutung). Zum Wesen der Vermutung des Inhalts „S ist p“ gehört das mögliche Urteil: Dass S p ist, ist wahrscheinlich! Und wenn die Vermutung Vermutungsgeltung hat, so hat das Urteil Urteilsgeltung und umgekehrt. Und so überall. Natürlich urteilend stellen wir das alles fest. Wir urteilen über das im schlichten Vorstellen, über das im Vermuten, im Wünschen, Wollen Bewusste, wir sehen darauf hin, wir setzen es als Vermeintes, Bedeutetes und urteilen, es sei wirklich, es „bestehe in Wahrheit“.2 Das besagt: J e d es B ew u s st s ei n k a n n U n t e r lag e ein e s aff ir m a tive n o d er n e ga ti ve n „ Ex i st en z ia l ur t e il s “ s ei n; je d es B ewu s s ts e in k an n f ü r e i n Pr äd i zi e re n di e s elb e F u n kt io n ha b en w ie et wa d a s si n n lich e V or s t el l un gs be w u ss t se in fü r e in D in g - Pr ä d iz ier e n.3 Auch ein Urteilsbewusstsein selbst: Auch aufgrund dessen kann ich „existenzial“,

1 2 3

Nota bene. – Sehr wichtig. – 1910. Bedeutung = Vollthema. Die übergreifende Funktion des Urteils über alle Akte.

beilage i

5

10

15

20

25

30

23

„kategorial“ etc. urteilen. So kann ich überall sagen: In Wahrheit besteht das Vorgestellte (das Ding-Bedeutete), in Wahrheit besteht das Geurteilte (der Satz ist ein wahrer, der „Sachverhalt besteht“), in Wahrheit besteht das Vermutete (dass S p ist, ist wahrscheinlich, das Wahrscheinlichsein besteht), in Wahrheit besteht das Gewünschte, in Wahrheit möge S p sein, ebenso in Wahrheit besteht das Gesollte, das Gesollte als solches ist, besteht. Haben wir aber hier Urteil, Existenzialurteil, so wird man vielleicht sagen: E x is t e n z i s t e in B e g ri ff , d er w e se n tlic h zu m U rt ei ls geb i et g eh ö r t, e be n s o w ie de r B eg r iff G ege n s tan d. Natürlich ist das, recht verstanden, nicht zu bezweifeln, aber es ist zu beachten, dass eben Urteile (Prädikationen) Akte sind, welche ihrem Wesen nach fundierte Akte sind, also Akte voraussetzen, die nicht immer selbst wieder Urteile sind und Urteile sein können.1 Und ebenso Urteilsbedeutungen, Sätze sind fundierte Bedeutungen, die andere „Bedeutungen“ als Unterlagen voraussetzen. J e d es U rt e il se t zt „ V o rs t e llu n ge n “, s a gt m an, al s U n ter la ge vo r a u s. Hinter diesem Wort „Vorstellung“ steht jederlei Bewusstsein: nämlich jedes, sei es ein sinnliches Wahrnehmen, sinnliches Erinnern oder ein Vermuten, Wünschen, Sichfreuen etc., is t e n tw e de r s c ho n s e lb s t e in „ Me in en “ o d e r e s ka n n s ich e in M ei n en d ar in ein le b en , u n d e s i s t d an n ei n s ol ch es „ V o r s t ell e n “ , da s a ls U n te r la g e d e s U r te ils f u ng ie re n k a n n. Das Meinen selbst ist eine auszeichnende Zuwendung zu dem Bewussten; es besagt einen eigentümlichen Modus, den jedes Bewusstsein, ohne sein Wesen einzubüßen, erfahren kann, einen durch dasselbe hindurchgehenden Blick, oder wie man es nennen möchte. Und nach diesem wahrnehmenden, gefallenden, wünschenden etc. Meinen kann sich dann das ausdrückende Begreifen orientieren und dasjenige Formen, das etwa eine subjektive Vorstellung oder eine Objektvorstellung für ein kategorisches, speziell etwa relationelles Urteil erfordert, oder auch ein solches Fassen, das das betreffende Vorstellen in modifizierter Weise als Unterlage für ein Existenzialurteil ermöglicht. So ist jedes Bewusstsein und jedes Was eines Bewusstseins, seine Bedeutung, einzubeziehen in ein Urteilsbewusstsein, ein existenziales Urteilsbewusstsein, und ebenso korrelativ jede Bedeutung in eine Aussage1 Das wird man nur von eigentlich vollzogenen, erfüllten, nicht von verworren vollzogenen Urteilen sagen können, von „bloß intendierenden“ Urteilen, unbegründeten. – Man müsste dann sagen: Das Urteilsmäßige ist dabei jederzeit etwas Unselbständiges, da die Urteilsfassung, Urteilsbeseelung eben etwas voraussetzt, was seinem Wesen nach ohne solche Beseelung sein kann und dann eben nicht Urteil ist. Aber das ist unrichtig, da es falsches und verworrenes Urteilen gibt. Urteilen weist auf etwas hin, was nicht Urteil ist, aber es ist nicht wirklich darin fundiert! Nicht jedes Urteil ist begründet, aber jedes „fordert“ eine Begründung.

24

5

10

15

20

25

30

zur intentionalität der objektivation

bedeutung. Und zur Aussage kommen dabei einerseits die Geltungen jener Bedeutungen, also Existenz, und andererseits das so und so Beschaffensein der betreffenden Gegenstände, der betreffenden Gegenstände, der Dinge, der Wahrscheinlichkeiten, der Wertgegenstände, auch der Sachverhalte als Urteilsgegenstände (neuer Urteile). Andererseits aber sind nicht Urteilsbedeutungen einerlei mit den „Bedeutungen“ der unterliegenden Akte, so wenig Urteile selbst Wahrnehmungen, Wünsche, Vermutungen etc. sind. Sie liegen zugrunde, aber so wie sie sind, sind sie noch keine Urteilsglieder bzw. noch keine Satzglieder: Es fehlt die spezifische Gedankenformung (synthetische) und begriffliche Formung, die zum Urteil (als Aussagen, Begreifen) gehört.1 Vor allem synthetischen Fassen, Begreifen und Aussagen liegen da Reihen von Akten (Bewusstseine), und sie haben das Eigentümliche, dass ihnen ein Sinn, eine Bedeutung einwohnt. Natürlich, dass das der Fall ist, das entnehmen wir aus ihnen im evidenten Urteilen, drücken es begrifflich aus, machen es zu unserem Erkenntnisbesitz. Aber diese Akte sind doch nicht die Gegenstände dieser Urteile. Ebenso ist die Eigentümlichkeit dieser „Bedeutungen“, zu gelten oder nicht zu gelten, durch Urteile zu erkennen, aber nicht selbst etwas zum Urteilen Gehöriges. Urteile selbst haben ihre Geltung; auch das aber – diese Beschaffenheit der Urteile, „wahr“ zu sein – entnehmen wir durch neue Urteile. Ebenso, wie es korrelativ heißt, jedes eigenartige Bewusstsein, und zwar im Modus des Meinens, hat seine Weise, sich zu erfüllen; auch das Urteilen hat seine Weise, die abhängig ist von den Erfüllungen der unterliegenden Akte, aber doch wieder etwas Neues ist. Und desgleichen: Im Urteilen ist uns bewusst ein „Gegenstand“, das ist, das Urteil hat eine Bedeutung, und ist diese, der Satz gültig, so ist der Urteilsgegenstand, der Sachverhalt. Aber genauso ist uns in jedem Bewusstsein ein „Gegenstand“ bewusst: Jedes ist Bewusstsein von, jedes lässt einen „vermeinten Gegenstand als solchen“, eine Bedeutung entnehmen, und im Fall der Bedeutungsgeltung sprechen wir von einem wahren Gegenstand (oder schlechthin von einem Gegenstand). Natürlich wie vom Urteilen selbst, so von jedem Bewusstsein sagen wir das aus, wir erkennen es durch einsich-

1 Also es muss das Verhältnis des zu Formenden und des Formenden vorliegen, das aber ist bei einem vagen Aussagen aus Gewohnheit wie 2 × 2 = 4 nicht der Fall. Oder es gibt zweierlei Formungen – adäquate und inadäquate –, und es gibt zweierlei Rede auch vom Formen: einmal ein spontanes Urteilen, das sich nach anderem „Bewusstsein“ richtet, und das andere Mal ein vages Urteilen, das sich nicht tätig nach etwas richtet und einer Unterlage etwas entnimmt, sondern in einem Schlag, „blind-assoziativ“ ist das Urteil (mit seiner Unterlage einig) da, und die Einheit ist eventuell eine „unpassende“.

beilage i

5

10

15

20

25

30

35

40

25

tiges Urteilen. Aber darum ist doch zu scheiden das erkennende Urteilen von dem Gegenständlichen, das erkannt ist und das ist, ob wir erkennen oder nicht. Und somit ist auch zu scheiden das erkennende Urteilen, in dem wir erkennen, dass jedes Bewusstsein „sich auf eine Gegenständlichkeit bezieht“, von dieser Tatsache selbst und von dem Bestand solcher verschiedenartigen Gegenständlichkeiten selbst, wenn Gültigkeit besteht. Also Gegenstand, Gegenstandsbedeutung, Geltung von Bedeutung sind Sachen, die erkennbar sind durch Urteile, aber nicht Urteilsfakta selbst, mögen auch apriorische Beziehungen bestehen zwischen Urteilsgeltungen und den Gegenständen, die wir setzen können, den Geltungen, die wir Wahrheiten nennen, und allen anderen Gegenständen, Bedeutungen, Geltungen. Vor allem muss man sagen: De r B egr if f der G el tu n g ( Ri c ht i gk ei t e t c. ) is t e i n a llg e m e in e r, d er de n B eg r iff d er S a tz g e lt u n g (R ic h t i g ke it d e s Ur t ei l en s ) a ls E in z e lfa ll e i ns c h lie ß t. Aber dieser Einzelfall übergreift in gewisser Weise alle Fälle, weil alles Erkennen von Geltung und von Sein selbst ein Urteilen ist, das seinerseits Wahrheitsgeltung haben muss. A ll e G e g en s t än de re ic h e n n o tw e n dig in di e U r te il ss phä re hi ne i n: Urteile sind freilich selbst Gegenstände. Alle Gegenstände sind mögliche Subjektgegenstände von Sachverhalten, aber Sachverhalte sind selbst wieder Gegenstände. Mit dem Gesagten hängt zusammen: E s g ib t s o v i e le G r u nda r te n v o n Ge g e ns t än d lic h k ei ten , a ls e s G r u n da r te n d es B ew u s st s ei ns g ib t. Die Grundarten des Bewusstseins bestimmen sich durch die Grundarten der Bedeutungen. Bedeutungen sind vermeinte Gegenständlichkeiten als solche: vor der Frage der Geltung. Zum Wesen jeder Gegenständlichkeit gehört es, dass sie ihre ursprüngliche Bewusstseinsweise hat, ihren sie „gebenden“ Akt, ebenso „bloß vorstellende“ Akte etc.; zu jeder gehört ihre Art der „Ausweisung“, der Erfüllung, der Begründung. Je nach Art des Bewusstseins, je nachdem es fundiertes ist oder nicht, sind auch die Gegenständlichkeiten, die da „vermeinte“ sind, fundierte oder nicht fundierte. Und das gibt den Ursprung für eigentümliche Prädikationen, sofern das gegenständliche Moment, das das höhere Bewusstsein in unselbständiger Weise hinzutut zu dem Gegenstand des unteren Bewusstseins, diesem als Prädikat zugemessen wird. Es sind grundverschiedene Arten von Prädikaten, je nachdem es heißt, der Gegenstand, das Ding da ist rot, und wieder, es ist schön, wahrscheinlich, gut etc. Kann man diese Prädikate mit dem Prädikat Wahrheit, Gültigkeit auf gleich behandeln? In gewisser Weise sicherlich. Nämlich: Auch das Bewusstsein, in dem ein Urteil als gegebene Wahrheit dasteht, nämlich vor der Prädikation der Wahrheit, ist ein fundiertes Bewusstsein, ein „Evidenz“bewusstsein, und wenn ich von dem Urteil dann aussage, es sei wahr, es „stimme“, so gebe ich ihm mit Beziehung auf das, was das fundierte Bewusstsein neu hergibt, ein Prädikat.

26

zur intentionalität der objektivation

Andererseits aber ist der Unterschied offenkundig. Es liegt hier nicht so etwas vor, was analog ist mit einem Werten, in dem ein Wertprädikat am Gegenstand oder Sachverhalt erscheint, wie ja dann auch jedes Werten selbst sich ausweisen kann und dann nicht in einem analogen Sinn wieder 5 einen Wert erhält. Mit all dem sind die Fundamente für eine Kategorienlehre gelegt, deren volle Ausführung aber hier nicht am Platz ist.

Beilage II Das Urteil als ein Gebilde von eigenen Intentionen. Das Urteilen ist ein erfülltes, wenn es sich nach einem gebenden Akt richtet1

10

15

20

25

30

Was da2 ausgeführt ist, ist sehr schön. Aber es bedarf nun neuer Untersuchungen. Das Urteil ist hier hingestellt als eine formende Spontaneität, durch deren Formung Urteile in concreto erwachsen. Es ist da in erster Linie gedacht an die Fälle, wo ein Bewusstsein, das im Allgemeinen noch kein Urteilsbewusstsein ist, allenfalls partiell ein solches enthält, als Substrat fungiert, es wird daraufhin ein Urteil gebildet, das auf dieser Grundlage etwa über den wahrgenommenen Gegenstand und seine Existenz urteilt oder über die Schönheit, Güte eines Menschen, über die Erfreulichkeit einer Tatsache etc. In anderen Fällen ist es aber anders. Während hier ein bloßes A u s ein an d er le g e n d e s a n de r we it i g Be wu sst en s tat th at t, ein U r t eilen , d as s ic h n ac h a n d e r e m B e wu s st se i n u n d s ein e m G eh a lt „ r i c ht e t “ un d ih m „ a n ge m e s se n “ i st (wobei wir von einer Evidenz der Angemessenheit sprechen können), kann ein Urteilen einfach da sein oder kann gefällt werden ohne ein solches Auseinanderlegen, so z. B. wenn ich gewohnheitsmäßig urteilend einen mathematischen Satz ausspreche, wobei mir eventuell eine Verwechslung passieren kann, die einen Widersinn mit sich bringt, den ich aber nicht merke. Diese schwierige Sachlage muss nun erforscht werden. Es liegt nicht, wird man sagen, ein „eigentliches“ Vorstellen, Wünschen, Sichfreuen etc. zugrunde, und es gründet sich darauf nicht ein eigentliches Explizieren, Objektivieren, Beziehend-Fassen etc. Ich sehe etwa ein Haus, ich habe also eine Wahrnehmung, aber ich sage hier, was ich davon aufgrund früherer Einzelbetrachtung, Explikation etc. „weiß“; ich vollziehe nicht Urteile,

1 2

Wohl Ende 1911. – Anm. der Hrsg. Gemeint ist die vorangehende Beilage I. – Anm. der Hrsg.

beilage ii

5

10

15

20

25

30

35

40

27

die sich nach dem Wahrgenommenen hier und jetzt „richten“. Oder ich sage „Möge S p sein, das ist erwünscht“. Aber ich urteile „mechanisch“, ich fühle jetzt keinen eigentlichen lebendigen Wunsch, vielleicht eine Wunscherinnerung, aber eine ganz unklare, matte, in nicht „vollziehender“ Weise usw. Was für Modifikationen liegen da dem Urteil zugrunde? Eventuell ist das „eigentliche“ Substrat gar nicht herstellbar, eben wenn das Urteilen widersinnig ist. Wir haben also gegenüberzustellen: das uneigentliche Urteilen und das eigentliche. Aber das in verschiedenem Sinn! Auf Seite der Uneigentlichkeit: einmal das unartikulierte, verworrene, nicht wirklich Setzung auf Setzung gründende Urteilen und andererseits das eventuell artikulierte, aber seiner Unterlage nach „uneigentliche“. Ich urteile wirklich und artikuliert, aber was das Urteil voraussetzt für die Realisierung seiner Termini bzw. was es voraussetzt, wenn es soll „richtig“ sein können, das fehlt. Soll man sagen: Das Urteilen ist im Fall, dass es aus einem vorgegebenen Substrat durch Explikation und prädikative Formung einen Sachverhalt konstituiert, nicht etwa eine bloß unselbständige Formung der unterliegenden Wahrnehmung, Erinnerung, des unterliegenden Wunsches etc., sondern ein Gebilde von eigenen „Intentionen“, die sich nach dem Vorgegebenen richten, indem sie die Bestimmheit der Richtung danach orientieren, aber doch ihm gegenüber ein Neues sind, derart, dass dieselben Intentionen, in derselben Form nachher ohne diese Unterlage auftreten können? Als unerfüllte Intentionen. Und nun können sich diese Intentionen auch anders formieren und auftreten, ohne Bestimmtheit der Richtung der erfüllenden „Anschauung“ zu verdanken, ohne aus der Fülle zu erwachsen, in der sie sich erfüllen, eventuell ohne erfüllbar zu sein? Wir hätten dann also den Gegensatz von e ig e nt l ic he n U r t e il si nt e nt io n en (artikulierten, wirkliche Setzung) und u n er f ü ll t en; alle Urteile wären entweder unerfüllte Intentionen oder erfüllte. Aber in jeder spontanen Sphäre hätten wir den Unterschied unerfüllter und erfüllter Intentionen, und damit hängen die Unterschiede der Begründung zusammen. Also muss ich den in den Logischen Untersuchungen so stark hervortretenden Unterschied zwischen Intention und Erfüllung hier in den Mittelpunkt stellen, und zwar fällt er durchaus in den Rahmen der Aktualität. Das Urteilen kann volles (erfülltes) sein, wenn es sich aktuell „richtet“, seine Richtigkeit sich ausweist, wenn es sich nach einem gebenden Akt orientiert. Andernfalls ist es leeres Urteil, leere Urteilsintention. Es weist dann auf eine zu leistende Begründung hin: Es steht eben unter Normen. Auch eine Wunschintention kann bloße, leere Wunschintention sein. Darum ist der Wunsch wirklicher Wunsch, aber er ist anders charakterisiert, wenn seine „Voraussetzung“ realisiert ist, als wenn das nicht der Fall ist.

28

zur intentionalität der objektivation

Wie weit reicht dieser Gegensatz? Gehört er spezifisch zu den spontanen Intentionen? Gehört er nicht schon zu den Hintergrundakten? So besteht ja die Perzeption (die Wahrnehmungserscheinung), ob Zuwendung da ist oder nicht, aus einem Komplex von Intentionen, von denen die einen volle, die 5 anderen leere sind. Ist das nicht im Wesen derselbe Unterschied?

Beilage III Das Verhältnis des vorprädikativen Vorstellens zum Denken. Identifikation im eigentlichen Sinn findet nur im Denken statt1 10

15

20

25

30

Wie verhält sich das vorprädikative (nicht-konzeptive) V o r s tel le n (schlichte Perzeption) zum D en k e n (Konzeption), wie dieses zum Sichmeinenden-Zuwenden? Ist I d e nt if iz ie r un g nicht eine Sache des De n k e n s? Kann man z. B. sagen: In der „Erfüllung“ trete ein Akt des Vorstellens und ein Akt des Denkens in die Einheit einer Identifizierung? Doch sicher nicht. D ie „ D e ck u ng “ i st n ic ht s el b st I de nt if iz ier u n g, die Deckung zweier Akte. Zunächst a) Vorstellung in dem vorstellenden Einheitsbewusstsein (d. i. dem zu Vorstellungen gehörigen) – z. B. das Einheitsbewusstsein in der Kontinuität von Wahrnehmungen, die denselben Gegenstand immer wieder von neuen Seiten zeigen – ist kein Identitätsbewusstsein als Denken von Identität, Erfassen von Identität, aber ein Denken kann etabliert werden.2 Das sagt, derselbe Gegenstand, der eine ist es, der sich in dieser und jener Wahrnehmung oder Wahrnehmungskontinuität darstellt, da nach diesen Seiten, dort nach jenen Seiten. b) Ferner, das Denken, das sich auf dem Vorstellen aufbaut, in dem es sich nach ihm „richtet“ bzw. nach dem richtet, was ich sehe, was ich vorstelle, geht damit mit dem Vorstellen eine eigentümliche Einheit ein, und diese Einheit ist wieder eine andere als die vorhin besprochene der kontinuierlichen Wahrnehmungseinheit. Aber wieder ist es eine Einheit, die es gestattet, in einem neuen Denken zu sagen: Das in der bloßen Vorstellung (schlichten Perzeption) Vorgestellte und das im darauf gegründeten Denken Gedachte ist dasselbe. Das Denken ist es, das im Hinblick auf eine Vorstellung sagt „diese Vorstellung“ (das heißt, das auf dem Grund einer Wahrnehmung

1

Aus Dezember 1909. Kontinuierlich sich deckendes Bewusstsein, einstimmiges Vorstellen, ist nicht Erfassen von Identität. 2

beilage iii

5

10

15

20

25

30

35

40

29

oder Vorstellung dieser Vorstellung so sagt), und das Denken ist es, das zugleich nach dieser Vorstellung sich richtend sagt „dieser Gegenstand“ und die Beziehung herstellt „dieser Gegenstand dieser Vorstellung“. Und wieder auf Grund der Vorstellung vom Denken (im Hinblick darauf) sagt „dieses Denken“ und es denkt „diesen Gegenstand“ etc. Und es ist dabei das so sich richtende Denken evident; alle diese Urteile sind evidente (eines jeden Aktes überhaupt!). Zum Wesen jeder Vorstellung und zum Wesen jeden Denkens gehört die Möglichkeit, ein so sich nach ihnen richtendes Denken zu begründen, das in Evidenz der Vorstellung ihren Gegenstand entnimmt, nämlich ihn für das Denken zu einem Dies macht, von dem sich Prädikationen vollziehen lassen. Ei ne I de n t i fiz ie r un g f in d et i m ei gen tl ic h en S in n n ur s ta tt zwis ch e n z w e i De n ka k t e n , u n d d i es e h a ben i h re rse it s z we i V o r s t e l lun g e n zu r G r un d la ge. Vorstellungen als Grundlage! Habe ich da früher nicht einen wesentlichen Sinn der Vorstellungsunterlage der rechten Abhebung entbehren lassen, aus dem Grund, weil ich nicht scharf unterschied in den Logischen Untersuchungen zwischen dem leeren Vorstellen (vor allem Denken) und dem leeren Denken, z. B. im leeren Gebrauch eines Eigennamens. Muss man nicht sagen, je d e r D en k a k t s e tz t e in V o r s tel len , e in v o ll e s o d er le e r es, voraus und baut sich darüber? Ich merkte richtig, dass in den Terminis ein Vorstellen stecke; das Denken bringt aber seine Denkform herein, und diese durchdringt alles, auch die Termini. Setzt aber jedes Denken Vorstellen im unteren Sinn, ein schlichtes Perzipieren, derart voraus, dass es Nicht-Konzeptives denkmäßig formt und setzt? Das Denken objektiviert auch; in ihm steht der Sachverhalt (urteilsmäßig) da, und ein neues Denken bezieht sich eventuell auf ihn und sagt „dies“, „dieser Sachverhalt“. Das ist dann ein Denken zweiter Stufe, dem direkt ein Denken und mittelbar ein schlichtes Vorstellen zugrunde liegt. Nun scheint es sich aber weiter bei allen impressionalen (positionalen) Akten ebenso zu verhalten. Wieder entnimmt ihnen das Denken einen Gegenstand, indem es an die Frage, den Wunsch etc. anknüpfend sagt „dies!“ und über das darin Gegebene prädiziert. I st al s o n i ch t ü b er a ll da s D e nk e n das i m e ig e nt li c he n Si n n O bj e kti vier e n de? D a s D en k en ist es, das der sinnlich schlichten Vorstellung und allen anderen Akten, auch den Denkakten, den Gegenstand entnimmt, das heißt, dass es sagt und aufgrund aller Akte sagen kann „dies da!“ und dass es das Dies dann prädikativ weiter bestimmen kann, und zwar nicht so, dass etwa die Akte zu Gegenständen werden – dazu müsste vielmehr ein Wahrnehmen dieser Akte zu Grunde liegen, womit wir nur Denken auf Grund von Wahrnehmungen hätten –, sondern so, dass das Denken allen Akten ein Intentionales entnimmt, genauso wie der Wahrnehmung, der schlichten Vorstellung. Das

30

zur intentionalität der objektivation

Intentionale „liegt“ also in jedem Akt, jeder ist Intention-auf, jeder hat Richtung auf ein Gegenständliches, Richtung auf eine Einheit, die im Denken zu einem Dies und einem so und so bestimmbaren und bestimmten wird. Aber so einfach liegen die Sachen nicht, dass wir nun schon fertig wären 5 und alles klar hätten. Vor allem das ist zu überlegen, wie d as in te nd ie r e n de M e i ne n un d da s D e nk e n zu e in an d e r s te h en. Wie grenzen sie sich gegeneinander ab?

Nr. 3 E i ge nt li c he s u nd u n eige nt l ic he s Ur tei l e n 1

§ 1. Das theoretische Meinen und sein Substrat. Leeres Denken. Das Herausmeinen aus einem leeren Akt ist Meinen und keine Vergegenwärtigung

5

10

15

20

25

30

Bisher hatten wir das theoretische Meinen immer betrachtet als ein solches, das sich in einem zugrunde liegenden „Erscheinen“ etabliert, das aus einem Substrat herausmeint, das auch in Ungemeintheit für sich leben kann. Kann nun nicht ein theoretisches Meinen ohne ein derartiges Substrat bestehen? Ist das nicht beim „leeren“ theoretischen Meinen, beim „bloß symbolischen“ der Fall? Wie verhält sich also das „volle“ und das „leere“ theoretische Meinen (oder Denken im prägnanten Sinn)? Auch das „leere“ Meinen (das leere Denken) hat sein „Substrat“ im ersten Sinn, nämlich so verstanden, dass das leere Denken wie jedes Denken etwas denkt, darin etwas bedeutet. Das „volle“ meint aus einer Erscheinung etwas heraus, setzt, fasst es als Subjekt etc., und die „Erscheinung“ kann auch Erlebnis sein, ohne als Denkfundament zu fungieren. Wie ist es aber beim leeren Denken, ist es auch ein Herausmeinen, überhaupt ein Meinen auf einem „Grund“, nur dass dieser Grund, das fundierende „Erscheinen“, ein leeres ist? Da ist zunächst zu fragen: a) Gibt es zunächst zu jeder Sorte von intentionalen Erlebnissen einen Gegensatz von „vollen“ und leeren? b) Gibt es so etwas wie Herausmeinen aus leeren Nicht-Meinungen, kommt es vor als Möglichkeit, dass aus einem leeren, nicht-theoretischen Akt eine Gegenständlichkeit herausgemeint wird? Was nun das Erste anlangt, so ist zunächst vor Verwechslung zu warnen. Wir nennen ein Denken ein leeres, weil es sich auf dem Grund einer Leervorstellung, eines Leeraktes aufbaut. So wenigstens, wenn

1

Wohl 1910/11. – Anm. der Hrsg.

32

5

10

15

20

25

30

35

zur intentionalität der objektivation

die aus b) zu erwägende Möglichkeit besteht. Es ist aber die Frage, ob das Denken selbst darum in demselben Sinn „leer“ ist, wie das, was es fundiert. Es fragt sich also zunächst, was wir als Leermodifikation definieren und welche Beispiele wir zugrunde legen. Wenn nun das Meinen aus einem leeren Akt herausmeint, wenn ein objektivierendes Setzen sich dem verborgenen Gegenstand eines Aktes zuwendet und ihn dem „Auge des Geistes“ offenbart, den verborgenen zum offenbaren Gegenstand macht,1 so ist natürlich das Meinen unter allen Umständen eben ein Meinen und nicht eine Vergegenwärtigung. Wenn das Meinen sein Substrat in einem leeren (dunklen) V e rgegenwärtigen hat, so ist es nicht selbst ein Vergegenwärtigen und gar ein leeres. Wir haben also eine fundamentale Unterscheidung zu machen und terminologisch zu fixieren: 1) die dunkle Vergegenwärtigung; 2) die Apprehension (im Gegensatz zur Prehension) in den apparenzialen Akten. Der Gegensatz, der hier besteht zwischen „Fülle“ und „Leere“ (das Leerstück der Apprehension, wenn wir das ganze Phänomen selbst Apprehension nennen); 3) das „Denken“, das setzende und synthetische Meinen, das theoretische Bewusstsein, das sich auf dem Grund einer dunklen Vergegenwärtigung etabliert und eventuell auf einem apprehensiven Grund. Im letzteren Fall geht „innerhalb der Apprehension“ ein Spiel von dunklen Vergegenwärtigungen vor. Das ist ein eigenes Phänomen. Wenn wir uns der Rückseite dieses Tintenfasses zuwenden, treten Vergegenwärtigungen auf, lebendige oder unlebendige, dunkle. Aber es ist die Apprehension festgehalten, und es deckt sich in der „Erfüllung“ die Tintenfasswahrnehmung hinsichtlich ihrer Apprehension mit der Rückseitenvergegenwärtigung, einer bevorzugten aus der Mannigfaltigkeit. Bezeichne ich dies da als Tintenfass, so mag ich sogar sagen „quadratisch“ etc., ohne dass Vergegenwärtigungen eintreten. Die Setzung richtet sich auf das ganze Objekt und darin liegt, sie lebt sich in den Akt ein, entnimmt ihm das Objekt, wobei die Apprehension natürlich mit ihre Rolle spielt, nur nicht eine abgesonderte.

1

Verborgener – offenbarer intentionaler Gegenstand.

text nr. 3

5

10

15

20

25

33

Das denkende (objektivierende) Meinen ist in je de m Fall keine Vergegenwärtigung, weder eine klare noch eine dunkle, und nennen wir es ein unklares Denken, so heißt das: ein Denken, das sich auf einem unklaren Grund etabliert. Andererseits, w i e jed er A k t A ha t au ch da s D en ken se ine ver geg enw är t i gen d e Mo d if i ka t i o n R(A), und wie jede andere R kann diese auf t au c h e n und im inneren Bewusstsein bewusst sein, ohne dass sie oder ihr Objekt oder das Objekt ihres Objekts (die Rede vom Objekt ist freilich impliziert zu nehmen) g e m ei nt ist. In der Reproduktion einer meinenden Wahrnehmung ist das Meinen eines Dinges reproduziert. Das sagt aber nicht, dass ein wirkliches, impressionales Meinen sich dem vergegenwärtigten Gegenstand zuwendet. Und geschieht das, so ist dieses impressionale Meinen und das demselben Gegenstand zugerichtete vergegenwärtigte Meinen (Quasi-Meinen) zu unterscheiden. So kann ich mich auch erinnern, ohne dem Erinnerten zugewendet zu sein (die Erinnerung regt sich, lebt auf, aber im Hintergrund des Blickfeldes des „Meinens“). Die frühere Zuwendung kann ich mir in den meinenden Blick bringen, aber die jetzige Meinung, das Hinblicken, Betrachten des in der Wiedererinnerung vor mir ablaufenden Vorgangs ist nicht bloß Reproduktion der früheren Wahrnehmung. Es deckt sich damit, aber ein Strahl von Aktualität geht da durch (bzw. ein wirklicher Aktstrahl und nicht ein bloßes Aktphantasma etc.). Wie ist es nun, wenn sich ein „Gedanke regt“, während ich anderen Dingen zugewendet bin? Und zwar wenn sich eine Überzeugung regt?1 Das kann besagen: Ich habe schon die aktuelle Überzeugung und die ist Meinung, ein objektivierender Akt. Aber es bestehen noch Unterscheide zwischen thematischer Überzeugung und nicht-

1 Das, was hier ausgeführt ist, kann leicht missverstanden werden. Ich hatte immer gesagt: „aktuelles“ Meinen. Was ich sagen wollte, war: ein Akt des Meinens (= Impression), ein jetziger, wirklicher Akt, im Gegensatz zu der eventuellen reproduktiven Vergegenwärtigung eines Meinens, das in der Erinnerung und dgl. liegt. Der Akt des Meinens, der zum Feld des inneren Bewusstseins und nicht zum Feld der Reproduktion gehört, kann aber den Modus des Glaubens haben (einen Modus der „Aktualität“ unter anderen) oder den des „bloßen Sich-Denkens“ (Inaktualität), so wie ich das Urteil als „bloßes Phantasie-Urteil“ haben würde.

34

zur intentionalität der objektivation

thematischer. Sie liegt noch nicht in der Linie meiner thematischen und mich jetzt beherrschenden Interessen und des Hauptzugs thematischer Tendenzen.

§ 2. Das Urteil und seine retentionale Modifikation. Festhaltung und Nachdauer der Meinung gegenüber Nachklang ohne Festhaltung. Die wiedervergegenwärtigende Rückkehr zum Festgehaltenen

5

10

15

20

25

Es ist auch Folgendes zu beachten: Wenn ich jetzt urteile und dann mit Urteilen fortgehe, s o e r f ähr t d as Ur t eil , da s ic h v or hi n f ä l l t e , s e i ne re t e nt io na l e M od i f ika t i on, un d e s si nk t a uc h i ns Du nk e l h e ra b. W as b e sag t d ies es D un kel ? Ve r w and el t e s s i c h i n e i n e V e rg egen w ä rt ig un g? -- Ne in. Solange es noch „da“ ist, noch bewusst, noch festgehalten sogar, solange ist es keine Vergegenwärtigung, sondern eine Ret en ti o n, aber eine leere. Im „Herabsinken“ des gefällten Urteils nimmt seine Lebendigkeit ab, und es wird schließlich zu einem leeren. Also Retention (auch leere) gehört in die impressionale und nicht in die reproduktive Sphäre.1 Nun haben wir zwei Fälle: 1) Ich objektiviere, ich meine und gehe Schritt für Schritt im Meinen weiter.2 Indem ich das tue und „Synthesis“ vollziehe, übe ich in gewissem Sinn Retention, nämlich andauerndes Festhalten, Durchhalten der Meinung. Von Retention der Meinung wollen wir besser nicht sprechen, sondern von Festhaltung, Nachdauer der Meinung als solcher. In diesem Sinn haben wir zwischen a) dem Vollzug eines meinenden Schrittes im Einschnappen der Spontaneität, dem Neuvollzug einer Objektivierung, dem Einsetzen einer solchen und jedes neuen Gliedes einer solchen, und b) andererseits dem Fe s t h a l t en d e r M e i nu ng, No c hMe i n e n, Im-Rahmen-der-sich-durchführenden-Meinung-Halten zu unterscheiden.

1

Doppelsinn von Retention siehe unten, leere Retention bzw. leeres Abklingen des Urteils. 2 Erster Sinn von Retention: Festhalten der Meinung.

text nr. 3

5

10

15

20

25

30

35

35

2) Ich gehe zu einem neuen Denken über, mein Interesse wendet sich anderem zu.1 Mein Thema ändert sich; dabei aber habe ich noch N ac hk lang der soeben vollzogenen Objektivationen (Retention im gewöhnlichen und echten Sinn, sagen wir N a ch ge ge nw är t ig ung, Nachleben). Aber ich halte sie nicht fest, beziehe sie nicht ein in meine Meinung. Ich meine nun also nicht mehr, was ich vorhin gemeint hatte. Das Meinen lebt noch nach, aber es ist kein „Vollzug des Meinens“ mehr (kein Akt im allerengsten Sinn). Aktvollzug ist Andauer des Aktes, der als spontane Setzung anfängt, aber als „Festhalten“ immer noch ist und dauert, ungleich der „Retention“ des Nachlebens, die nur Bewusstsein des eben gewesenen Aktes ist, aber nicht mehr gegenwärtiger, fortdauernder Akt. Es fällt das nicht ohne weiteres mit der Änderung des Themas zusammen. Es kann sein, vielleicht, dass ich noch daran hängen bleibe, während schon ein Interesse sich Neuem zuwendet. Doch wird man dann sagen, dass ich solange noch das alte Thema habe, während das neue sich schon auftut. Es ist ferner zu sagen, dass ein Festhalten bestehen kann (innerhalb eines thematischen Zuges), ohne dass das Festgehaltene als synthetisches Glied sich in den Zug des neuen Urteils schon einordnet. Ich vollziehe einen synthetischen Zug und komme zu einem Resultat. Ich beginne einen neuen, halte aber noch fest: Das Resultat dürfte sich noch als wertvoll erweisen für das Spätere, dürfte in einem künftigen synthetischen Zusammenhang noch eine Rolle als synthetisches Glied spielen. Dabei aber ist zu bemerken: Das Zurückkehren zu dem dunkel Festgehaltenen ist natürlich ein Wiedervergegenwärtigen, falls ich es lebendig wieder erneuere. Wie ist es, wenn ich den meinenden Blick zurückwende? Es ist doch zunächst ein Unterschied: ein Meinen, das im Neuvollzug objektivierend fungiert, und das „NochFesthalten“ am Meinen, wenn ich abgewendet war, den primären Blick auf anderes inzwischen gerichtet hatte. Rückkehr ist Neuzuwendung, ist Objektivieren in dem ausgezeichneten Sinn des Neusetzens auf dem Grund der Noch-Meinung, mit der sich eventuell in identifizierender Deckung ein Reproduzieren verbindet. Das Die-Meinung-

1

Nachklang, Nachgegenwärtigung.

36

zur intentionalität der objektivation

Festhalten, etwa eines soeben gefällten Urteils, kann in doppelter Form statthaben: Entweder ich gehe weiter, um etwas anzuknüpfen, oder ich halte, etwa bevor ich weitergehe, den Blick des Meinens fest auf das Geurteilte gerichtet. Im letzteren Fall habe ich fortdauernd 5 primäre Zuwendung. Im anderen Fall zwar Festhaltung, aber zugleich Abwendung des Blickes.

10

15

20

25

30

35

§ 3. Die Regung eines Gedankens. Das nachlebende, abklingende Urteil als Urteilsmodifikation gegenüber dem aktuell sich vollziehenden Urteil. Das Entnehmen des Intentionalen aus einem unlebendigen Phänomen in einem Zug Wenn sich nun ein Gedanke regt, wenn ich einen Einfall habe, ehe ich aber ihn mir „zu eigen“ gemacht habe, so haben wir in ähnlicher Weise einen Modus von Objektivation, der doch noch nicht Objektivation in ganz besonderem Sinn ist. Ich folge etwa der Erörterung des Buches, vollziehe die Urteile, oder folge den Argumenten des Vortragenden, und es regt sich ein Gedanke (etwa ein Einwand oder eine Bekräftigung), und nun erst wende ich mich ihm zu und „vollziehe“ den Gedanken, der nun erst rechtes Leben gewinnt. Soll man sagen, das sei, dieses Sich-Regen, eine Art von Vergegenwärtigung? Es kann ja allerdings Wiederaufleben einer früheren, früher von mir vollzogenen Einsicht sein. Allgemein zu reden ist die Vergegenwärtigung, deutlicher, di e R epr o du k ti o n e i n e r f r ü h e r en W ah r ne h mu ng , ü be rh au pt e i ner fr ü h e re n S e t z u ng , Gr u n d fü r e i ne E r ne ue r un g d e r S e tzu n g se l b st. Ich erinnere mich, das meint in der Regel bei solchen Objektitäten, ich reproduziere nicht nur, ich werde im Allgemeinen nun auch glauben, nämlich an das früher Gesetzte, an das „Gewesene“. Ebenso Reproduktion eines Urteil führt in der meinenden Zuwendung zum früher Geurteilten zu einer neuen Setzung, ich urteile wieder. (Gehört da ein Wesensgesetz dazu, dass mindestens eine Motivation hier vorgezeichnet ist? Das früher Geurteilt-Haben, phansisch gesprochen die Vergegenwärtigung, notwendig ein Motiv für die neue Setzung?) Also wenn ein Gedanke, eine Meinung auftaucht, so wird es vielfach eine frühere meiner Meinungen sein. Das

text nr. 3

5

10

15

20

25

30

37

Auftauchen kann aber auch eine Vergegenwärtigung im weiteren Sinn sein, ohne Erinnerung zu sein, also keine Reproduktion im Sinn einer Erinnerung.1 So kann aber doch das Phänomen ähnlich sein, es kann das Vergegenwärtigte Seinscharakter haben. Das ist aber jetzt eine schwierige Situation. Vollzieht nicht das Urteil erst die Seinssetzung? Ist aber eine solche „Vergegenwärtigung“, mag es auch Vergegenwärtigung einer „Aussage“ sein, wenn ich nicht vollziehend mich betätige, also meinend der Sache zugewendet bin, ein Urteilen?2 Im Festhalten nach dem Urvollzug des Urteils haben wir eine Modifikation des Urteils, die noch Urteil ist. Warum ist nicht ebenso eine Antizipation, ein modifiziertes Urteilen vor dem Urteilsvollzug, eine eigene phänomenologische Art? Es scheint, dass wir etwa so auszuführen hätten. Das nachlebende, abklingende Urteil ist ein eigentümlich modifiziertes Phänomen gegenüber dem aktuell sich vollziehenden Urteil. Es ist kein Urteil mehr, kein Urteilsmeinen. Aber das gehört zum Wesen jeder solchen sich an das Urteilen anschließenden Modifikation, dass da das Sein des Sachverhalts zu entnehmen ist.3 Ich kann ein neues Urteil, eine neue Setzung etablieren, die jetzt eine entnehmende ist aus diesem einheitlichen Phänomen und die im „Wesen“ sich deckt mit dem ursprünglichen und etwa in voller Gleichheit wieder zu vollziehenden Urteil. Ich führe den Beweis und habe nun einsichtig den Anschlusssatz geurteilt, in einem bestimmten Vollzug. Nachher tritt die Modifikation ein, ich blicke darauf zurück, während ich es noch festhalte und sage e n t n eh m e n d: Weil das nun so ist usw. Das wirkliche Urteilen knüpft zusammen, das verknüpfte „Ganze“ ist nun eines, das zurücksinkt und immer verworrener wird. Was im wirklichen Vollzug gebildet war, eines auf das andere in lebensvoller Aktion (Setzung) sich bauend, das ist nun ein unlebendiges Phänomen, aus dem sich einheitlich ein „Dies“ entnehmen lässt, ein Entnehmen in einem Zug. So können wir überhaupt Phänomene haben, die den Charakter von Urteilsmodifikationen besitzen, in denen ein Meinen zwar nicht

1 Freilich ob es wirklich mit in den Rahmen des allgemeinen Begriffs der Vergegenwärtigung gehört? – Nein. 2 Warum denn Vergegenwärtigung?! Das Bewusstsein hat dabei doch nicht den Charakter eines Vergegenwärtigens eines Nicht-Gegenwärtigen! 3 Nein. Nachleben ist nicht Festhalten. Das Gesagte gilt nur vom Festhalten.

38

5

10

15

20

25

zur intentionalität der objektivation

aktuell, „lebendig“ aktiv vorliegt, die aber Modifikationen desselben enthalten. Und nun kann sich ein Meinen dem darin „verborgenen“ Intentionalen zuwenden; es kann, ohne dass die Meinung, die da in Modifikation bewusst ist, wirklich neu, in neuer expliziter Aktivität vollzogen und eigentlich aktualisiert wird, ein Meinen vollzogen werden, das i n ein em Üb e rsc hl a g, in einem Zug das Intentionale meint, und diese Meinung ist dann gleichwertig dem Urteil und kann in das Urteil (in den expliziten Vollzug) eventuell auch übergeführt werden. Wir können sagen, es sei zu unterscheiden zwischen expliziten und eigentlichen Urteilen (lebendigen, aktiven), spontanen Urteilsvollzügen und modifizierenden Gebilden, uneigentlichen, nicht-expliziten. Genauer: Objektivierende Meinungen sind es. Es ist etwas gemeint. Aber während das explizite Urteil als Urteilssynthesis sich in bestimmter Weise durch objektivierende aktive, lebendige Schritte aufbaut und in jedem Schritt Phänomene voraussetzt, Akte als Objektivationssubstrate, dient dem inexpliziten Urteil eine verworrene Reproduktion1 überhaupt, eine verworrene Urteilsmodifikation als Objektivationsfundament. Ich höre z. B. einen Satz, vollziehe die Verständniseinheit in verworrener Weise2 und das Ganze hat Aktualitätscharakter; ich vollziehe daraufhin setzende Meinung. Das ganze Phänomen könnte in demselben Charakter „genauso“ ohne Meinung bewusst sein, wie eine Wahrnehmungserscheinung es sein kann ohne wahrnehmendes Meinen oder eine Erinnerung. Überall kann ich das Meinen nach dem Substrat orientieren und komme zu einer objektivierenden Setzung.

§ 4. Unlebendiges, passives Urteilen als eine Modifikation des lebendigen, aktiven Urteilens. Der Vollzug der Urteilssynthesis und ihr Ergebnis 30

Es ist allerdings mehr als fraglich, ob das hier Dargestellte genug präzise und ausreichend ist. Aber Gutes ist wohl darin, wenn ich

1 2

Es ist fraglich, ob immer eine Reproduktion. Aber doch nicht als Reproduktion.

text nr. 3

5

10

15

20

25

30

39

nur wieder herausstreiche, was ich vorhin versuchte, als ob es sich um Vergegenwärtigungsmodifikationen und Analoga derselben Urteile handeln müsste. Es gibt sozusagen un lebe n di ge s , pas s iv es , re z ep t i ves , n i c h t w i rk li c h spo n tan e s U r te i l e n al s e in e Mo d if ik at io n d es l e ben d ig en , a kt i ven , wi rkl i ch s et ze n de n, d ara uf hi n - se tz en d en , bez i eh e nd en , b eg re i fe nd en un d zu s am m e nb e gre if en den u sw . U r t ei le n s. Das bloß passive Lesen, das bloß passive Aufnehmen, das Urteilen in Form der Verworrenheit, diese verworrenen Urteilsphänomene, „die verstandenen und gläubig aufgenommene Sätze“: Das deutet eine Weise des Bewusstseins der Sätze an, die einige Analogie hat mit einem verworrenen Phänomen einheitlicher sinnlicher Erscheinung. Dazwischen kann sich ein lebendig-explizites Denken anspinnen. Ich vollziehe, wenn auch in einem verworrenen Medium, in „Hinblick“ auf das einheitlich verworrene Verständnis des gehörten Satzes, eine einheitliche Setzung und urteile etwa wirklich: „Daraus folgt das und das“. Oder ich verstehe in einem Verworrenen eins und stimme zu: Ja! Es ist dabei noch der Unterschied, ob ich passiv hinnehmend höre oder lese, wobei ich „a u f me rk s a m bin“, oder ob ich eine Gedankenrichtung habe, die mir als verworrene Einheit durch den Kopf geht, während ich no c h ni ch t a u f m e rk s a m b i n. Zu beachten ist hier immer dabei, dass es sich um eigentümliche Modi des theoretischen Meinens, des Urteilens handelt. Man wird da Mehreres auseinanderhalten müssen. 1) Die aktuelle Setzung und Darauf-Setzung, der Vol l z ug der Urteilssynthesis Schritt für Schritt, in lebensvoller Aktivität, Spontaneität.1 2) Nach Abschluss des letzten Schritts die Summe, das Er ge bni s, das als Einheit dasteht, das ist, ein mit dem Abschlussschritt lebendiges und seinem Wesen nach diesen Prozess voraussetzendes Meinen wird „fe st g e h a lt e n“, und während das Phänomen abklingt, kann darauf weiter gebaut werden.2 Es kann auch, wenn es sich um das Schlussglied eines Beweises handelt, ein Rü ckb l i c k auf den Beweis in seiner, im nachlebenden Bewusstsein gegebenen, aber nicht

1 2

Urteil als spontaner Akt. Das Urteil als Ergebnis.

40

5

10

15

20

25

30

35

zur intentionalität der objektivation

mehr Aktives enthaltenden Einheit (die Schritte sind jetzt nicht mehr wirkliche Schritte, sondern Modifikationen von ihnen gehören einer passiven Einheit an) vollzogen werden. Ein m ei ne n de r, s e tze n de r Blick setzt jetzt das Ganze, „entnimmt“ aus dem Phänomen des Nachbewusstseins den Gegenstand. Dabei ist im Allgemeinen v on V erw o r ren h ei t k ei n e Red e oder braucht nicht die Rede zu sein. Ich urteile „S ist p!“ und knüpfe daran „Diese Tatsache!“ Ich blicke also auf das „Ergebnis“ hin oder zurück und mache die Tatsache zum Subjekt-worüber neuer Urteile. Aber das bleibt bestehen, dass zwischen dem lebendigen Aufeinandersetzen und dem Resultat (das im letzten Setzungsschritt ein Bewusstsein nicht sosehr vollendet, als aufgrund der nachlebenden Schritte erst gewinnt – das Bild mit dem Bau ist eigentlich schlecht) zu unterscheiden ist und dass dieses Endbewusstsein immer mehr an Leben und Deutlichkeit verliert. So wie der Schlussschritt vollzogen ist, beginnt schon das Verschwimmen und Verworrenwerden, ein stetiger Prozess. Aber es ist ein Bewusstsein, aus dem durch neue meinende Blicke Verschiedenes entnommen werden kann. Vor allem das gegenständliche Korrelat des Ganzen kann nun Gegenstand, „Vorgestelltes“, „Erfasstes“ werden. 3) Etwas anderes ist das v er wo rre n e B ew u ss t se i n, das nicht bloß nachlebendes Bewusstsein eines ursprünglichen Lebens, eines „wirklichen Vollzugs“ ist. Ich meine da s B e w us st s e in ei n es Sa t ze s , d a s V e r st e he n i m Le s e n un d v e r w or r en e „ U r tei l e n “ i m L e s e n. Hier baut sich ja auch wie aus Worten der Satz, so aus Gedanken das Verständnis auf, und fü r j e d e s Ver m e i nen , f ü r j e d e n A kt , d e r s i c h z e i t l i c h a u f b au t, g i l t d a ss e lb e w i e da s , wa s w ir z um Ur t e i l e n g es a g t h a be n, e r h a b e e i ne n Ab sc hl u ss , e i n Er g e bn i s e t c. 4) Und wieder etwas anderes sind sich „regende Gedanken“. Und dabei ist 5) zu fragen, wie es sich mit Vergegenwärtigungen von Meinungen verhält, die offenbar notwendig explizite Vergegenwärtigungen im „Wiedervollzug in der Erinnerung“ sind oder explizite Phantasierungen als „Vollzug in der Phantasie“ oder andererseits einheitlich vage Vergegenwärtigungen ohne expliziten Vollzug „in“ der Vergegenwärtigung. Frage: Wie stehen diese, insbesondere die letzteren zu den Bedeutungsintentionen der Ausdrücke? Und wie ist, was sub 3) aufge-

text nr. 3

41

führt ist, das Sich-Aufbauen der Bedeutungsintentionen komplexer Ausdrücke, prädikativer Aussagen und Aussagezusammenhänge zu verstehen?

Nr. 4 The mat i s ch es u nd un t h em a ti sc he s Be wu ss t se in . D er U n t ers c h ied un d das V e rh äl t n i s zw isc he n R ez ep t iv it ät u n d s ch öp fe ri sc he r Sp o nt an ei tä t 1

§ 1. Intentionale Erlebnisse im weiteren und engeren Sinn. Akte im prägnanten Sinn als Erlebnisse, in denen ein einheitliches Sich-Richten-auf-Gegenständliches statthat. Meinende Zuwendung und ihre Modi

5

10

15

20

25

30

Jeder Akt bezieht sich auf eine Gegenständlichkeit. Jedes Bewusstsein ist Bewusstsein von etwas. 1) Dieser Satz wurde, indem ich von B ren t an os Darstellung zunächst ausgegangen bin, von mir so verstanden: Eine und dieselbe Gegenständlichkeit kann eventuell intentionale sein für verschiedene „Weisen des Bewusstseins“, für verschiedene Akte. Dass S p ist, das denke ich mir; ein andermal urteile ich, dass S p ist (ich urteile „S ist p!“). Wieder einmal wünsche ich: „S möge p sein“. Wieder einmal frage ich: „Ist S p?“ usw. In allen diesen Fällen bezieht sich ein Bewusstsein in verschiedener Weise, aber auf eine und dieselbe Gegenständlichkeit „S ist p“, bloß denkend, wünschend, urteilend, sich freuend etc. Von da ausgehend kam ich auf die Ausbildung der Begriffe Materie und Qualität. Indem ich diese „Gegenständlichkeit“, auf die sich der Akt bezieht, festhielt und die Bewusstseinsweisen sich differenzieren ließ, sagte ich mir, in den Erlebnissen selbst muss ein Gemeinsames sein, und dieses Gemeinsame nannte ich die phänomenologische Materie. 2) B r e nt a n o ging wohl aus von der subjektiv psychologischen Betrachtung, indem er sich sagte: Im Bewusstsein, in Form verschiedener Akte kann eine Gegenständlichkeit „intentionale“ („immanente“) sein, und ist sie es dank eines Vorstellens, das sie zur Vorstellung bringt, dann kann sich das Bewusstsein noch in verschiedenen weite-

1

März 1911.

text nr. 4

5

10

15

20

25

30

43

ren Weisen zu demselben immanenten Gegenstand verhalten. Er kam so zur Lehre, dass jedes Bewusstsein entweder Vorstellung ist oder eine Vorstellung zur Grundlage hat. Die phänomenologische Materie reduzierte sich für ihn auf einen konkreten phänomenologischen Bestand: einen Vorstellungsakt. Das führt aber auf Schwierigkeiten. Aber eins ist sicher, es gibt den Unterschied schlichten und fundierten Bewusstseins, und dabei kann das fundierende und fundierte Bewusstsein in der Tat von derselben „Materie“ sein. Nur meinte ich, dass zwei Bewusstseinsakte, die dieselbe Materie in diesem Sinn haben, keineswegs in diesem Verhältnis stehen und auch keineswegs einen konkreten Akt, genannt Vorstellen, gemeinsam haben müssen, der die identische Materie ausmache.1 Alle einfältigen – ich könnte sagen: qualitativ einschichtigen – Akte derselben Materie rechnete ich zu einer „Grundklasse“: Vorstellungen. 3) Die qualitativ einschichtigen Akte sind insofern objektivierend, als alle anderen Akte ihnen die phänomenologische Materie und damit die Beziehung auf die Gegenständlichkeit in gewissem Sinn verdanken. Zunächst muss eine Gegenständlichkeit überhaupt vorstellig sein, dann kann sie für das Bewusstsein noch anderes sein. Aber leider ist damit nicht gesagt, dass alle qualitativ einschichtigen Bewusstseinsarten von einer wesentlich einheitlichen Gattung sind. Es kann hier aber noch ein anderer Unterschied in Betracht kommen und so überhaupt, wenn von objektivierenden Akten die Rede ist. Es kann dann angeknüpft werden an einen engeren Begriff von Akt. In einem weiteren Sinn kann Bewusstsein von einem Gegenstand statthaben, ohne dass dieses Bewusstsein sich i m p rä g nan t e n Si n n a u f e i n e Ge g e n s t ä n d li c hk e it „ r i cht e t “. Ich unterscheide unter dem Titel objektivierende Akte im weiteren Kreis der intentionalen Erlebnisse eine engere Gruppe. 1) Im weiteren Kreis d i e s e r in t e n t i on a l e n E r l e bn i ss e üb er h a up t (Akte im Sinn der Logischen Untersuchungen, im allerweitesten Kreis also) scheiden sich: 2) A k t e i n e i n e m pr ä g na n t e n und e ng e r e n S in n, Erlebnisse, in denen ein e i g e n tl i c he s Si c h- Ri c ht en -a uf -

1 Qualitativ einschichtige Akte, deren Gesamtmaterie nicht mehrere Qualitätsschichten hat.

44

5

10

15

20

25

30

35

zur intentionalität der objektivation

G egenst änd li c h es statthat.1 Jedes intentionale Erlebnis ist Bewusstsein von etwas, mag es sich auch z. B. um eine Hintergrundwahrnehmung handeln. Es „bezieht“ sich auf das, wovon es Bewusstsein ist, und so heißt es „intentionales“, gleichsam sich-darauf-richtendes. Aber eigentlich gerichtet sind wir nur in solchen intentionalen Erlebnissen auf dieses Was, in denen wir diesem Was zugewendet sind. So z. B. sind wir einem Gegenstand, den wir betrachten, zugewendet. Die umgebenden Gegenstände sehen wir auch, sie sind für uns bewusstseinsmäßig da, wir sind ihnen aber nicht zugewendet, wir sind nicht auf sie in einem spezifischen Sinn gerichtet. Also hier ist zunächst an jeden Fall schlichter Aufmerksamkeit (in der Sphäre schlichter Perzeptionen) zu denken. Es sind hier mehrere Unterschiede zu beschreiben: Dasjenige, dem wir nicht im eigentlichen Sinn zugewendet sind, kann dem völlig vagen Hintergrund angehören, es kann aber auch schon me r kl i ch sein, in gewisser Weise abgehoben sein gegenüber dem letzten Bewusstseinshintergrund. Und es kann sich stufenweise vom Hintergrund etwas abheben, merklich werden, und dann der Strahl der Zuwendung hineinleuchten. Hierbei haben wir gewisse zu beschreibende phänomenologische Abwandlungen. Diese Zuwendung kann man auch bezeichnen als Z um - Th e m aM a c he n (im ersten Sinn: der bloßen Aufmerksamkeit); das thematische Objekt ist aufgemerktes und nicht bloß bemerktes, so in der Sphäre der schlichten Perzeptionen; und Ähnliches, wird man sagen, gilt in der Stufe der höheren, der spontanen Akte, der Synthese etc. Es ist aber der Begriff der Zuwendung noch durch Hinzunahme einiger ihr zugehöriger Unterschiede zu bestimmen. Es ist ein Unterschied zwischen der Sph ä re de s Me r kl ic he n, des Abgehobenen, durch das kein Strahl der Zuwendung hindurchgeht und eventuell soeben hindurchgegangen ist, und der Sphäre des N oc h -F e s t ge h a l t en e n, dem soeben eine Zuwendung Gunst erteilte. Oder, wie wir ebenso sagen können: Wir müssen unter dem Titel „thematischer Akt“ unterscheiden das primäre Sich-Zuwenden bzw. Zugewendetsein (vom Übergangsphänomen des Sich-Zuwendens sehen wir ab) und das nach Übergang zu einem neuen primären

1

Akt im prägnanten Sinn = cogito.

text nr. 4

5

10

15

20

25

30

45

Zugewendetsein zu anderem Noch-Festhalten, das sekundär thematische. Das also nehmen wir zusammen, wenn wir von m ei n en d e r Z u w en du ng und Sich-Richten-auf sprechen. Es hat, sagen wir hier, Zuwendungsmodi, Modi des Meinens. Alles Objektivieren in dem doppelten Sinn des Zum-spezifischen-Objekt-Machens und ZumObjekt-Habens gehört hierher. Ob das eine Beschränkung ist, da wir von „hierher gehören“ sprechen, das werden wir ausführlich zu erwägen haben; ob also Verschiedenheit der Akte jeder Klasse Verschiedenheiten betrifft zwischen sich zuwendendem Denken, sich zuwendendem Wünschen etc. und solchem, das es nicht ist, und ebenso, ob der Begriff der Merklichkeit entsprechend zu erweitern ist. Wir betrachten eine Landschaft. Sie ist unser „Thema“; wir betrachten innerhalb ihrer Einheit nach und nach einzelne Baumgruppen, Berge, Täler etc.1 Sie sind unsere Sonderthemen, ebenso die besonders erfassten Beschaffenheiten, Momente derselben. Innerhalb dieser thematischen Intentionalität treten hier dann Vorkommnisse auf: Im fortschreitenden Einzelbetrachten wird das Gesamtobjekt, aus dem wir Einzelnes herausnehmen und betrachten, nicht bloß festgehalten (das Phänomen der Objektwahrnehmung bleibt nicht ungeändert und steht nicht einfach neben den Phänomenen der Einzelbetrachtung). Ohne dass der primäre Strahl der Zuwendung anderem gilt als dem Einzelnen, erfährt das Objekt „Näherbestimmung“, es „bereichert sich seine Intentionalität“ usw. (Diese zum Wesen des thematischen Objektivierens gehörigen thematischen Funktionen und Leistungen sind zu studieren.) Die Rede von Zuwendung, von einem Strahl des Gerichtetseinsauf usw. ist eine formale Rede. Sie hebt in der Tat gewisse allgemeine Formen hervor, auf die wir aufmerksam sein können; aber mit ihnen gehen Hand in Hand funktionelle Wesensvorkommnisse in den Akten, die vom Licht der Zuwendung durchleuchtet oder vielmehr durch diesen Modus ein eigentümliches Leben und ein Spiel eigentümlicher Leistungen empfangen oder, wenn man will, eine eigene Leistungsfähigkeit.

1 Also nicht thematisch im Sinn anderer Manuskripte, also nicht im Sinn des theoretischen Interesses.

46

5

10

15

20

25

30

zur intentionalität der objektivation

Indem hier nun ein neues Leben lebt, organisiert sich in diesem Leben Neues und Neues. Es konstituieren sich neue Objekte, was eben sagt, dass die Akte sich nach ihrem Gehalt ändern und zu neuen Aktgebilden organisieren; es bilden sich Synthesen und konstituieren sich synthetische Objekte etc. In jeder Stufe, scheint es, haben wir U nt er sc hi ede z w i sc hen Pri mär em und Se ku ndä r e m. Und ferner, jedes solche Gebilde kann in den Hintergrund der bloßen Merklichkeit oder in den letzten vagen Hintergrund rücken. Umgekehrt können Gebilde dieser Art schon im Hintergrund sein und auftauchen, Zuwendung sich mit ihnen verbinden etc. Zuwendung ist dabei zunächst etwas Einfaches, wie in der Stufe des schlichten Aufmerkens; aber mehrfache Zuwendungen, das heißt, mehrere spezifische Akte, die dieses Leben haben, in denen das Ich sich richtet etc., können sich verbinden, so dass das Ganze wieder den Charakter einer Zuwendung höherer Stufe hat (ein Akt höherer Stufe mit fundierter Zuwendung) etc. Das ist das Feld der Studien. H i ns i c h t l i ch d e r G em üt sak t e wäre von vornherein auf Folgendes hinzuweisen. Betrachte ich eine Landschaft mit Wohlgefallen, so wird es, wenn es „lebhaft“ ist, merklich sein, aber darum nicht notwendig selbst Zielpunkt einer Richtung-auf. Andererseits wird man zu sagen versuchen, d a s W oh l g e f a ll en s el b s t hat R i ch tun g a u f di e La n d s c ha f t und nicht nur das Betrachten. Ebenso im ästhetischen Wohlgefallen an einem Bildobjekt. Wieder, e i n Wi l le r ic h t e t si c h , ei n Wu ns c h r i c h t e t s i c h. Damit hängen freilich schwierige Problem zusammen. Wir lassen jetzt offen, wie weit diese Analogie trägt.1 Wir sprechen nun speziell vom „thematischen“ nur beim theoretischen doxischen Sich-Richten-auf, nur bei der theoretischen Zuwendung und den theoretischen doxischen Akten sagen wir vorläufig, dass in denen solch thematische Richtung waltet.2 3) W oh l u n t er s c h i e d e n halten muss man die thematischen (objektivierenden) Akte im bisherigen Sinn von den Akten des „Interesses“, die spezifischen Objekte des Vorstellens und Denkens von O bj e kte n d e s t h eo r e t is c he n I nt e r e ss e s (interessanten Objekten). Einheit des „Themas“ im engeren Sinn, z. B. in meiner theore-

1 2

Ausschluss der Gemütsakte, also Beschränkung auf doxische Akte. Engster Begriff von Thema (Sphäre des theoretischen Interesses).

text nr. 4

47

tisch-mathematischen Beschäftigung. Was ich als hierein gehörig und nicht hierein gehörig charakterisiert habe etc. Bleibe beim Thema! Aber auch: Sei aufmerksam! (Enger Begriff von Aufmerksamkeit.) Das bleibe ausgeschieden.

5

10

15

20

25

30

§ 2. Das thematische Meinen. Thema und Gegenstand. Thematischer Inhalt und Charakter. Thematisch schlichte Objektivation und sich darauf bauende synthetische Objektivationen Das thematische Meinen, eventuell mit seiner Grundlage, würde dann einen p rä gn a nt en B e gri f f vo n obj e kt iv i er en d em Akt definieren. Auf dieses baut sich in höherer Stufe als Gefallen, Wünschen ein „Akt“, in dem, was er Neues bietet, n oc h k ei n the m a tis c h e s Me i n e n l e b t, er gehört noch zum Unbewusstsein und ist doch ausgezeichnet durch sein besonderes Gerichtetsein. Aber jedes Bewusstsein kann Unterlage für ein thematisches sein, und so erwächst hier aus dem nicht-objektivierenden Akt des Wohlgefallens ein objektivierender, in dem das thematische Objekt als wohlgefällig thematisch da steht.1 Sehen wir genauer zu, s o s c he i d e t sic h d ie F unk ti on, d i e zu m Th e ma m a c ht , v o n de m Be w u ss t s ei n, d a s d as The ma h er g ib t, und zwar in dieser besonderen Weise, nach welcher nicht das Erlebnis als phänomenologisches Datum zum Objekt wird (in dem ein thematisch beseeltes, reflektives Anschauen sich darauf richtet), sondern das Erlebnis durch ein thematisches Meinen Beseelung erfährt und hierdurch ein Intentionales zum Objekt wird. Nun ist auch diese Rede ungenau. Denn wir finden nicht identisch dasselbe Erlebnis (von demselben phänomenologischen Gehalt), das einmal eine beseelende Beigabe erfährt und das andere Mal nicht. Vielmehr tritt eine gewisse Modifikation ein; es handelt sich um gewisse Wesensveränderungen, die zur Einheit gebracht werden unter dem Titel „Ein nicht von Aufmerksamkeit und thematischem Meinen

1 Also doxisch objektivierender Akt (sowohl aktuelles wie inaktuelles objektivierendes Bewusstsein) = thematisches Meinen (auch = theoretisches, doxisches Meinen).

48

5

10

15

20

25

30

zur intentionalität der objektivation

beseeltes Wahrnehmen etc. verwandelt sich in ein Wahrnehmen etc., das Träger eines thematischen Meinens ist“. Man wird wohl sagen dürfen: J ed es Er le b ni s i s t B e w u ss ts e in u n d l äs st d i e U mw an dl un g in ei n th em at i s ch me in end es zu, und jedes ist wahrnehmbar und kann so selbst zum thematischen Objekt werden. Ein Phantasma kann im Hintergrund bleiben: Es kann aber auch ein thematisches Betrachten des Phantasieinhalts statthaben und wieder ein thematisches Betrachten des Phantasierens, wobei ein Wahrnehmen sich auf das Phantasieren richtet. D i e Sph är e d e r A uf m er ks am k eit u nd d es th e ma ti sc he n M e in e ns g i bt e i ne n b e son d er en B eg r i ff vo n B ew u ss ts e in1 v or. Nennt man dieses Meinen selbst Bewusstsein, dann ist es eine Funktion, die bewusst im spezifischen Sinn macht, aber es ist kein konkretes Erlebnis. Es setzt immer einen Erlebnisgehalt voraus, eben das, was ein Meinen von etwas, ein Konstituieren gemeinter Gegenständlichkeit voraussetzt. Man kann aber auch jedes konkrete Erlebnis, in dem die thematische Funktion waltet, in dem also etwas thematisch bewusst ist, ein meinendes, sich-richtendes, ein intendierendes Bewusstsein (einen Akt) nennen und dann in der doppelten Weise, dass das meinende Bewusstsein (das Meinen mit seiner Grundlage) objektivierendes Bewusstsein heißt und ein fundiertes „Bewusstsein“, das sich auf das Gemeinte richtet, intendierendes Bewusstsein im weiteren Sinn. Das heißt, dass man 1) das thematische Meinen „Bewussthaben von etwas“ im besonderen Sinn nennt, und das ist verwandt mit dem Bewusstseinsbegriff aus der inneren Wahrnehmung, die nur ein sehr besonderer Fall davon ist;2 2) dass man jedes Bewusstsein, das solches zur Grundlage hat, Bewusstsein von etwas, genauer, in te nd i e ren d e s E r le b n i s nennt. Unter einem Be w u s s t se i n i m w ei t e r e n Si n n wäre dann zu verstehen jedes Erlebnis, das entweder ein Meinen von etwas ist oder das durch ein Meinen zu beseelen ist (wirklich patent intendierend –

1 „Bewusstsein“ als thematisches Meinen = objektivierendes Bewusstsein. Aktuelles und inaktuelles, und dazu jeder Akt, der ein solches Meinen zur Grundlage hat. 2 Bewusstsein in diesem engeren Sinn = patentes Bewusstsein; im engsten Sinn patente Objektivation.

text nr. 4

5

10

15

20

25

30

49

latente Intentionalität).1 Und zum Letzteren gehört auch der ausgezeichnete Fall, wo auf ein Meinen sich ein neues Erlebnis baut, darin fundiert ist, das selbst wieder durch ein Meinen zu beseelen ist und durch die Art, wie es als ein fundiertes Moment Erlebnis ist, ein mit dem Fundierenden einiges Gegenständliches konstituiert. Das ist freilich nicht gut genug gesagt. Ein „B ew us s ts ei ns c ha ra k ter“, ein „Aktcharakter“ tritt zum thematischen Bewusstsein hinzu, „gerichtet“ auf Gegenständlichkeit, und wo immer das der Fall ist, da kann eine neue thematische Gegenständlichkeit konstituiert werden, die ein neues thematisches Moment der bisherigen hinzufügt, das das gegenständliche Korrelat dieses Charakters ist. (Wir können den Bewusstseinscharakter auch i nt en t ion ale n C ha ra kt e r nennen, er „gewinnt“ ja Intentionalität. Besser „Bewusstseinscharakter“ als intentionaler Charakter.) Im Übrigen muss bemerkt werden, dass Aktcharakter (= Bewusstseinscharakter im weiteren Sinn) hier nicht gegenübergestellt werden soll irgendeinem phänomenologischen Inhalt des konkreten Aktes, der nicht Aktcharakter ist. (So wie ich das früher hinsichtlich der Empfindung getan habe.) Vielmehr lassen wir es offen, ob nicht notwendig jedes Bestandstück von Bewusstsein selbst wieder „Bewusstsein von“ ist2 und ob nicht alles, was wir unter dem Titel Empfindungsinhalt als adäquat gegebenes Nichtbewusstsein bezeichnen, nicht hier wie überall bloß adäquat Herausgemeintes aus einem Bewusstsein ist. Was sagt aber dieses „bloß“? Das würde sagen, dass z. B. das, was wir Bewusstsein nennen, nicht seinerseits wieder bewusst ist (wahrgenommen, empfunden etc. ist), dass dagegen, was wir Empfindungsinhalt nennen, nicht Bewusstsein, aber aus Bewusstsein zu entnehmen ist und nur in diesem Sein besteht. Es ist darum doch Seiendes, aber dieses Sein liegt in einer anderen Linie. (Es ist, was es ist, nur als intentionales Sein.) Bewusstsein selbst aber ist nicht intentionales Sein, sofern wir sagen können, es ist zwar zum intentionalen Objekt zu machen, aber es ist nicht bloß intentionales Korrelat.

1 Endlich: Bewusstsein im weiteren Sinn = teils nicht wirklich intentionales und teils wirklich intentionales oder latent intentional und wirklich intentional. Oder auch „Bewusstsein“ ist latentes und patentes. 2 Intentionaler Charakter ist dagegen nicht „Intention“, könnte man sagen.

50

5

10

15

20

25

30

zur intentionalität der objektivation

Empfindungsinhalt ist kein reelles Bestandstück von Bewusstsein, sondern aus Bewusstsein adäquat als Gegebenheit zu entnehmen. Ein thematisches (objektivierendes) Bewusstsein ist au f et w as al s „ The m a “ ger ic h t et,1 z. B. ein thematisches Wahrnehmen auf das Wahrgenommene, ein Urteil „Dieses Papier ist weiß!“ auf: Dieses Papier ist weiß. D a s T h em a u n ters c he i de n w ir v om G e ge nst an d. Im Urteilen steht das „Urteil“ im logischen Sinn da (die „vermeinte Wahrheit“) als das, worauf das Urteilsbewusstsein „th e m at i sc h ger ic h t et“ ist, während wir vom „Sachverhalt selbst“ sagen, dass auf ihn das Bewusstsein o b j ek tiv g er ic ht e t, dass dieses in ihm intendiert ist.2 Das Thema lässt eine Unterscheidung zu in t he m a t is ch en I n ha l t (thematische Materie) und „Ch ara kt er“, m oda l e Qu al if i z i e r u n g d e s Th em a s. Und diese Q u al if i zi er ung ka nn en tw e de r a k tu e l l e o d er ged a nk enh af t mod i fi zi e r te se in. Und all dem entsprechen parallele phänomenologische Unterschiede. Mehrere „intentionale Erlebnisse“ können phänomenologisch sehr verschieden sein (z. B. Unterschiede der Lebendigkeit und Anschaulichkeit), aber vom identisch selben Thema sein, und sie können zwar verschiedene Themen haben, aber Themen von demselben thematischen Inhalt, so dass sie sich thematisch nur durch die modale Qualität unterscheiden. So zunächst für bloß objektivierende Erlebnisse. Ferner können mehrere intentionale Erlebnisse, die nicht bloß objektivierend sind (aber als intentionale solche zur Grundlage haben), sich ebenso verhalten, wie wir in den vorstehenden Unterschieden angegeben haben. Sofern wir die Möglichkeit finden werden, den Begriff des Themas zu erweitern, können wir auch von theoretischem (objektivierendem) Thema sprechen, und somit sind diese Vergleichungen und Unterscheidungen, von denen soeben gesprochen war, nur auf ihren doxisch-theoretischen Gehalt bezogen.

1 Als „Thema gerichtet“ besagt „zugewendet“, im eigentlichen Sinn „gerichtet“. Ein jedes intentionale Erlebnis „bezieht“ sich auf Gegenstände, und schon da könnte man von „gerichtet“ sprechen; aber erst in der „Zuwendung-zu“ haben wir Richtung im ausgezeichneten Sinn. „Thematisch gerichtet“ darf also nur jenes im eigentlichen Sinn Gerichtetsein besagen und dabei nicht etwa das „mit Interesse gerichtet“. Diese Einschränkung ist hier nicht in Frage. 2 Der Gegenstand selbst, wenn wir voraussetzen, dass er existiert.

text nr. 4

5

10

15

20

25

30

35

51

Es gehört eben zum Wesen der intentionalen Erlebnisse, dass sie gegenständliche Beziehung in dem Sinn haben, dass sie sich vermöge einer Richtung auf ein objektivierendes Thema auf Gegenständliches beziehen, und das nicht nur insofern, als die objektivierenden Akte ihrer Unterlage es tun, sondern es hat einen phänomenologisch guten Sinn von der Richtung auch der fundierten Bewusstseinscharaktere auf das theoretische Thema bzw. auf die Gegenständlichkeit zu sprechen. Jedes fundierte intentionale Erlebnis hat „substruierte“ theoretische Themata. Objektivierendes Thema = objektivierende, doxische (theoretische) Gemeintheit. Weiter ist in Betreff der objektivierenden Akte zu sagen: Alle Objektivation führt zurück auf Objektivationen unterster Stufe; das sind die v o r s t e l l e n d en A kt e i m e ngs te n S inn. Auf diese bauen sich die synthetischen Objektivationen in apriorischen Formen, welche die reine Grammatik als Formenlehre der objektivierenden Themata (= der objektivierenden Bedeutungen im „ontischen Sinn“, wie ich immer sagte, und jetzt sage ich besser: der Bedeutungen im thematischen Sinn oder thematische Bedeutungen) behandelt. Denken wir uns irgendwelche Objektivationen, so können wir logisch daraus immer neue bilden. Gehen wir von thematischen schlichten Objektivationen aus, so kommen wir immer wieder zu Objektivationen. Andererseits können sich aber neue intentionale Erlebnisse durch neue, nicht-objektivierende Aktcharaktere bilden. Es ist hier aber wichtig, Folgendes herauszustellen. Die Objektivationen unterster Stufe haben ihre Parallele in sozusagen unbewussten latenten Objektivationen, und es hat einen guten Sinn zu sagen, sie erwachsen aus latenten Objektivationen dadurch, dass sich in ihnen ein entnehmendes Meinen etabliert, das aus ihnen, sie zugleich in objektivierende Meinungen verwandelnd, eine Objektität herausmeint. So z. B. vollziehen wir ein Hintergrundwahrnehmen (und überhaupt ein Hintergrundanschauen) und dann wendet sich der bemerkende und thematisch meinende Blick dem wahrgenommenen Gegenstand zu, das ist, das Hintergrundwahrnehmen verwandelt sich in ein thematisches Wahrnehmen (überhaupt thematisches Anschauen). Auch beim Leervorstellen (dem dunklen Vorstellen – wohl zu unterscheiden von einem Hintergrundvorstellen) ist das auszuführen.

52

5

10

15

20

25

30

zur intentionalität der objektivation

Nun gehört es zum Wesen von thematisch meinenden Erlebnissen, dass sie in Synthese treten können; es gehört zu ihnen, dass sie in bestimmten Formen zu immer neuen synthetischen Komplikationen und Modifikationen Gründe abgeben können. Es erwachsen so aus den ursprünglich schlichten Vorstellungen synthetische Akte höherer Stufe (synthetisches Bewusstsein, sage ich lieber), fundiert in den schlichten, und dabei immerfort objektivierend, durch und durch nicht nur nach den fundierenden Teilen, sondern als Ganze thematisch meinend. Diese synthetischen Akte sind, wird man einwenden, nicht genau in dem Sinn objektivierende als die unterliegenden.1 Es bedürfte freilich genauerer Beschreibungen. Ein Gegenstand lenkt das Interesse auf sich, der schon vorstellig ist und nun zum besonderen Bemerken kommt, an ihm wird ein Glanzlicht besonderes Merkmal, während der ganze noch im Bemerken festgehalten ist und das Moment eben als an ihm dasteht. Dabei tritt aber noch eine noch nicht erwähnte Schicht auf: Der Gegenstand ist zugleich als Uhr, das aufgesetzte Licht als Spiegeln erkannt usw., und die Uhr liegt auf den Papierblättern usw. Dabei unterscheiden sich innerhalb der Synthesen die G e ge ns t ä n d e - wo r ü b e r und die Sy nt h es en , d ie s el bs t ni ch t G eg e nst ä nd e - w o r üb e r sind, und die als so und so bestimmt aufgefassten und erkannten Gegenstände von denselben ein zweites Mal in der synthetischen Einheit anders aufgefassten und anders bestimmten Gegenständen. In den höheren Akten konstituieren sich neuartige Gegenständlichkeiten, die logisch-kategorialen, und sie konstituieren sich, das ist, sie sind in den betreffenden Akten nicht selbst Gegenstände-worüber, sondern werden es erst in neuen Akten, die sie „nominal modifizieren“. Nun hätte ich wohl, wie schon in den Logischen Untersuchungen, von vornherein auch bei der Wahrnehmung scheiden müssen: das Aufmerken auf den Gegenstand und das Worüber, das FunktionalForm in einer synthetischen Meinung ist, die nominale und subjektivische Form. Ich denke, wir müssen das „thematische Meinen“ vom „Aufmerken“ sondern und unter diesem Titel thematisches

1 Die synthetischen Akte sind meinend, das Worüber meinend und in Betreff dessen meinend, aber nicht meinend den Sachverhalt als Gegenstand-worüber.

text nr. 4

53

Meinen das ganze Spiel der synthetischen Akte verstehen, mit dem ihm einwohnenden Aufmerken; alles darin ist Gemeintes, was eben nicht besagt, Gemeintes als Subjekt oder Objekt einer Synthese, einer synthetischen Gemeintheit.

5

§ 3. Das passiv aufnehmende und entnehmende Betrachten und Explizieren gegenüber dem schöpferischen Konstituieren. Sinnliche gegenüber kategorialen Gegenständen. Zweierlei gebendes Bewusstsein: sinnlich gebende und synthetisch gebende Akte

Auf dieser Seite1 kommt eine Unstimmigkeit hinein. Die thematischen Akte, die objektivierenden, waren eingeführt als das schlichte Erfassen und als die daraufgebauten Denksynthesen (prädikativen Synthesen). Allerdings von vornherein war eine Unklarheit in Betreff des Sinnes von „t h e ma t i s ch“.2 1) Thema als Feld des Interesses: Ein herrschendes Interesse zeich15 net ein thematisches Feld aus. So sagt der Lehrer: „Sei aufmerksam!“, „Bleibe bei der Stange!“, oder man spricht vom Abschweifen der Aufmerksamkeit etc. Nun, bei diesem Abschweifen wird allerlei vom Schüler wahrnehmend erfasst. Das Wahrgenommene wird durch20 laufen, prädikative Synthesen werden vollzogen und ausdrückliche Urteile. Aber all das bildet eine Sphäre, die außerhalb des von der Schule und dem Lehrer geforderten Interesses liegt. Nun ist das natürlich auch ein Feld des Interesses. Und bei dem Schüler ist das das herrschende. Wenn wir nachdenken und momentan durchbricht 25 ein Stimmengeräusch von der Straße her die Sphäre unseres theoretischen Interesses, so empfinden wir die auf diese Sphäre hingerichteten Ten d e n ze n; andererseits sind wir wahrnehmend und eventuell auch urteilend zugewendet anderen Sachen, die momentan „unser Interesse in Anspruch nehmen“, jenen herrschenden Tendenzen zum

10

1 Husserl bezieht sich hier und an anderen Stellen auf den Text eines nicht mehr im Nachlass vorhandenen Blattes. Die folgenden Ausführungen (bis zum Ende von § 4) sollten diesen Text wohl ersetzen (vgl. dazu die Textbeschreibung in Husserliana XLIII/4, S. 56). – Anm. der Hrsg. 2 Das war aber oben ausdrücklich ausgeschaltet, also nicht übersehen.

54

5

10

15

20

25

30

35

zur intentionalität der objektivation

Trotz. Da steht also Interesse gegen Interesse, ein „momentanes“ Interesse gegen ein herrschendes, ein Sich-Durcheinanderschieben von Interessen und eventuell von relativ herrschenden und sich bekämpfenden Interessen. Das müsste näher beschrieben werden. 2) Aber so viel ist klar, dass diese Unterschiede nichts mit der „O b j ek t i vi eru ng“ zu tun haben, und nichts mit dem, was das Wesen der Betrachtung, Explikation, prädikativen Synthese, begreifenden Prädikation selbst ausmacht. Eine andere Frage ist es allerdings, ob der Versuch einer wesentlichen Trennung zwischen den schlicht betrachtenden bzw. explizierenden Akten (das wahrnehmende Durchlaufen und dgl.) und den denksynthetischen und prädikativen Akten nicht aus guten Gründen durchführbar ist. Jedenfalls liegt er in einer neuen Linie, und zunächst habe ich diese alle als wesentlich eins genommen, und so durften sie nicht unvermittelt und ohne zwingenden Grund hier gegenübergestellt werden. Das Aufmerken war eingeführt als der thematische Akt, und zwar als derjenige Akt dieser Sorte, der schlicht zuwendend, schlicht herausmeinend oder erfassend eine schon voraus konstituierte Gegenständlichkeit erfasst. Er weist also eventuell in niederster Stufe zurück auf das Hintergrundwahrnehmen und dgl. als vorthematischer Akt (der also kein aufmerkender ist). In höherer Stufe handelt es sich um das Hinblicken auf Sachverhalte, die originär anderweitig konstituiert waren und dgl. Es müsste hier der Schritt zu schlicht explizierenden Akten und anderen Akten also ausdrücklich eingeführt werden durch den Unterschied von Rezeptivität und schöpferischer Spontaneität. „Logischer Akt“, das passt natürlich nur auf die denksynthetischen Akte, in denen sich Subjekt, Merkmal (Bestimmung) etc. konstituiert. Es muss daher passend modifiziert werden. Es muss auch nicht heißen, alle thematischen Akte, sondern alle logischen Akte (Akte der spontanen theoretischen Synthesis) „weisen zurück auf schlichte Akte der Rezeptivität“ (die allerdings in gewissem weiteren Sinn auch Spontaneität enthält: das Erfassen selbst). Überhaupt wechselt jetzt das Wort „thematisch“ seinen Sinn. Es besagt plötzlich soviel wie „logisch“, wie synthetisch in der Stufe der schöpferischen Spontaneität. Und weiter verengt wohl auch der allgemeine Begriff des „intentionalen Erlebnisses“, des Aktes, seinen Sinn: Akte sind schöpferische Spontaneitäten, in denen sich schöpferisch Gegenständlichkeiten konstituieren.

text nr. 4

5

10

15

20

25

30

55

Im Bisherigen war das bloße Aufmerken, oder sagen wir lieber das schlichte Zuwenden, Erfassen eines Gegenstandes und das schlichte ihn Betrachten, ihn wahrnehmend oder erinnernd „Durchlaufen“ und dgl. unter den Titel des thematischen Meinens befasst, ebenso wie die höheren „thematischen“ Akte, die logischen Akte, Subjektsetzung, daraufhin Prädikatsetzung etc. Hier versuche ich aber eine Trennung, die sicher berechtigt ist, obschon das Problem im Auge behalten werden muss, ein Hauptproblem für das Verständnis der Konstitution des Bewusstseins überhaupt: das Problem, zu entscheiden, ob das schlichte Erfassen, Aufetwas-bevorzugend-Merken, Es-„aufmerksam-Betrachten“ (Explizieren) und andererseits das Vollziehen prädikativer Synthesen nicht sich zueinander verhalten wie niedere und höhere Stufe, und zwar innerhalb einer gattungsmäßigen Einheit.1 Jedenfalls berechtigt ist aber die Sonderung und Gegenüberstellung, die wir jetzt vollziehen, nämlich zwischen einerseits dem p as s i v e n, a uf n e h m e nde n , en tn ehm en d en B e tr a ch te n – wir sind rezeptiv, Vorgegebenes nehmen wir nur hin, wir setzen nichts, wir betätigen uns nicht in schöpferischer Weise etc.2 – und andererseits, wir vollziehen schöpferisches Tun, wir nehmen nicht hin, was uns auffällt, sondern wir setzen in Beziehung, wir beziehen auf Subjekte Prädikate, wir vergleichen und unterscheiden etc. Im einen Fall haben wir ein Feld der Rezeptivität in dem Explikationssubstrat; aber eigentlich haben wir kein Thema, weil wir keine These vollziehen. Die eigentliche Thesis liegt erst im Gebiet der schöpferischen Akte vor, als Subjektsetzung (Untersetzung), als Daraufhinsetzung, als Voraussetzung und Folgesetzung usw. Insofern können wir hier von eigentlich thematischen Akten (oder thetischen Akten) sprechen,3 natürlich auch von syn-thetischen, und es ist klar, dass das ko nt i nu i e r l ic he E i nh e its b e wu s s ts e i n, das vorliegt, wenn wir explizierend in purer passiver Betrachtung einen Gegenstand durchlaufend einen Teil auf

1 Aber cf., gerade was unten als „rezeptiv“ charakterisiert ist, das ist doch das bloße Aufmerken. 2 Ist das ganz korrekt? Ist das Erfassen, Betrachten nicht eine andere Stufe der Aktivität gegenüber dem „synthetischen“ Meinen? 3 Aber was wären einfache thetische Akte anderes als schlichte Zufassungen und Festhaltungen?

56

5

10

15

20

25

30

35

zur intentionalität der objektivation

dem Grund des Ganzen, das sich just aufgedrängt hat, aufnehmen, keine Syn-thesis ist, kein Setzen und kein das Gesetzte Zusammenfassen und zu einer höheren Einheit eines Synthemas Bringen. Also sprechen wir besser in der explikativen Sphäre nicht von Synthese. Also b ess er al s „ t hem at i sc h e “ sagen wir the t i sch e un d sy n t het i sc he Ak t e. Die synthetischen Akte setzen thetische voraus. Die prädikativen Akte setzen nominale, adjektivische Setzung voraus, und bei „eigentlichem“ Vollzug dieser Akte (was das ist, ist hier noch nicht untersucht) setzen diese Thesen „Entnehmungen“ voraus. Die logischen (theoretisch-synthetischen) Akte bauen sich dann auf auf Akten einer „Schicht der Sinnlichkeit“, auf schlicht erfassenden, explizierenden (entnehmenden); oder sollen wir sagen auf „bloß aufmerkenden“ Akten? Gehört ein prägnanter Sinn von „Aufmerksamkeit“ zu dieser Schicht? Doch wohl nicht. Denn: Die logischen Akte, die beziehenden Synthesen konstituieren n e ue G e g e ns t ä nd li c hke i t e n , a uf w el ch e sic h, na ch de m s i e ko n s t i t ui e rt s i nd , wi e de r e i n auf m erk en d er , sc hl i ch t er fa s s en d e r , b e t r a c h t e nd e r Bl ic k l en ke n l äss t. Und nun sind neue thetische und synthetische Akte möglich; die Synthemen, die sich in erster Stufe schöpferisch konstituiert haben, werden zu Gegenständenworüber in neuen Synthesen usw. Man kann sehr wohl die l og i s c h e n A kt e, die s ynt h et is c he n, a l s d i e i m e i g e nt l i c he n S i n n o bj e k t i v i er e nd en bezeichnen, sofern erst in ihnen Gegenstände-worüber als Subjekte von Bestimmungen bewusst werden. Aber was heißt denn im „eigentlichen Sinn“? Doch nichts anderes als „theoretisch“, logisch objektivierend, gegenüber bloß doxischen Akten der unteren Stufe, bloßer Erfahrung, bloßer Sinnlichkeit. In gewissem Sinn wird es auch sicher gesagt werden müssen, wie ich es ursprünglich sagte, dass alle thematischen Akte der schöpferischen Stufe, alle „produktiven“, „synthetischen“, zu r ü ck w e i s e n a uf A k t e , de n e n d i e „ Ge g e n s t ä nde “ e nt n o m me n , i n d e ne n d i e Ge g e ns t ä nd e „ ur s pr ü ng l i c h g e g eben “, v o r ge g e be n, passiv gegeben sind, während die thematischen Akte durch ihre synthetischen Funktionen Gegenstände schöpferisch „erzeugen“ (produktive Gegebenheit). Oder auch so: Die eigentlich theoretischen Akte (die produktiven, die Verstandesakte) mögen zunächst zurückweisen auf v or g e g e be n e Ge g e ns t ä nd e, die selbst

text nr. 4

5

10

15

20

25

30

57

wieder Verstandesgegenstände, produzierte sind. Aber schließlich kommen wir zu n ich t p ro du z i ert en G ege n stä nde n. Es ist das der Unterscheid zwischen s i nnl ich e n und ka teg o ri alen  G e gen s t än de n (in der logischen Sphäre). Die sinnlichen Gegenstände sind durch keine Synthese ge g eb e n ( urs pr ün g li c h g ege ben ); sie sind gegeben in reiner Rezeptivität, der keine Produktivität vorausgeht. Die sie gebenden, rein rezeptiven Akte, die rezipierend sind aufgrund einer ursprünglich gebenden Materie, sind die sinnlichen Wahrnehmungen (die sinnliche Erfahrung, aber originäre). Doch noch besser sagen wir: J ed em m ög li ch en G eg en st and e n t s p r i c h t ei n m ögl i c h e r, s ch l i ch t i hn e rf a ss en de r, sich ihm schlicht zuwendender (ihm, dem gegebenen) und eventuell ihn in der Gegebenheit explizierender Akt. Dabei müssen wir unterscheiden: den Blick der Zuwendung oder des Zugewendetseins (die Erfassungsform, den Charakter der Anschauung als erfassendes DaraufGerichtetsein) und das, was der Zuwendung die Materie, den phänomenologischen Gehalt1 gibt, nämlich das, was phänomenologisch das nehmende Erfassen gerade dieses Gegenstandes und dieses in der bestimmten Erscheinungsweise und dgl. ausmacht.2 In dieser Materie liegen nun gerade die wesentlichen Unterschiede. Dem nehmenden Erfassen entspricht sozusagen ein Geben, und wenn man die A n s c ha u u n g en „ geb en de Ak te “ nennt, so liegt das Geben in diesem phänomenologischen Gehalt. Auch ni c ht a n scha uen d e Akte können von der Art schlichter Zuwendungen und Erfassungen sein, wie wenn sich ein Gedanke vage regt und ich mich ihm zuwende und dgl.3 Es gibt nun z w e i e r l e i g e be n d es Be w u ss ts e i n oder zweierlei Gehalt gebende Akte. Einmal liegt i m G e be n e i ne r ei ne Pas s ivi t ä t. Die Rezeptivität des Nehmens, des Erfassens ist bloße Rezeptivität, weil bloße Aufnahme von etwas erfolgt, das nicht selbst wieder aus Spontaneität entsprossen ist. Also der Gegensatz macht es

1

Das heißt nachher Substrat. Erfassen im prägnanten Sinn = nehmendes Erfassen eines Gegebenen. 3 Geben und Erfassen ist im prägnanten Sinn zu nehmen. Dieses Geben ist Anschauen im erweiterten Sinn. Schlicht gegeben ist schlicht angeschaut. 2

58

5

10

15

20

25

30

zur intentionalität der objektivation

klar: Es wird etwas erfasst, und zwar im prägnanten Sinn, derart, dass erst ein spontaner Akt vorausgegangen sein muss, der die Materie des Erfassens vorbereitet und herstellt. Erst muss die Urteilssynthese hergestellt sein, damit ein erfassender Blick sich dem Sachverhalt zuwenden und ihn zum eigentlich erfassten Gegenstand machen kann.1 Für jedes (natürlich eigentliche) Erfassen gilt, dass ein Bewusstsein möglich ist, dass die volle Materie in gewisser Weise schon enthält, derart, dass wir sagen müssen, der Gegenstand sei schon bewusst, aber er sei noch nicht Gegenstand der Erfassung, der Zuwendung. Dazu bedarf es eben erst des Rezipierens, des Erfassens, Aufnehmens, was eine gewisse Modifikation jenes Bewusstseins – das im eigentlichen Sinn nicht bewusst macht, erfasst macht – mit sich führt. Dieses Bewusstsein ist einmal ein spontanes, in gewissem Sinn von Licht durchleuchtet (Spontaneität ist immer hell), und das andere Mal nicht spontan. Oder das originäre Konstituieren vor der Zuwendung, das e i g e nt l i c h g e b e nde, zeigt diesen kardinalen Unterschied der ursprünglich passiven Vorgegebenheit und der spontanen Erzeugung und Erzeugtheit. Dieser Wesensunterschied in der Art der Gegebenheit der s i nn l i c h g e b e n d e n und s y nt h e t i s c h ge ben de n Akt e setzt sich dann fort, hat dann seine Abwandlungen und führt zur allgemeineren Unterscheidung zwischen s i n n l i ch e n A kt e n und sy n th e ti sc hen ( s pe z if isc h l o g i s c he n ) A k t e n. Es gibt gewisse Abwandlungen, Modifikationen, die zu allen Akten unter Erhaltung ihres gattungsmäßigen Wesens gehören: so die Unterschiede der Klarheit und Verworrenheit und dgl., und die finden wir also in gleicher Weise bei den sinnlichen Konstitutionen und sinnlich erfassenden Akten und bei den synthetischen Konstitutionen (den Urteilsakten etc.) und den synthetisch fundierten, erfassenden Akten. Der Unterschied liegt dabei originär durchaus in dem Zuwendungsgehalt, also in der „Gegenstandskonstitution“. Man kann also, wenn man von der Erfassung, Zuwendung absieht, gegenüberstellen: sozusagen u r s pr üng l i ch to te s , b l i n de s Be w uss t s e in , s i nn l i ch e s (vor der Zuwendung), und s y nt he ti -

1 Die aktuelle Synthese ist notwendig, damit der Sachverhalt gegeben sein kann bzw. genommen, erfasst sein kann.

text nr. 4

59

sc h es B ew u sst s ein , ak t u ell e s Leb en. Man kann allgemein auch so sagen: Es gibt 1) das ursprünglich Stoffliche, da s u rs pr üng li ch S t o f f l ic he d er Rez ept ivit ät;1 2) S p on ta ne i t ät, und zwar die schlichteste Aktivität. Die unterste Stufe oder uneigentliche ist das 5 bloße Zuwenden, Erfassen des im bloßen Stoff blind, untätig Konstituierten. Dann kommt aber die schöpferische Spontaneität, die lebensvoll Stoffe, d. i. gegenständliche Beziehungen, neu erzeugt, und zwar so, dass ein derart Erzeugtes niemals ursprünglich anders gegeben sein kann als durch diese Spontaneität; dass es nur schlicht erfasst 10 werden kann als Gegebenes, gegebenes Objekt der Zuwendung, des Hinsehens und Fassens nur sein kann, nachdem es tätig erzeugt war. Ein Begriff der synthetisch erzeugten Gegenstände (Verstandesobjekte) gegenüber den bloß sinnlich empfangenen Gegenständen reicht aber über die „theoretische Sphäre“ hinaus.

15

§ 4. Die Schichtung in der Sphäre der Sinnlichkeit: physische Sinnlichkeit und Gemütssinnlichkeit

Wir müssen sagen: Nicht alle sc hö pf er i sc h er z e uge nde n A k t e sind l og i s ch e Akte. Korrelativ: Nicht alle thematischen, und zwar aus Thesis und Synthesis hervorgehenden, schöpferisch erzeug20 ten Gegenstände sind logische Gegenstände, Sachverhalte, Inbegriffe etc. Ebenso haben wir auch in der Sphäre der Sinnlichkeit kardinale Unterschiede; es gibt nicht nur eine ä s t he t i s ch e S i nn li ch kei t, sondern auch eine (sagen wir vorläufig) Ge mü t s s i nnl i ch ke it, und zum Wesen der letzteren gehört es, dass sie die erstere voraussetzt, in 25 ihr fundiert ist. Wir lassen es dahingestellt, ob jeder originär gebende, sinnliche Akt von vornherein geschichtet ist, ob er von vornherein neben ästhetisch-sinnlichem Material auch Gemütssinnlichkeit enthält.2 Jedenfalls, wenn er geschichtet ist, dann kann das „zum Gegenstand machende“ Erfassen und Betrachten sich entweder in der Unter30 schicht bewegen oder in die Oberschicht eintreten und sich ganz

1 Was besagt aber das „ursprünglich“? Ist das anderes, als was auf voriger Seite = S. 57,21 ff. das „geben“ heißt? 2 In weiterem Sinn gebend ist jeder sinnliche Akt, sofern er einer möglichen Erfassung darbietet ein Was der Erfassung. – Aber das darf nicht „gebend“ heißen!

60

5

10

15

20

25

30

35

zur intentionalität der objektivation

in ihr bewegen, wobei von der Unterschicht nur das Momente der Oberschicht in „dienender“ Weise speziell Fundierende in Betracht kommt; endlich kann auch die Betrachtung in der Einheit einer ungeschiedenen Erfassung des ästhetisch-axiologisch einheitlich erfassten Objekts vom einen in das andere wahllos übergehen. Ich betrachte zum Beispiel eine Blume. Ich kann einmal erfassend das Naturobjekt erfassen und mich in der Einheit dieses natürlichen Seins bewegen, oder ich kann das „schöne“ Objekt, die schöne Blume (in ihrer Schönheit) betrachten und erfassend und betrachtend in die Einheit eintreten, die das „wertende Bewusstsein“ herstellt und die in dem bloßen ästhetischen Objekt (der Natur) und gewissen Seiten desselben gegründet ist. Ich betrachte das schöne Objekt in seiner Schönheit: Ich erfasse und betrachte seine „Schönheiten“, seine Gefälligkeiten: die schöne Form, die schöne Farbe, den schönen Duft usw. Ich bewege mich „rein in der Oberschicht“; die Formbetrachtung etc. ist hier dienend für die Erfassung des Schönen und erfolgt nur soweit, als sie „dazu nötig“ ist. Es kann die „Einstellung“ von vornherein die Unterschicht herausnehmen und sie allein bevorzugen; so wenn der Naturforscher das Ding betrachtet, er „sieht“ nur das Naturobjekt. Es kann die Einstellung von vornherein auf das axiologische Objekt gehen, so wenn der ästhetische Betrachter (im gewöhnlichen Wortsinn: der schönheitsfreudige Betrachter, der Blumenfreund) die Blume betrachtet. Es kann aber sein, dass keine solche Bevorzugung statthat; das Objekt schlechthin lenkt den Blick auf sich und im Lauf der einheitlichen Betrachtung kommt bald Naturhaftes, bald Axiologisches zur Geltung. De r N a t u r g e ge n s t an d u nd de r a x i ol og i s c he d ur chdr i ng en s ich. Beide sind selbständig und durchdringen sich eigentümlich. Der Naturgegenstand ist völlig selbständig. Was das axiologische Bewusstsein heranbringt zum Naturgegenstand, der mindestens nach gewissen seiner Seiten (die aber doch das Ganze fordern) die axiologischen Momente fundiert, das ist eine unselbständige Schicht (ontisch wie phansisch). Charakteristisch ist die wesentlich verschiedene Art, wie die ästhetisch-natürlichen Merkmale im oder am Objekt sind und wie die axiologischen; die einen gehören zum Wesen des Naturgegenstandes, die anderen zu dem des axiologischen Gegenstandes. Also die axiologischen Merkmale sind dem Naturgegenstand „außerwesentlich“, sie kommen ihm zu, aber nicht als sein

text nr. 4

5

10

15

20

25

61

Wesen ausmachend, es innerlich bestimmend, verdeutlichend, näher bestimmend etc. Andererseits kommen sie ihm nicht zu wie relative Merkmale. In der „schlichten Betrachtung“ ist noch von keinen „Merkmalen“, „Bestimmungen“ die Rede. Aber in ihr schon unterscheiden sich die verschiedenen Weisen der schlichten Gegebenheit, die verschiedenen Einstellungen, die verschiedenen Explikationen, die „ästhetischen“ und axiologischen, während doch bloße Explikation statthat und in dieser Hinsicht keine Unterschiede bestehen. Es fehlt an einem richtigen Namen für das, was ich jetzt immer „ästhetische“ Sinnlichkeit nannte. Aber gerade das Wort hat ja einen axiologischen Sinn bekommen. Auch „physische Sinnlichkeit“ passt nicht, da es ja auch eine „innere“ Sinnlichkeit geben soll, mit ihr gleichartig. Eigentlich würde das Wort „physisch“, wenn wir nicht gewohnt wären, es so eng zu fassen, ganz gut dienen können. Natur im weitesten Sinn steht ja in Bezug zu dieser Sinnlichkeit.1 Sagen wir vorläufig: p hy s i s c h e Si n nl i ch keit, und verwundern wir uns, dass wir nicht theoretische Sinnlichkeit sagen dürfen als Parallele zu Gemütssinnlichkeit. In der Sphäre der Sinnlichkeit finden wir eine Schichtung; der in sich geschlossene konstituierte physische Gegenstand hat eine axiologische Schicht. Korrelativ: Das Natur konstituierende Bewusstsein trägt eine unselbständige Schicht axiologischen Bewusstseins, aber eines Bewusstseins, das nichts von Spontaneität enthält. Es kann nun aber auch ein auf physischer Sinnlichkeit gegründetes synthetischlogisches Bewusstsein eine axiologische Bewusstseinsschicht tragen und das ganze fundierte Bewusstsein wieder konstitutiv sein für eine neue Gegenständlichkeit.

1 Man könnte sagen, das geht doch nicht, da ja die innere Sinnlichkeit mit hierher gehört. – Überlegen.

62

5

10

15

20

25

zur intentionalität der objektivation § 5. Funktionell verflochtene Grundarten des Bewusstseins. Vordergrund- und Hintergrundbewusstsein. Jeder Akt, dem sich ein Gegenstand entnehmen lässt, bezieht sich auf diesen Gegenstand. Die zu allen Akten gehörigen modalen Unterschiede

Betrachten wir die Gegenstände ausschließlich hinsichtlich der thematischen (logisch- oder doxisch-synthetischen) Formen, der kategorialen Formen, in denen sie sich im thematischen Denken konstituieren, so kommt es auf den besonderen „Ursprung“ der Gegenstände-worüber, der Besonderheit ihres Inhalts nicht an. Wir bewegen uns dann in der Sphäre der Formen des kategorialen Meinens (statt logisch-thematisches Meinen könnte ich auch sagen kategoriales Meinen) und korrelativ der kategorialen Formen der Gemeintheiten.1 Diese Gemeintheiten sind die V er st a nde so bj e kt e, es sind die doxischen Bedeutungen im ontischen Sinn, wenn wir von Wahrheit und Falschheit zunächst absehen. Gehen wir aber auf den „Ursprung“ der Gegenstände-worüber zurück, so bestimmen sich die kategorialen Gegenständlichkeiten je nach den „Regionen“ (Grundklassen von Akten); vor allem je nach Art der „Sinnlichkeit“, auf die sie zuletzt zurückführen. Soweit wir bisher überlegt haben, könnten wir sagen: Es gibt folgende Grundarten des Bewusstseins, die miteinander funktionell verflochten sind: 1) das latent intentionale Bewusstsein, vorthematische Bewusstsein, und das thematische. Dann das nicht logisch Verständige, das vor dem logischen Verstandesfunktionieren Liegende. Zu jeder Grundart solchen Bewusstseins gehört die Doppelheit: Es kann Hintergrundbewusstsein sein und erfassendes, betrachtendes; und jedes bemerkende ist überzuführen in logisch-thematisches (Subjekt, Beschaffenheit etc.). Im Übrigen ist das latente Bewusstsein

1 Dabei ist zu bemerken, dass es sich teils um Formen handelt, die unabhängig sind von den modalen Unterschieden des thematischen Denkens, teils um die modalen Unterschiede selbst, entsprechend der Unterscheidung im Thema zwischen thematischem Inhalt und thematischer Qualität. Dies entspricht aber einigermaßen dem Unterschied der Urteilsformen (Gewissheit) und dem der durch die übrigen modalen Unterschiede hereinkommenden Formen; was sich erklären würde, wenn Gewissheit die einzige aktuelle theoretische Qualität wäre, die nicht fundiert ist.

text nr. 4

5

10

15

20

25

30

63

Bewusstsein unterster Stufe (ästhetisches Bewusstsein) und höherer Stufe (axiologisches Bewusstsein, darauf weiter gebaut praktisches). 2) Das thematische Bewusstsein ist fundiert und zuletzt in dem sinnlichen Bewusstsein. Im Gemütsbewusstsein, das einem sinnlichen oder thematischen Gegenstand zugewendet ist (einem in logische Fassung gebrachten), ist die Gemütsobjektität latent, sie ist noch nicht in die Verstandessphäre, in die thematische, objektivierende getreten; sie muss erst zum objektiven Thema werden. Erst dadurch verwandelt sich der Gemütsakt in einen objektivierenden. Auch das logische, schöpferisch spontane, thematische Bewusstsein kann Vordergrundbewusstsein und Hintergrundbewusstsein sein; der Ausdruck „latent“ für „vorthematisch“ ist wohl nicht passend, es würde ja besser auf das Hintergrundbewusstsein passen. Aber hier ist eine Schwierigkeit: Sollen wir ein Urteilsbewusstsein, in dem wir nicht leben, auf den Sachverhalt nicht achtend, noch Verstandesbewusstsein nennen?1 Wir müssen jedenfalls sagen: Ein richtiges thematisches Bewusstsein, ein richtiges Verstandesbewusstsein ist ein solches, in dem wir leben, dessen Thema eben Thema für uns ist. Ein solches Bewusstsein kann nun in ein Hintergrundbewusstsein übergehen, das ist sicher.2 Ich habe soeben geurteilt, und wenn ich mich einem Neuen zuwende, sinkt das Bewusstsein in das Dunkle des Hintergrundes zurück; aber ich kann mich wieder darauf zurückwenden und dabei konstatieren, dass es „noch lebendig war“. Also es wird sich vielleicht besser machen, wenn ich die s en U n t er s c hi ed v o n V or d e r g run d u nd H i nt er g ru nd a l s e in e n b e s o nd e r e n P u nk t e i n f ü r a l l e M a l h e ra us st e ll e un d in n e rh a l b de r V or de r gr u n ds p hä r e - d i e Sp hä r e von E rl e bni sse n , i n de n e n w i r v o r zu g sw ei s e l e be n - di e and ere n U n t ers ch i e d e m a c h e.

1 Es ist eben unpassend, das logische Bewusstsein ohne weiteres thematisch zu nennen. 2 Es gibt aber noch verschiedene Bedeutungen von Vordergrund: 1) Vordergrund kann dasjenige heißen, worauf wir achten. 2) Vordergrund kann in einem anderen Sinn verstanden werden, in dem wir komplexe Phänomene haben und nun auf einen komplexen Gehalt derselben hinsehen, ihn im Vordergrund haben im vorigen Sinn. Aber die aus ihnen zu entnehmenden Gegenständlichkeiten sind uns in besonderer Weise zur Hand.

64

5

10

15

20

25

zur intentionalität der objektivation

Dann wird man sagen: Was im Vordergrund ist, das ist „m e r klic h“. Auch wenn ich in einem Wunsch lebe, ist das Wunschmoment, das im Gegenstand „erwünscht“ heißt, nicht bemerkt zwar, aber merklich. Im Gefallen lebend ist das Gefallende von rosigem Schimmer übergossen etc.; das ist nicht unmerklich, aber thematisch bin ich damit nicht beschäftigt, ich bin ihm nicht primär zugewendet und objektiviere es nicht.1 Noch ein Wichtiges: Lebe ich im Gefallensakt, Wunschakt und reflektiere ich dann auf das Moment des Gefallens, Wünschens, so erscheint dieses auf das Objekt bezogen,2 und ich sage dann: Zum Wesen solcher auf thematische Objekte bezogenen neuen Akte gehört eine S ubj ek t - O b j e k t- B ez ie hu n g, w e lch e w i r b ei d en s c h l i c h t e n o b jek t i vi ere nd en A k t en ni c ht fi nd en. Die haben noch nicht ein konstituiertes Objekt und dazu einen Aktcharakter, der sich auf dasselbe richtet.3 Man darf das nicht hineintragen, wie man es tut, wenn man das einfache Urteilen „S ist p!“ als Zustimmung zu einem bloßen Vorstellen fasst, als Ja-Sagen zu einem Vorgestellten und Fraglichen. Natürlich können wir auch beim einfachen Urteil eine Beziehung zwischen Akt und Sachverhalt herausstellen: In einem neuen Meinen machen wir den Sachverhalt zum Gegenstandworüber (nominal) und bringen nun den ursprünglichen Akt und den so modifizierten zur Synthese. So sagen wir von jedem Akt, dem sich ein Gegenstand entnehmen lässt, dass sich der Akt auf ihn beziehe. Sagen wir von einem Erlebnis, es sei ein Bewusstsein, ein „Akt“ im weiteren Sinn, so sagt das dasselbe wie: Zum Wesen dieses Erlebnisses gehört die Möglichkeit, aus ihm einen Gegenstand zu entnehmen4 durch ein Hinblicken und thematisches Meinen (wodurch

1 Dann müsste ich aber auch sagen: In der äußeren Wahrnehmung sind die Empfindungsinhalte nicht bemerkt, aber merklich. Und es ist das Fiktum des Bildes merklich nur, aber nicht thematisches Objekt? 2 Und ebenso auf die dem thematischen Meinen entsprechende Sachverhaltsgegenständlichkeit. Thematisches Objekt ist zweideutig: Es kann den Gegenstand-worüber des Sachverhalts und den Sachverhalt selbst bezeichnen. 3 Das ist wohl eine bedenkliche Ausführung: Von allen fundierten, auch den thematischen Akten kann allenfalls dergleichen gesagt werden. Es steht schon ein Objekt da und darauf bezieht sich eine Prädikatsetzung und wieder eine Setzung von Erwünschtsein. 4 Oder das Erlebnis ist selbst ein Entnehmen oder ein Einen-Gegenstand-Setzen.

text nr. 4

5

10

15

20

25

30

35

65

wir den Gegenstand als Gegenstand im eigentlichen Sinn bewusst haben). Und jedes unselbständige Erlebnismoment, dem in seinem Zusammenhang der Fundierung wesensmäßig ein Gegenstandsmoment als Gemeintheit zu entnehmen ist, heißt ein Aktmoment, ein Aktcharakter, Bewusstseinscharakter. Dasselbe sagt, jeder Akt, jedes Bewusstsein hat einen „Sinn“. Den „Sinn“ eines „Bewusstseinsaktes“ auseinanderlegen, das besagt zunächst, die in ihm – wenn er nicht schon thematisch ist – sozusagen lat en t e ge gen st än d li c he B e zi eh u ng ans Tageslicht zu ziehen dadurch, dass der Akt in einem Einheitsbewusstsein übergeführt wird in einen thematischen Akt, der ihm die Gegenständlichkeit entnimmt. Ist der Akt ein thematischer, so machen wir – wenn er ein synthetischer ist – den ganzen Sachverhalt zum Gegenstand-worüber und beziehen ihn auf den Akt selbst als das in ihm „Gemeinte“. Die logische, doxische Funktion ist überall die eigentlich objektivierende, und eigentlichere, nämlich entfaltete Intentionalität haben wir nur in den Fällen, wo eine gemeinte Gegenständlichkeit schon konstituiert, eben thematischer Gegenstand-worüber ist, und wieder in der Weise der auf intendierte Gegenstände bezogenen Akte höherer Stufe. Zu den logischen Akten gehören die logischen Formen, die Formen der Bildung von logischen Akten zu logischen Akten. Und korrelativ die Bildung von kategorialen Gegenständlichkeiten, aber dabei ist von den modalen Unterschieden abstrahiert. Was besagt das also? In ganz anderer Richtung, als in der die Formen gefunden werden, liegen die m od a l e n Un t e r s c h i e de. Ein Gegenstand oder Sachverhalt (besser doch ein thematischer Gegenstand als solcher) steht da in der Weise der Gewissheit (Wahrhaftigsein, Wahrheit), in der Weise der Möglichkeit, in der Weise der Wahrscheinlichkeit, auch in der Weise der Nichtigkeit, der Fraglichkeit, Zweifelhaftigkeit. Soll man sagen, dass diese Unterschiede wesentlich zu den thematischen Akten gehören, also nur zu den „Gegenständen“ im eigentlichen Sinn? Und was sind diese „Gegenstände“ ohne diese modalen Charaktere? Das sind offenbar auch keine Charaktere der Gegenstände im eigentlichen Sinn, keine Merkmale derselben. Man wird auch sagen: Wenn ich im Stereoskop eine weit verbreitete Landschaft sehe und dabei ausschließlich einen Gegenstand betrachte und thematisch als Objekt behandle, so gehört der Charakter der Fiktion doch auch zum Hinter-

66

zur intentionalität der objektivation

grundwahrnehmen bzw. zu dem nebenbei Bemerkten und jedenfalls nicht thematisch Behandelten. Und ebenso bei Zweifel, Vermutung. Ferner, auch bei den fundierten axiologischen Akten treten diese Charaktere auf, und sie treten auf, auch wenn ich nicht objektiviere. 5 Ich empfinde Gefallensneigung oder einen Wunschzweifel usw. Freilich, ob sich die Charaktere nicht im Licht des Verstandes reicher ausgestalten, das ist eine andere Frage. Wir haben hier also eine Reihe von Modi, die zu allen Akten gehören, und in gewisser Weise alle „Gegenständlichkeit“ betreffen: Ge10 wisssein – oft Urteilen schlechthin (im engeren Sinn) genannt – oder Für-wahr-Halten, Für-möglich-Halten, Für-wahrscheinlich-Halten, Für-fraglich-Halten, Für-falsch-Halten und endlich auch das Sichbloß-Denken, eventuell die Entscheidung ausschalten, einklammern, was mit gehört zu dem „dahingestellt sein lassen“. Und bei all dem 15 kann es „derselbe Sachverhalt“ sein, der einmal für wahr oder für falsch, das andere Mal für vermutlich und wahrscheinlich gehalten ist etc.

Beilage IV Psychische Akte gegenüber psychischen Zuständen. Meinen und Objektivieren. Der Satz von der Vorstellungsgrundlage und die Frage nach einem einheitlichen Vorstellungsbegriff1

20

Man pflegt zu unterscheiden zwischen psychischen Z us tä nd e n und psychischen A kt e n. Das kann vortrefflich so interpretiert werden: Psychische 25 Akte sind die im s pe z if is ch e n Sinn „intentionalen“ (intendierenden) Erlebnisse, es sind entweder objektivierende Akte (objektivierende „M ein un ge n“) oder andere Akte, denen objektivierende zugrunde liegen. Diese müssen aber selbst „meinend“ sein, und das können sie nur sein, wenn ihnen Meinungen zugrunde liegen. Was sagt das? Es sagt, dass sich etwa 30 ein Vermuten regen kann, ohne dass ich im Vermuten lebe, das Vermutete meine. Oder noch besser: Ich kann eine Tatsache „konstatieren“, und das ist ein meinendes Erlebnis, ein intentionales (intendierendes), ein Akt. Es regt sich etwa die Freude darüber, aber ich lebe nicht in der Freude; die

1

Wohl Frühjahr 1911. – Anm. d. Hrsg.

beilage iv

5

10

15

20

25

30

35

40

67

Tatsache in ihrer Erfreulichkeit fällt nicht in den Rahmen des meinenden Bewusstseins. Es mag sich auch ein Wille regen, aber es fällt nicht der Entschluss, das Gewollte als solches, in den Rahmen des Meinens; ich habe keine Willensmeinung. Nun kann aber ein fundierter Akt meinend nur sein, wenn seine Unterlagen es sind. B lo ße Z u s tä n de w ä r e n B e wus st s e in s erl eb n i ss e , d ie ni c h t m e in e nd s in d . J ed e s m e in en d e E rl eb n i s k an n s ic h z u ein em blo ß en Z us t a n d m o d if izi e r e n, je d e r Be w us st s eins zu s ta n d k a n n A k t w e rd e n. Meinen ist hierbei nicht Objektivieren. – Warum denn nicht? Zwar kann man sagen: Wenn ich diesen Zug der Wolken im Sturm beleuchtet von der untergehenden Sonne sehe und die Pracht des Schauspiels fühle, so bin ich mir der Prächtigkeit bewusst. In gewisser Weise ist wie der Wolkenzug so die Pracht „wahrgenommen“. Und doch nicht „objektiviert“? Ich müsste dann auch hinsichtlich der Wahrnehmung sagen, das „bloße“ Wahrnehmen, das Einheitsbewusstsein, in dem der Wolkenzug im Wechsel kontinuierlicher Erscheinungen bewusst ist, ist noch kein Objektivieren, vielmehr erst das Verstandesbewusstsein, das „Als-dieses-Ding-, als-Wolkenzug-etc.Setzen“. Und so objektiviere ich das Gefühlsbewusste auch erst, wenn ich „urteilsmäßig“ setze: „Dieser Wolkenzug ist prächtig“ oder „dieser prächtige Wolkenzug“ etc. Dann ist aber zu sagen, der Satz „Jedes intentionale Erlebnis ist entweder Vorstellung oder hat Vorstellung zur Grundlage“ meint unter Vorstellung nicht eine begrifflich-nominale Vorstellung oder ein Urteil. Ich kann ja rein wahrnehmend und im Wahrnehmen Wohlgefallen fühlend einen einheitlichen Akt vollziehen (setzen). Überhaupt, kann der Satz einen ganz einheitlichen Sinn gewinnen, wenn wir jederlei Bewusstsein und auch jederlei intentionales Bewusstsein zusammennehmen? Genauer, kann man da einen einheitlichen Vorstellungsbegriff als Begriff einer zusammengehörigen Klasse von Bewusstseinsarten gewinnen? Wie es scheint, nicht. Einmal haben wir eine schlichte Anschauung als Grundlage, das andere Mal (wenn wir die Gesamtmaterie, den gesamten thematischen Inhalt festlegen) ein Urteil. Und wenn wir von der Unterscheidung zwischen fundierenden und fundierten Akten ausgehen und die Identität der Materie nicht festhalten, so gewinnen wir bei den letztfundierenden auch keine Einheit. Wir kommen dann einmal auf anschauliche, schlichte sinnliche Akte (Wahrnehmungen und dgl.), das andere Mal auf schlichte leere Akte, ein drittes Mal auf nominale unsinnliche Vorstellungen wie „4“ usw. Erst wenn wir auf die „Ursprünge“ zurückgehen, auf die g eb e n d en oder q ua s i - g eb e n de n Ak t e, auf die „eigentlichen“ explizierten Akte oder auf die Akte, welche in expliziter Weise eben dasselbe vorstellen, urteilen etc.,

68

zur intentionalität der objektivation

was die anderen in bloß impliziter und verworrener Weise tun, kommen wir auf letzte anschauende Akte, und das sind die sinnlichen Akte, und zwar die empirisch-sinnlichen (physisch-sinnlichen). Versteht man aber unter objektivierenden Akten die wirklich objektivierenden, die Verstandesakte 5 (die synthetisch erkennenden und begreifenden), so ist natürlich keine Rede davon, dass jeder meinende Akt (jedes intentionale Erlebnis) notwendig einen objektivierenden Akt zur Grundlage haben muss.

Beilage V Lebendigkeit und ihre Grade beim Wünschen und beim Urteilen. Lebendigkeit besagt nicht Evidenz und setzt sie nicht voraus1

10

15

20

25

30

L e be n di gk e it (wohl nicht dasselbe wie Eigentlichkeit) und ihre Grade. Beim Urteil die lebendige Überzeugung und ihre Grade. Ich hege einen Wunsch: Möge Gott mir beistehen. Möge der Himmel mir den Abschluss der großen Unternehmung gestatten. Diesen „selben“ Wunsch kann ich lebendiger und weniger lebendig hegen. Im lebendigen Hegen des Wunsches, in dem Mehr-oder-minder-vom-Wunsch-Erfülltsein-unddarin-Leben ist der Sachverhalt Thema des Wunsches, das Sp ist „lebendig charakterisiert“ als wünschlich. Es kann aber die Lebendigkeit eine sehr geringe sein. Und man kann auch geradezu von einem Gegenpol der „Unlebendigkeit“ sprechen. Ich sage vielleicht noch den Wunschsatz aus „S möge p sein“, aber bei dem „möge“ „fühle ich nichts“. Es ist leer. Jemand spricht diesen Satz aus, ich stimme ihm bei, aber ich bin momentan von ganz anderen Sachen im Gemüt erfüllt. Trotzdem spreche ich nicht unwahrhaftig, wenn ich zustimme.2 Wenn ich mich in die Sachlage wieder vertiefe, würde sich der aktuelle Wunsch wieder einstellen und meine leere Wunschsetzung „erfüllen“. Es ist aber zu bemerken, dass ich nicht etwa die Sachlage mir ganz klar machen muss, um lebendig zu wünschen; es handelt sich also nicht um diejenige phänomenologische Sachlage, die gegeben sein muss, damit eine Evidenz des Erwünschtseins der betreffenden Sachen statthätte. Ich kann lebendig wünschen, dass die tyrannische Verfassung wiederhergestellt würde, ohne dass diese Sachlichkeit im Geringsten klar wäre.

1

Osterferien, März 1911. Und ich wünsche – ich spreche nicht bloß ein leeres Wissen davon aus, dass ich das wünsche. 2

beilage v

5

10

15

20

25

30

35

69

Wie ist es beim Prädizieren? Ich kann einen Satz aussagen und dabei wirklich urteilen; aber doch ist das Urteil in gewisser Weise unwirklich, nämlich u n leb e n di g. I ch ha b e k e i n e „ l e be n d ige “ Ü b er z eu gu n g. D a s U r te il k an n m i t grö ß er e r o d er ge r ing ere r L eb en d i gk eit d er Ü b er z eu g un g v o llz og e n sei n.1 Diese Lebendigkeit besagt nicht Evidenz, und Grade der Lebendigkeit besagt hier nicht und noch weniger Grade der Wahrscheinlichkeit. Ein reproduzierter Satz, der im Denken benutzt wird, drückt ein „Urteil“ aus, aber im Allgemeinen ein „unlebendiges“. (Man würde es passend auch uneigentliches nennen.) Machen wir uns den Sinn des Satzes deutlich, aber darum noch nicht klar und gar evident, so wird nun vielleicht das Urteil lebendig werden, und die Lebendigkeit nimmt wohl insbesonders zu, wenn die oder jene Urteilsmotive ins Bewusstsein treten, ohne darum in ihrer Klarheit und Beweiskraft gegenwärtig zu sein. Aber mehr kommt es wohl an auf die deutliche Explikation des Sinnes und die Eigentlichkeit, mit der die Urteilsmeinung den Gliederungen des Sinnes gemäß vollzogen ist, gegenüber dem vagen, verflossenen Urteilen, wo die Einheit des Sinnes eine vage Art der Bewusstheit hat und damit auch das Urteil keine wahre Gliederung, eben keine Deutlichkeit, und dies gibt auch dem allgemeinen belief-Charakter einen anderen Habitus. Natürlich handelt es sich also auch nicht um begleitende Gefühlscharaktere, nicht darum, ob für mich dieser Glaube Herzenssache ist oder nicht und dgl. Soll man nicht sagen, es handle sich um den Unterschied der Deutlichkeit und Verworrenheit? Es wäre aber dabei zu sagen, dass nicht etwa dasselbe Urteil (phänomenologisch identisch genommen) im Übergang zur Deutlichkeit sich nur entfalte, seine immanenten Teile zeige, so wie wir, wenn wir einem von fern undeutlich gesehenen Gegenstand näher treten, bei Identität des Gegenstandes der Teile besser sichtlich werden. Dasselbe Urteil ist dasselbe, sofern in der Einheit der Identifizierung eine Deckung nach dem Gemeinten eintritt (und sofern gemeinsames „intentionales Wesen“ besteht), aber die Phänomene sind verschieden. Hier könnte man sagen: Korrelativ, was das Geurteilte, den Seinsverhalt anbelangt, tritt uns derselbe Seinsverhalt oder Sachverhalt gewissermaßen näher, er wird deutlicher und andererseits verworrener. Also n ich t d as U r te i le n s e lbs t, sondern d as G e u rt ei lt e hat die Unterschiede der Deutlichkeit und Undeutlichkeit, mit der es zum Urteilsbewusstsein kommt.

1 Etwas anderes ist die Lebhaftigkeit, die Intensität der „Überzeugung“ als mehr oder minder hitzige Gefühlsparteinahme, das Sich-dafür-Einsetzen, Entschiedendafür-Stellungnehmen, eventuell Sich-dafür-Ereifern etc., wobei eventuell Folgeerscheinungen mitgenommen sein mögen.

70

zur intentionalität der objektivation

Hängt nicht die „Lebendigkeit“ auch an der Wahl gewisser Ausdrucksformen? So bei Wünschen in den spezifischen Wunschsätzen: „Möge S p sein“, ebenso bei Vermutungen und Fragen: „Ist S p?“, „S dürfte wohl P sein“. Wählen wir die prädikativen Formen, so ist das nicht mehr der Fall: 5 „Dass S p ist, ist erwünscht, ist fraglich, ist zweifelhaft, ist wahrscheinlich“. Doch macht das nicht allein den Unterschied zwischen prädikativer Form und nicht-prädikativer aus.

Beilage VI Notiz über Stellungnahme und ihr Moment der Aktivität einerseits und über Momente der Passivität und Aktivität in der Wahrnehmung andererseits1

10

Wenn wir den Ausdruck „Stellungnahme“ verwenden, so drückt sich damit ein phänomenologisches Moment der A kt i v itä t aus. Dies liegt nicht ausgedrückt oder nicht in prägnantem Maß ausgedrückt in dem Wort „W ah r 15 n e hm u n g“. Im letzteren Fall, möchte man sagen, liegt zweierlei vor (als angedeutet durch den Ausdruck): eine Passivität und eine Aktivität. Es wird uns durch „die Sinnlichkeit“ etwas als gegeben entgegengebracht, es ist nun für das Bewusstsein da, wir mögen dazu Stellung nehmen oder nicht. Andererseits 20 liegt in dem Nehmen dieses Gegebenen schon eine niederste Stufe der Aktivität. Wir sprechen ja auch vom B e t r a c h t e n, dann vom aufmerksamen Betrachten, von dem Betrachten mit Interesse. Da sind Aktivitäten.

1

Wohl 1911. – Anm. der Hrsg.

Nr. 5 D er t hem ati sch e I n ha lt u nd s ei ne C h ar ak t er e1

5

10

15

20

25

30

§ 1. Das thematische Bewusstsein mit seinen verschiedenen Qualitäten. Der thematische Blick als Bewusstsein vom Thema und als Bezogensein auf den Gegenstand. Die Objektivierung des Charakters als Prädikat eines thematischen Inhalts Gehen wir nun zu den „modalen“ Unterschieden (oder besser den qualitativen des thematischen Meinens) über und zu dem Verhältnis der modalen Unterschiede zur Materie dieser Akte. I. Wir urteilen (und sagen aus), wir sind dessen gewiss, dass S p ist. Wir vermuten, halten es für möglich, dass S p ist. Wir fragen, zweifeln, ob S p ist (wir „schweben“ in Ungewissheit). Wir lehnen es ab, wir sind dessen bewusst in einem Nichtigkeitsbewusstsein. II. Endlich: Wir können es uns bloß denken, dass S p ist, ohne dass irgendwelche Anmutung, Vermutung etc. im Spiel wäre. Wir können aber auch Gewissheit, Zweifel etc. „ausschalten“; wir können – selbst wo wir gewiss sind, dass S p ist – es dahingestellt sein lassen. Wir setzen nun gegenüber: All die genannten Akte bis auf das bloße Denken (bzw. Dahingestelltseinlassen, in welchem auch ein bloßes „Sich-Denken“ mitvorliegt) und andererseits eben das letztere. Wir nennen die ersteren Akte im weitesten Sinn s te l lu n gne hme n d e A k te t h e ma t i s c h e r Ga t tu n g oder t he m a t is ch e St el l un g n ahm e n und die letzteren Akte stellungsfreie Akte (stellungsfreies Bewusstsein). Der Unterschied reicht über die Sphäre der thematischen Akte hinaus, und nun können wir sagen: Beschränken wir uns zunächst auf die stellungnehmenden Akte, und zwar auf synthetische, so kann es sein, dass wir zunächst diese Akte, im thematischen Meinen lebend, vollziehen, wobei der t h e ma t i s c he B l i c k a u f da s „ T he m a “ g er i ch t e t is t. Wir leben im Gewisssein, und unser Blick

1 Osterferien 1911 (ausgebessert mit Bleistift Anfang Oktober mit Anmerkungen aus der Zeit nach 1913).

72

5

10

15

20

25

30

zur intentionalität der objektivation

ruht auf „S ist p“, schrittweise, wie es sich dabei aufbaut, oder auf „S ist p und dasselbe ist auch q“, oder „S, welches p ist, ist auch q und dasselbe S p, welches q ist, ist einerlei mit M, welches n ist“ usw. Was heißt das: Der „thematische Blick ist gerichtet“ auf diesen „Inhalt“? Der Blick ist der Blick, der eben zum Wesen des thematischen Meinens gehört, und ist der Blick des „Aufmerkens-auf“ (in dem einen Sinn). Wohl gemerkt, es ist d iese s G er ic ht e ts e in d es t he m at i sc h en Bl i ck s n ic ht ei n Wah rn eh m e n i m ge w öh nl ic he n S in n, das ist ein Zum-Gegenstand-worüber-Machen, zu einem identisch Einheitlichen, das Subjekt thematischer Meinung ist.1 Z u m t h e ma t i s c hen G emei nt e n g eh ö rt e s, da ss es i m m e r ei n S ubj ek t wo rü ber „ hat “, und eventuell wie in den Beispielen geht das thematische Meinen (der Blick) darauf, dass ein so und so Gemeintes dasselbe ist wie ein anderes Gemeintes, aber der thematische Blick, das thematische Gerichtetsein geht eben auf das so Gemeinte und auf „dasselbe“, kurzum darauf, dass dieses S p dasselbe ist wie das M n und dgl. Und dieser thematische Inhalt ist in der Weise der Gewissheit thematisch bewusst. In der Vermutung kann genau derselbe „thematische Inhalt“, der in ihr genau ebenso Inhalt ist, genauso im thematischen Blick bewusst, in der Weise des Vermutens bewusst sein. Wieder sind wir ebenso thematisch auf dasselbe, auf denselben Inhalt gerichtet in der „entsprechenden“ Frage, im entsprechenden Zweifel,2 während die „Weise“ des Gerichtetseins, die Weise des Bewussthabens die des Fragens, des Zweifelns ist. Die Weise des Bewussthabens affiziert in gewisser Art den thematischen Inhalt. Er ist in verschiedener Weise charakterisiert, und diese verschiedene Charakterisierung fällt nicht selbst in den thematischen Blick, sie gehört nicht selbst zum Thema. Das thematische Bewusstsein mit seinen verschiedenen Modi, seinen verschiedenen „Qualitäten“ hat etwas zum Thema, aber Qualität ist nicht selbst Thema der Qualität.3

1 2 3

Blick = Hinwendung-auf = Erfassung, Setzung etc. Aber die Qualität des Themas ist eine andere. Paradox: korrelative Qualität.

text nr. 5

5

10

15

20

25

30

35

73

Jede Qualität lässt sich in den thematischen Inhalt hineinziehen! Und zwar in einem neuen thematischen Bewusstsein, näher einem Gewissheitsbewusstsein. Das geschieht in der Weise, dass der gesamte thematische Inhalt des zu modifizierenden Aktes zu einem nominalen Objekt, einem Gegenstand-worüber gemacht wird (wobei der ursprüngliche thematische Inhalt verwandelt wird in eine „Eigenbedeutung“ von ihm selbst, also in ein nominales Eigenthema).1 Was ist nun das Prädikat des zu bildenden „kategorischen Urteils“? Nun, ein entnehmendes Objektivieren erfasst in der Weise, wie eben das Thema „charakterisiert“ ist, das Prädikat „gewiss“. Dass S p ist, das ist gewiss. Doch ist die Redeweise nicht bedenklich? Das Subjekt, der Gegenstand-worüber, ist nicht das Subjektthema. Im Thema (ebenso thematischer Inhalt) „S p ist dasselbe wie M n“ treten Themata auf. S p ist eins, M n ist ein anderes und verknüpft sind sie durch die thematische Form „dasselbe“. Andererseits sagen wir in gutem Sinne: Der Subjektgegenstand ist derselbe wie der Objektgegenstand, und dass er derselbe sei, das ist gerade die „Meinung“ des Urteils, das ist es ja, dessen wir gewiss sind, das ist der thematische Inhalt der Gewissheit. Und wie wir zwischen Subjekt und Subjektthema, Gegenstand des nominalen Themas und nominalem Thema selbst scheiden, so unterscheiden wir auch zwischen Prädikatthema und Prädikat selbst. Und so überall für alle Glieder des Themas, und schließlich für das ganze Thema selbst. Wir unterscheiden es von seinem „Gegenständlichen“, das das thematisch Gemeinte ist im ontologischen Sinn. Die Rede von der Richtung des Bewusstseins, von der Richtung des „Urteilens auf“, oder davon, dass Bewusstsein „Bewusstsein von“ ist, ist zweideutig. Wir müssen unterscheiden den t he m a t i s che n Bl ic k a l s B e wu s sts e i n v o m T he ma, das in der Tat ein im Bewusstsein selbst vorzufindendes Gerichtetsein ist, und das B e zo ge ns e i n a uf de n Ge g e n st a n d – d i e t he m a t i s c h e B ew us s t s e i ns b e z i e hun g un d d ie g eg e n s tä n d li c h e. Wenn nun im Urteilsbewusstsein das „S ist p“ bewusst ist in Gewissheitsweise, und wir sagten, das „S ist p“ stehe im Charakter der Gewissheit (oder Wahrheit) da, so ist zu sagen: Im Urteilsbewusst-

1

S ist p! Dass S p ist, ist wahr!

74

5

10

15

20

25

30

35

zur intentionalität der objektivation

sein, wo der Blick auf das Thema gerichtet ist, ist der thematische Inhalt in gewisser Weise charakterisiert: „S ist p!“, „Dieses Papier ist weiß!“ Wir können sagen, das ist der Charakter der Gewissheit, der am thematischen Inhalt haftet, ohne dass er aber zum thematischen Inhalt gehört. Machen wir aber aus dem thematischen Inhalt ein nominales Thema, so wird (nicht der Sachverhalt „S ist p“, aber) der thematische Inhalt zum Objekt, das Thema erhält nun das Prädikat der Gewissheit. Also wäre es doch ganz unbedenklich und korrekt. Woher kam mein Bedenken? Nun, man darf nicht verwechseln das Bewusstsein der Gewissheit und die Gewissheit selbst, die da als Prädikat fungiert. Man könnte nämlich denken: Das Urteilsbewusstsein ist eben das Phänomen „S ist p!“, und scheide ich dabei das Thema und die Qualität, so scheide ich phänomenologisch. Also wenn ich das Urteilsbewusstsein vollziehe und dann reflektiv urteile „Dass S p ist, ist gewiss“, so sage ich damit aus, dass der thematische Inhalt den Charakter der Gewissheit hat, und das hat er natürlich, er steht eben so da. Aber das Urteil „Dass S p ist, ist gewiss“ hat den Wert von „Dass S p ist, ist wahr“, und dieses Urteil kann falsch sein, trotzdem es mir im Urteil „S ist p!“ so „erschien“. Also phänomenologisch entspricht dem phänomenologischen Moment „thematischer Inhalt“ der thematische Inhalt selbst, und dem phänomenologischen Moment „Gewissheit“ die Gewissheit selbst. Und ob dem Thema wahrheitsgemäß Gewissheit zukommt, das ist nicht gesagt dadurch, dass gesagt wurde, es sei im Urteil das Thema als gewiss charakterisiert (immer Thema = thematischer Inhalt). Und das überträgt sich auf alle anderen Fälle. Also in dieser Weise ist jedes thematische Bewusstsein thematisch gerichtet, und das Thema hat einen „Charakter“, und jedes lässt sich überführen in ein Gewissheitsbewusstsein, in welchem das Thema (der thematische Inhalt) zum Gegenstand-worüber geworden ist in einem nominalen Eigenthema und in welchem der Charakter objektiviert, d. i. durch ein entsprechendes Prädikatthema, einen eigentümlichen Qualitätsbegriff, vertreten ist. E s e r wa c hs e n s o d i e m o da l en Be g ri f f e a ls K or r e l a t e d e r Ur t e i l s qu a l i t ä t e n und als Prädikate von thematischen Inhalten. Als Prädikate treten sie dann (durch die modalen Prädikatbegriffe) selbst in thematische Inhalte ein („zweifelhaft“, „fraglich“, „möglich“, „wahrscheinlich“). Selbstverständlich können aber d i e se thematischen Inhalte – wie

text nr. 5

5

10

15

20

25

30

75

alle – nicht nur solche von Gewissheiten, sondern auch solche von Vermutungen, Zweifeln etc. werden. Nun wären freilich noch die Wesensbeziehungen zwischen dem unmodifizierten und dem modifizierten, nämlich in Prädikation über Gewissheit verwandelten Urteil und so überall zwischen modifizierter und unmodifizierter Vermutung etc. zu erörtern: die „Deckungsbeziehungen“, die Vernunftbeziehungen (noetisch: Es ist evident, dass die betreffenden Paare unmittelbar „gleichwertig“ sind) usw. Es wäre dann noch zu erwägen d as blo ße Si c h- De nke n, der stellungsfreie Akt. Hier können wir auch die Modifikation zu machen versuchen: „S ist p“, dass S p ist, ist gedacht, ist ein „bloßer Gedanke“. Aber näher besehen ist das kein objektives Prädikat von der Sorte der modalen, wie dann das „Sich-Denken“ nicht Qualität ist in dem Sinn wie Gewisssein etc. Man kann wohl sagen, es ist ein bloßes Bewusstsein von einer qualitätslosen, modal unqualifizierten Materie, d. h. ein Bewusstsein vom bloß thematischen Inhalt, nicht ein solches, wo das Thema Objekt ist, sondern ein thematisches Bewusstsein mit der thematischen „Richtung“ auf das qualitätslose, modal uncharakterisierte Thema. Nun möchte man aber fragen: Wie verhält sich dieses Bewusstsein als „Bewusstsein“ zu dem Gewissheitsbewusstsein, Wahrscheinlichkeitsbewusstsein usw.? Das Gedankenbewusstsein heißt doch wohl nicht Gedankenbewusstsein in demselben Sinn, wie das Wahrheitsbewusstsein Wahrheitsbewusstsein, das Wahrscheinlichkeitsbewusstsein Wahrscheinlichkeitsbewusstsein heißt? Nämlich phänomenologisch ist die Sachlage prinzipiell eine ganz andere. Im stellungnehmenden Bewusstsein haben wir Richtung (thematische Richtung) auf das Thema, und das Thema ist mit einem Charakter begabt. Dagegen im bloßen Sich-Denken haben wir eine thematische Richtung, aber das Thema hat keinen „Charakter“.1 Kann man aber sagen, dass im stellungnehmenden Bewusstsein ein Komplex vorliege aus dem bloßen Sich-Denken und dem Moment der Stellungnahme?2 Das wird nun von neuem überlegt werden müssen.3 1 Aber doch einen Quasi-Charakter, ich denke mir „S ist p“, „S ist vermutlich p“, „Ist S p?“. 2 Natürlich nicht. 3 In den vorstehenden Blättern hatte ich ursprünglich den Begriff des Themas gefasst im Sinn der bloßen Materie (ohne Qualifizierung) und dann durchgehend

76

zur intentionalität der objektivation § 2. Das thematische Bewusstsein als unselbständige Schicht. Stellungnahme und Thema bei den synthetischen Akten und beim Gemütsbewusstsein

5

10

15

20

25

Sind wir in der Einsicht in die Struktur des Bewusstseins soweit gekommen und haben wir erkannt, dass jedes „thematisch“ stellungnehmende Bewusstsein eine Schicht des thematischen Inhalts hat und eine Schicht des Charakters, so hängt es jetzt von der Interpretation des bloßen Sich-Denkens ab als eventuelles Bestandstück in allem „thematischen Bewusstsein“, ob wir den Begriff und Terminus „thematisches Bewusstsein“ festhalten können.1 Denn müssen wir nun nicht sagen, dass jedes meinende Bewusstsein im Sinn der δξα ein Thema hat, eben vermöge der thematischen Bewusstseinsschicht, die dem Inhalt entspricht, die das eigentlich so zu nennende thematische Bewusstsein wäre, und dass darüber hinaus eben der „Urteilsakt“, die δξα, charakterisiert ist durch die eigentliche „Aktschicht“,2 durch die doxische? Wir hätten dann zu sagen: Das Thema gibt insofern die „Richtung auf den Gegenstand“, als Richtung auf den Gegenstand eben Richtung auf das Thema (in einem anderen Sinn von Richtung) voraussetzt. Es bleibt dabei, dass die eigentlich objektivierenden Akte die „meinenden“, nämlich die doxischen sind: Das bloß thematische Bewusstsein wäre kein Akt im prägnanten Sinn – schon darum nicht, weil es eine unselbständige Schicht ist – und zudem, das wären bloß die „Stellungnahmen“. Doch wäre der Name Akt am besten hier zu vermeiden, wobei freilich ein passender Terminus fehlt. (Vernunft-

ausgebessert, nämlich Thema gefasst als das Ganze von Inhalt und Qualität (also korrelativ zum intentionalen Wesen der Logischen Untersuchungen) und, wo früher „Thema“ stand, geschrieben „thematischer Inhalt“. Es ist aber zu überlegen, ob es nicht einen sehr guten Sinn hat, die bloße Materie als Thema zu bezeichnen (so dass ein Urteil „S ist p“ und die entsprechende Vermutung und Frage dasselbe Thema hätten). Doxischer Charakter = Aktcharakter der Objektivation, theoretische Qualität, und zwar als wirkliche Stellungnahme verstanden. 1 Hier (bis 18 = S. 80,5–81,28) heißt Thema immer so viel wie u n q u alifi zierte Materie (aber nicht phänomenologisch, als Korrelat der Materie der Logischen Untersuchungen). 2 Das Wort „Schicht“ ist leicht irreführend, da es sich um Unselbständigkeiten handelt.

text nr. 5

5

10

15

20

25

77

akt sagt zu viel. Vielleicht doch „Intention“.) Akt wäre also etwas Unselbständiges.1 Der Akt der δξα hat sein Thema und setzt das „bloße“ thematische Bewusstsein voraus, das ihm Richtung auf das Thema gibt.2 Nun gibt es einfache Akte und zusammengesetzte, einschichtige und fundierte. Die Frage ist, wie sich „Akt“ und Thema bei den fundierten Akten verhalten. Sollen wir sagen, dass Akte überhaupt Stellungnahmen zu Themen (in denen sich qualitative Themen, Urteile etc. konstituieren) sind, dass aber die Richtung auf das Thema bzw. die Stellungnahme zu ihm bald eine unmittelbare, bald eine mittelbare sein kann?3 Zunächst machen auch die z u sam men ge set z ten Akt e ihre Schwierigkeiten und die Art wie D en k ak te (doxische) in Denkakten bzw. in „bloßen Vorstellungen“4 fundiert sein können. Wenn ich vermute, dass der Kaiser nach Rom reisen wird, so enthält doch das „Thema“-Bewusstsein der Vermutung bereits doxische Stellungnahmen, und dasselbe Thema kann Thema einer Gewissheit, einer Frage etc. sein. Wenn die thematische Reflexion das Thema zum Gegenstand macht, so gehört zum Thema da und dort ein „Setzungscharakter“, der nur nicht prädikativ und begrifflich gefasst ist. Nur das Thema, die Materie, der untersten, nicht fundierten Akte ist charakterlos. Sowie sich ein höherer Akt, ein fundierter erbaut, tritt in sein Thema der Charakter ein, der dem Thema der untersten Stufe durch den Akt unterster Stufe erteilt ist. So haben die Themen der synthetischen Denkakte positionale (doxische) Charaktere in sich.5 Dabei sind die Themen selbst in verschiedener Stufe gebaut, eben mit Rücksicht darauf, dass sie Charaktere enthalten, die ihrerseits einen thematischen Kern haben, der seinerseits wieder im Thema positionale Charaktere und thematische Inhalte derselben

1

Ebenso aber das Bewusstsein vom „Inhalt“ des Aktes. Aber dieses bloß thematische Bewusstsein ist eine unselbständige, abstrakte Schicht. 3 Die Richtung des Aktes? Im Akt ist bewusst das Qualifizierte, das Korrelat der Stellungnahme gehört mit zu dem, worauf der „Blick“ des Aktes geht. 4 Das ist keine Fundierung durch Akte. 5 Nicht Rücksicht genommen ist da auf die Fundierung durch Gedanken, durch Quasi-Akte, wo sich im Quasi dasselbe wiederholt. All das bedarf aber gründlicher Erörterung. Es ist fundamental. 2

78

5

10

15

20

25

30

zur intentionalität der objektivation

enthält usw. Das ist ja in der Sphäre der Urteilsakte die Lehre von der verschiedenstufigen Gliederung der apophantischen Bedeutungen. Ich habe so viele Jahre geglaubt, dass das bloße Sich-Denken, das bloße „Vorstellen“ eine Parallele sei des Urteilens (als Gewissseins), derart, dass beide eine gemeinsame, aber abstrakte Schicht haben des Themas („Materie“) und beiderseits eine verschiedene „Qualität“.1 Aber da ergibt sich eben die Unzuträglichkeit, dass die Vorstellungsqualität das Thema nicht qualifiziert und nicht für Gegenständlichkeit konstitutiv ist, dass das Vorstellungsbewusstsein kein Vernunftbewusstsein ist usw. Ich habe ferner auch geglaubt, dass jedes Gemütsbewusstsein notwendig in einem „objektivierenden“ Bewusstsein fundiert ist; nämlich in Konsequenz davon, dass jedes Gemütsbewusstsein ein Thema „hat“, also eine thematische Bewusstseinsschicht impliziert. Würden wir uns dafür entscheiden, dass eine bloße thematische Schicht keine „Vorstellungsqualität“ haben muss, keinerlei doxische Qualität oder Quasi-Qualität, um als Unterschicht eines Gemütsbewussteins zu fungieren, so wären auch Gemütsakte direkt auf ein Thema bezogen. So das Gefallen an einem bloß Phantasierten oder Abgebildeten, einem Schönheitswerten, das sich um Sein oder Nichtsein nicht kümmert. Und das wird wieder richtig sein. Was die versuchte Theorie hier besonders schwierig macht und höchst bedenklich – nämlich die obige Theorie, welche wieder zu B r e nt a no zurückmündend jedem Akt ein bloßes Sich-Denken zugrunde legen möchte –, ist, dass wir doch in der bloßen Phantasie mannigfaltiges bloß Phantasiemäßiges zur Einheit bringen. Der Zentaur in verschiedenen Erscheinungen steht als Einheit da und synthetisch als identisches Subjekt der und jener Prädikate, in diesen Prädikaten bezogen auf ein anderes Phantasieobjekt usw. Da haben wir Gegenbilder von allen synthetischen Charakteren und Formen, auch von den Charakteren. Nun ist Phantasie und Sich-Denken nicht dasselbe, aber was wir sagten, gilt doch ebenso vom Sich-bloß-Denken. Bilden sich da bloße

1

Dem ist nun Rechnung zu tragen dadurch, dass zu jeder stellungnehmenden Qualität als „wirkliche“ Qualität gegenübergestellt wird eine Quasi-Qualität, jedem echten „Akt“-bewusstsein ein Quasi-Bewusstsein. Und dann ist alles in Ordnung.

text nr. 5

5

10

15

20

25

79

Materien? Aber wenn das bloß „Vorgestellte“ zur Materie einer Gewissheit werden sollte, so könnte nicht einfach eine Gewissheit sich auf diese „Materie“ beziehen, sondern jeder Schritt dabei müsste in bestimmter Weise, in der Art wie Gewissheit es erfordert, modifiziert werden. Der Zentaur müsste als gewisses Sein, wahrhaftes Sein charakterisiert werden und ebenso das ihm zukommende Merkmal und das Zukommen usw. Anstatt der Gewissheitscharakteristik könnten auch da und dort neben den Gewissheitscharakteren Vermutungscharaktere, Zweifelscharaktere etc. auftreten. Soll man sagen: So ist das Wesen des „Bewusstseins“, dass in sich völlig stellungsfreie bloße Gedanken nicht in beliebiger Weise stellungnehmende doxische Charaktere annehmen können, sondern Gedanken sind entweder schlichte oder fundierte, und die Weise der Fundierung schreibt dann die Art der aktuellen doxischen Charakterisierungen vor; die höherstufigen können nicht Charaktere haben, ohne dass vorher die unterstufigen sie haben, und eine synthetisch so und so geformte Materie kann Materie eines auf sie als Ganzes bezogenen Charakters nur sein, wenn sie in sich schon Charakter hat? Ein thematisches Bewusstsein ist also bloß thematisches nur in Hinblick auf einen Akt, dem sie das ganze Thema gibt; andererseits ist ein thematisches Bewusstsein, das synthetisch, also fundiert ist, niemals ein bloß thematisches, das ist, es schließt als Komponente und Unterlage ein stellungnehmendes doxisches Bewusstsein ein.1 In jedem doxischen Bewusstsein steht ein charakterisiertes Thema da (es „erscheint“ in jedem Bewusstsein etwas), und dieses Thema ist wieder fundiert und hat in der fundierenden thematischen Unterlage wieder charakterisierte Themen usw.

1 Das ist unrichtig ausgedrückt! Im bloßen Sich-Denken haben wir nicht Charakterlosigkeit, sondern die Charaktere sind modifizierte, und bloße Gedanken nehmen nicht Stellungscharakter an, sondern ihre Charaktere wandeln sich in der Art, die ihr Wesen vorschreibt, in stellungnehmende um. Was aber die „Materien“ anlangt, so sind sie in den betreffenden Stellungnahmen, deren Materien sie sind, in ihren unteren Schichten auch mit Qualitäten ausgestattet, im Übrigen aber unselbständige Schichten im gesamten Thema. Jede Materie, als Einheit genommen, ist ein Unselbständiges.

80

zur intentionalität der objektivation § 3. Das Thema der Freude. Die Scheidung von Inhalt und Charakter als eine bloße Abstraktion. Die gedankenhafte Modifikation der positionalen Charaktere. Ein mehrfacher Begriff des Themas

5

10

15

20

25

30

Wie steht es nun mit dem G emü t s be wu sst sei n? Es ist entweder auf ein pures Thema bezogen, das gar keine Charaktere enthält, oder es enthält das Thema schon doxische Charaktere, oder es enthält auch axiologische Charaktere. Wenn es solche Charaktere enthält, dann kann dem Gemütsakt zugrunde liegen ein doxischer Akt, derart, dass dessen ganzes Thema mit dem zugehörigen Charakter sozusagen als Gemütsthema fungiert. So bei der Freude. Die Tatsache, dass S p ist, ist erfreulich. Dem Akt der Freude liegt zugrunde das Urteil „S ist p“; eventuell das Überwiegend-für-wahrscheinlich-Halten. Die gesamte Materie des doxischen Aktes gehört zur Materie des Sich-Freuens. Ich urteile: „S ist p“. Dass S p ist, ist das, was mir dabei gewiss ist. Ich freue mich darüber, dass S p ist: Das Thema der Gewissheit geht in das ein, dessen ich mich freue. Aber ich freue mich darüber, dass S p ist, über die Tatsache. So mi t i st da s ni c ht bl oß Th em a d e s Ur t e i l s , s o nde r n da s c h a r ak t eri si erte T he m a a ls „ T he m a “ de r F r e u de z u be z e ic h n e n ( a l s i h r t he m a ti sc he r I nh al t). Folglich ist die ganze frühere Darstellung, wonach nur die doxischen Akte als thematische bezeichnet werden (mit der Grundauffassung, dass solche Akte allen Akten ein Thema geben), zu verwerfen. „Th e ma“ bedeutet so viel wie da s Wa s d er St e ll un g na hm e,1 de s „ A k te s “ i n de m n e u e n p r ä g n a n t e n S i nn (also beim Urteil nicht das logische Urteil „S ist p!“, sondern den „Inhalt“ „S ist p“, beim Wünschen nicht den Wunsch „S möge p sein!“, bei der Freude nicht das Erfreutsein von S p, sondern – cf. folgende Seite – die Tatsache, dass S p ist! usw.). Jeder Akt ist Stellungnahme zu etwas, in jedem ist etwas bewusst als etwas, zu dem Stellung genommen ist,2 das als so und so quali-

1

Oder das Was einer Qualität, wie es korrelativ lauten muss. Jedes „Stellungnehmen“, jeder Akt im prägnanten Sinn, ist Stellung nehmen zu etwas. So kann man freilich sagen. Aber nicht ist damit gesagt, dass in jedem Akt, wie es das Bild vom Stellungnehmen besagt, ein Gegenüber vorliegt zwischen einem Etwas, zu dem Stellung genommen ist, und einem Stellungnehmen selbst. Dieses Bild 2

text nr. 5

5

10

15

20

25

81

fiziertes Thema vor dem Blick steht. So viele Qualitäten, Gesamtqualitäten, so vielartige Akte – dabei ist vorausgesetzt, dass wirklich „Freude“ und „Urteil“ als Qualitäten gleichstehen (ich meine natürlich die ontischen Korrelate). Jeder Akt hat eine thematische „Richtung“, Richtung auf ein Thema, und es bleibt dabei, dass diese Richtung nicht Richtung auf einen Gegenstand ist, sondern auf das im Aktbewusstsein eben Bewusste, wie zum Beispiel in der Freude die Richtung darauf, dass der Garten in Blütenflor steht. Wobei dieser Satz mit allen seinen Teilen und Formen zum Thema gehört, durch jede Form geht das Freude-Bewusstsein hindurch, auf jede – eben auf dieses Ganze, wie es dasteht – ist das Freude-Bewusstsein thematisch „gerichtet“, und dabei gehört auch zum Thema der Freude der Urteilscharakter, der das durchtränkt (der Wahrheitscharakter im Thema). Das Thema ist bewusst durch ein Urteilsbewusstsein, das seinerseits sein Urteilsthema hat, und das letztere stimmt mit dem Freudenthema völlig überein, bis auf den Freudencharakter, der im bloßen Urteil fortfällt. Das Urteilsthema ist fundiert und enthält Glieder, die selbst wieder Thema und Charakter unterscheiden lassen, was also phänomenologisch zurückführt auf ein neues Aktbewusstsein, und zwar hier ein doxisches. Zuletzt kommen wir notwendig auf Themen, die keinen Charakter mehr enthalten, und phänomenologisch auf ein Bewusstsein, das keinen Stellungscharakter mehr enthält (bzw. nach der anderen Auffassung eine abstrakte Bewusstseinsschicht). (Natürlich bedarf es für die Freude keines begrifflich-ausdrücklichen Urteilsbewusstseins, keiner Prädikation, und hier ist manches näher zu studieren. Auch inwiefern besondere „Gefühlscharaktere“ an „theoretisch“ erfassten Einzelheiten fundierend für die Freude fungieren etc.) leitet immer wieder irre. Im Urteilen und ebenso in jedem schlichten intellektiven Bewusstsein, nämlich in jedem, das kein Zustimmen ist oder Ablehnen, haben wir kein Gegenüber von einem „Thema“, zu dem Stellung genommen wird, und dem Stellungnehmen. Vielmehr haben wir nichts weiter als das Was des Bewusstseins, als das „Urteil“, das Wahrscheinlichsein usw. Im Grunde ist es nicht viel anders bei den fundierten Akten, Wünschen, Freuden etc. Denn auch da steht einfach da der Wunsch, das Erwünschtsein, das Erfreulichsein etc. Aber hier liegt die Sache so, dass das Was, das im Wunsch bewusst ist – das volle und ganze Was, worauf wir wünschend gerichtet sind –, als Unterschicht ein volles „logisches“ Urteil hat und überhaupt ein volles „Thema“ eines anderen Aktes, und dieses erhält nun einen neuen „Charakter“ (neue Qualität).

82

5

10

15

20

25

30

zur intentionalität der objektivation

Wiederholt muss ich überlegen, ob meine Darstellung in der Hinsicht korrekt ist, als ich sage, dass ein stellungnehmendes Bewusstsein dem „Thema“ (Materie) zugewendet ist, zu dem der Charakter (Qualität) n ic ht gehört.1 Ist es nicht korrekter zu sagen, dass das Bewusstsein zugewendet ist dem „vollen“ Thema, dass aber zu m T hem a eb en d er C ha ra kt er g ehö rt, und so war doch meine Auffassung in der Lehre von den Kategorialien etc.2 Die Scheidung von Inhalt (Materie) und Charakter ist doch nur eine Abstraktion. Ich kann diese Abstraktion jederzeit vollziehen, aber wenn ich urteile, ist das Urteilsbewusstsein gerichtet eben auf das Urteil (im thematischen Sinn), auf das „S ist p!“ Und da ist nicht ein Thema und davon irgendwie geschieden, in einer anderen Schicht liegend, ein Charakter, sondern eben das „S ist p!“; aber jederzeit kann ich hier eine Unterscheidung vollziehen und sehen, dass dieses selbe „S ist p“ auch in einer Vermutung vermutet, in einem bloßen Gedanken bloß gedacht sein kann. E s wi r d wo h l a u c h n i c h t ang ehe n, d as bl oße G eda nk en b e wu s st se i n a l s e i n ch ar ak t er lo ses anz us e he n, s ta t t z u s a g e n , e s s e i a n st e l l e de s „ wi rk l ic he n “ C h a ra kt e r s e in mo di f i z i e r t e r. Es treten doch in dem Verstehen eines nach Grundsetzungen und Daraufsetzung falschen Satzes – z. B. „Jedes regelmäßige Dekaeder wird von jeder Ebene in 22 Graden geschnitten“ – eben alle Grundsetzungen und Daraufsetzungen auf, das Subjekt steht im Seinscharakter da etc. Aber alle diese positionalen Charaktere sind „modifiziert“ ins „Gedankenhafte“. Verwandelt sich ein solches bloßes Verstehen in ein Gewissheitsurteilen, so verwandelt sich jeder modifizierte Charakter in einen wirklichen Charakter. Nicht aber, als ob die modifizierten Charaktere erhalten blieben, in dem Gewissheitsbewusstsein auch daständen und dazu die wirklichen Geltungscharaktere.3

1 Revision. – In den Seitenbemerkungen der vorigen Blätter ist dem schon Rechnung getragen. 2 Im Folgenden: Thema = qualifizierter thematischer Inhalt. 3 Oder es verwandelten sich die modifizierten Charaktere, die die gesamte Qualität „Urteil“, vermeinte Wahrheit fundieren und Wahrheitswert haben, in wirkliche Wahrheitswerte etc.

text nr. 5

5

10

15

20

Es ergibt sich also ein meh rf ach er B eg ri ff v on Th em a: 1) Jedes Bewusstsein ist Bewusstsein von etwas, hat ein Thema, es ist auf etwas gerichtet, und nur dadurch kommt ihm „Beziehung auf eine Gegenständlichkeit“ zu; wobei aber die Gegenständlichkeit die intentionale Gegenständlichkeit heißt und vom Thema zu unterscheiden ist.1 2) Das Thema hat einen t h em a ti sc he n In h al t und einen the m at is c h en C h ara kt er. Dieser thematische Inhalt bildet einen zweiten Begriff von Thema. Wir sagen aber besser th em at i s che r I n h al t.2 Es wäre dann ferner zu sagen – zunächst für die Sphäre der doxischen Akte –, jedem Urteil entspricht ein modifizierter Akt (sozusagen ein inaktueller, ein gedankenhafter) und dementsprechend: Jedem aktuellen Thema entspricht ein inaktuelles oder jedem „wirklichen“ Thema ein thematischer „Gedanke“. Da der thematische Gedanke dem thematischen Inhalt nach übereinstimmt mit dem wirklichen Thema, so kann man in Form des Gedankens jedes Thema modifizieren bzw. jeden thematischen Inhalt gedankenmäßig „isolieren“. Das sagt darum etwas, weil sich nicht willkürlich jedes Urteil, aber willkürlich jeder Gedanke „bilden“ lässt. Ich meinte nun weiter, d a s s d e r G e g e ns a t z v o n „ w i rkl i ch em “ Ak t un d g e d a n k e nh a f te r Mo di f i k a ti o n d ur ch a ll e G a t tu ng e n des B e w uss t se i n s hi n du r c hg e h t.

§ 4. Die Möglichkeit der Verwandlung jedes Themas in ein objektivierendes Thema. Der thematische Inhalt des Wunsches. Inwieweit Gewissheit und Gewissheitsmodi bei allen Akten auftreten können. Schwierigkeiten in der doxischen Sphäre

25

30

83

Aus jedem unmodifizierten (aktuellen) Bewusstsein lässt sich nun ein doxologisches unmodifiziertes Bewusstsein bilden, das ihm eine ihm eigentümliche und seinem Thema entsprechende Objektität ent-

1 2

Das Thema in diesem ersten Sinn ist der „Satz“ im Sinn der Ideen. Thematischer Inhalt ist der „Sinn“.

84

5

10

15

20

25

30

35

zur intentionalität der objektivation

nimmt. Das sagt: Jedes Bewusstsein ist Bewusstsein eines Themas. Und damit gleichwertig ist (unmodifiziertes, aktuelles Bewusstsein vorausgesetzt): In jedem Bewusstsein „erscheint“ etwas. Im Wunschbewusstsein „Es möge S p sein“ ist dieses Thema bewusst, und dazu gehört das entnehmende Urteil: „Dass S p sei, das ist erwünscht“. Nun wird geurteilt, und das Thema dieses Urteils ist „prätendierte Wahrheit“, es ist das Urteil im objektiv-logischen Sinn. Nun sagt man: Im Wünschen ist mir der Wunsch bewusst (der Wunsch ist hier das Thema); andererseits, im Wünschen steht mir etwas als wünschenswert charakterisiert da. In der Freude steht mir etwas, eine Tatsache als erfreulich da. Ich freue mich, und mit der Freude wende ich mich der erfreulichen, mir urteilsmäßig bewussten „Tatsache“ zu. Sie hat bewusstseinsmäßig den Erfreulichkeitscharakter, aber dieser ist nicht in die Objektivation aufgenommen. Das ist: Objektiv stehen die und die Gegenstände da und objektiv ihre Eigenschaften und Verhältnisse. O bj ekt i vi tä t s bew us s ts ei n i st n u r B e wu s s t s e i n do x i sc her A rt , ei n B ew us st se i n m i t e i nem d o x i s c he n Th e ma. Das alles ist richtig. Also im Wünschen ist der Wunschcharakter nicht objektiviert, aber er kann objektiviert werden. Also jedes Bewusstsein (jedes aktuelle) hat ein Thema, aber nicht jedes hat ein objektivierendes Thema. Jedes Thema lässt sich in ein solches verwandeln, ihm lässt sich ein objektivierendes, das in ihm verborgen ist, entnehmen. In jedem Bewusstsein „erscheint etwas“; es bedarf aber eines Objektivierens, um ihm durch ein objektivierendes Thema den Gegenstand zu „entnehmen“. Ich hatte also am Anfang unter Thema immer das objektivierende Thema verstanden1 oder vielmehr seinen Inhalt; und zum Thema machen, ein thematisches Bewusstsein etablieren, das hieße, in die Urteilsstellung übergehen, die das zum Bewusstseinswesen gehörige Bezogensein-auf-eine-eigenartige-Gegenständlichkeit herausholt. Das objektivierende Bewusstsein ist von vornherein auf Gegenständlichkeit bezogen dadurch, dass es ein objektivierendes Thema hat. Jedes andere birgt in seinem Wesen die Möglichkeit gewisser Objektivationen. Wir stellen dabei in Parallele: das beliebige aktuelle

1

Dritter Begriff von Thema. Engster Begriff: objektivierendes Thema.

text nr. 5

5

10

15

20

25

30

35

85

Bewusstsein und das Wahrnehmungsbewusstsein, das letztere, bevor es Grundlage eines Urteilsbewusstseins geworden ist. Geht man der Struktur des Bewusstseins in lebendiger Intuition nach, so lasse man sich nicht durch die Sprache zu sehr leiten und eventuell irreführen. Sage ich: „Es ist zu vermuten“ oder „Ich vermute, dass S p ist“ und wieder „Ich wünsche, dass S p ist“, so scheint es, als ob einfach beiderseits ein und derselbe thematische Inhalt in verschiedener Weise des Bewusstseins gegeben ist bzw. dass verschiedenes Bewusstsein auf dasselbe gerichtet ist. Näher besehen haben wir im Vermutungsbewusstsein den thematischen Inhalt „dass S p ist“ in der Vermutungscharakteristik, aber nicht einfach denselben Inhalt in der gleichstehenden Wunschcharakteristik. Nämlich der thematische Inhalt ist zwar da, aber in der Charakteristik der Erfreulichkeit, und das alles gedankenhaft modifiziert. Es liegt also zugrunde das modifizierte Bewusstsein der Freude darüber, dass S p ist, genauer die Urteilsmodifikation „S ist p“, charakterisiert in der Modifikation der Freude. Und erst darüber baut sich der aktuelle Charakter des Wunsches auf. Der thematische Inhalt des Wunsches wäre danach der Gedanke der Erfreulichkeit des „S ist p“, nur dass dieser Gedanke wieder nicht in dieser doxologischen Form zugrunde liegt, die ihm jederzeit gegeben werden kann. Es ist kein doxologischer Gedanke. Der Wunsch, das Seinsollensbewusstsein, richtet sich auf den erfreulichen Gedanken, Wertgedanken als thematischen Inhalt, und intentional ist er bezogen auf das gedachte Erfreulichsein, auf den gedachten Seinswert, der in ihm sozusagen gilt als Seinsollendes. Und wohl noch eine Stufe höher liegt der Wille. Das Seinsollende im Sinn des Seinsollensbewusstseins ist sozusagen der eigentümliche Gegenstand des Willens, wie sein Thema das Seinsollende selbst ist (nicht das Wünschen). Das „Erwünschte als solches“ ist das praktisch Gesetzte.1 Ich glaubte ferner annehmen zu können, dass Ge w i s s he i t , Z w ei f e l e t c. M od i s i nd , d i e be i a ll e n Ak te n a uf t r e t e n kö n nen, also auch bei den doxischen, und dass somit zwischen doxologischer Gewissheit (Urteil in prägnantem Sinn) und jeder anderen Gewissheit zu unterscheiden ist, wobei aber jede nicht-doxische

1

Wenn wir von „erwünscht“ sprechen, so ist oft das Seinsollende gemeint.

86

5

10

15

20

25

30

zur intentionalität der objektivation

in eine doxische überzuführen ist. Wie jedes Urteil kann ja auch das Urteil „Dass S p ist, ist erfreulich, erwünscht etc.“ als solches Gewissheitscharakter haben, von da übergehen in Zweifel etc. Und schließlich gilt dasselbe auch von Vermutung etc. Dass irgendetwas vermutlich ist, ist eine Gewissheit, die ihre Parallele hat in einer entsprechenden Vermutung etc. Es ergeben sich aber in der doxischen Sphäre Schwierigkeiten. „Dass S p ist, ist gewiss“, das kann nun selbst wieder ungewiss, zweifelhaft, vermutlich werden etc. Ist nun das Gewissheitsbewusstsein etwas, das Modi der Gewissheit haben kann? Da ist in der Tat eine Schwierigkeit. Geht die Gewissheit, das Urteil „S ist p!“, in eine bloße Vermutung über, sofern ich Gegenmotive erfasse, oder in einen Zweifel, so verliert das Urteil „Dass S p ist, ist gewiss“ selbst seinen Gewissheitscharakter und verwandelt sich in „Dass S p ist, ist vermutlich, ist zweifelhaft“, aber doch nicht in das Urteil „Es ist vermutlich, dass S p ist, gewiss = wahr ist“? Nun sind das Äquivalenzen, aber wie klären die sich auf? Das wäre verständlich,1 wenn d i e Ve rm u tu ng e in f u ndi e rt e r Ak t wäre, nämlich we n n nur d i e G e w i ssh ei t u nf un di er t wäre, di e Ve r mu t u ng a be r a l s ih r e n ei gen tü m l ic he n t he m at i sc he n I n ha l t hä t te d i e U r te i l s m od i f ik at i on „ S is t p! “ (ähnlich wie wir es oben beim Wünschen ausführten).2 Auf die vorgestellte Wahrheit, Gewissheit wäre dann die Vermutung gerichtet: „Ich vermute, dass S p wahr ist“. Ebenso die Frage, der Zweifel, auch die Negation, endlich auch die Affirmation. Ich denke mir, dass S p ist, gedankenhaft steht mir die „Wahrheit“ da und sie „stimmt“; sie ist die durch irgendwelche Gewissheitsmotive geforderte. Das sind feine Sachen, und es ist schwer, sich hier zu entscheiden. Jedenfalls hat diese Auffassung, wonach nur Gewissheit ein schlichter stellungnehmender Akt ist, während alle modalen Unterschiede auf Fundierung durch Modifikationen der Gewissheit (durch gedankenhafte, quasi-urteilende Akte) beruhen, viel für sich.3 Aber festlegen

1

Nein! Ob modale Abwandlungen des Urteils im engeren Sinn in Urteilsgedanken fundiert sind. Die Ansicht wird aber später widerlegt, p. 24 = S. 90,24–92,16. 3 Das Gegenteil stellt sich als richtig heraus. 2

text nr. 5

87

möchte ich das nicht.1 Wir müssen ja auch überlegen, dass wieder eine Vermutung, ein Für-Wahrscheinlich-Halten ins Schwanken kommen und selbst wieder vermutlich werden kann, sofern ja das entsprechende Wahrscheinlichkeitsurteil „Es ist wahrscheinlich, dass …“ 5 aus Gewissheit in bloße Vermutung übergehen kann usw. Überlegen wir näher. 2

§ 5. Inwieweit und in welcher Hinsicht Urteil und Gedanke ein gemeinsames Wesen haben

10

15

20

25

30

Das Verhältnis zwischen Materie und Qualität im doxischen Akt (im theoretisch stellungnehmenden Akt, sagen wir: im prädizierenden Akt). Ein Urteil, etwa „Das S und das Q stehen in der Beziehung R zueinander“, und eine entsprechende Vermutung, der entsprechende Zweifel, haben den thematischen Inhalt, die „Materie“ gemein. Das volle Was, das volle Thema ist einmal: „S und Q stehen in der Beziehung etc.!“, „Vermutlich stehen S und Q etc.“, „Ob wohl S und Q etc.?“ Was haben diese Themen, das Urteilsthema, das Vermutungsthema, das Fragethema miteinander gemein? Unmittelbar gehört der Gewissheitscharakter zu dem In-Bezug-Stehen, und ebenso gehört dazu der Vermutungs- und Fragecharakter. Mindestens bei dem Fall der Gewissheit kann ich nicht annehmen, dass das In-Bezug-Stehen „bloß gedacht“ ist, wobei es die der Gewissheit gegenüberstehende Quasi-Qualität haben müsste, als ob darin der Gewissheitscharakter fundiert wäre. Das In-Bezug-Stehen, das in Gewissheitsweise dasteht, hat ein Wesen, das ebenso vorhanden ist wie im Fall der bloß gedankenhaften Gegebenheitsweise. Würde sich der Vermutlichkeitscharakter und Fraglichkeitscharakter unmittelbar mit diesem „Wesen“ verbinden, so hätten wir also überall ein gemeinsames Wesen, nur anders charakterisiert. In dieser Hinsicht ergeben sich je nach der Stellung, die wir da einnehmen, sehr verschiedene Auffassungen von dem, was das „Wesen“ hier besagt. Lassen wir

Gründe dagegen 24 = S. 90,24–92,16. Das Problem wird nach einer vorausgeschickten allgemeineren Überlegung aufgenommen 232 = S. 89,21–90,23 oder 24 = S. 90,24–92,16. 1 2

88

5

10

15

20

25

30

35

zur intentionalität der objektivation

das zunächst noch ruhen und überlegen wir, wie dieses „Wesen“ des In-Bezug-Stehens sich zu der übrigen „Materie“ verhält. Es handelt sich um etwas in Relation zu diesem Übrigen Unselbständiges. „S und Q stehen in der Beziehung φ.“ Vom phänomenologischen Standpunkt aus sagen wir: Der Stellungscharakter der Gewissheit ist fundiert mitsamt seinem unmittelbaren Inhalt in den Akten „S“ und „Q“ bzw. in dem konjunktiv stellungnehmenden Akt „S und Q“. Oder: In der Weise der Gewissheit gesetzt ist das In-BezugStehen als dasjenige der schon als seiend gesetzten S und Q und ihrer Konjunktion. Und so ist auch im Thema der Gewissheitscharakter des ganzen Themas fundiert in den Gewissheitscharakteren der Glieder; und eben dasselbe hat zu gelten von dem Vermutlichkeitscharakter und Fraglichkeitscharakter. Der entsprechende bloße Gedanke lautet: „S und Q stehen in der Beziehung φ“, wobei das S und Q im bloßen Denken in der Weise von „nominalen Setzungen“, und zwar von Gewissheitssetzungen enthalten sind, so dass das bloße Sich-Denken seine Unterlage hat in gewissen „unmodifizierten“ Stellungnahmen. Und das ist wieder thematisch (noematisch) zu interpretieren, ebenso wie noetisch (phansisch). Vergleichen wir die parallelen Akte (die vollen intentionalen Erlebnisse) bzw. die parallelen Themata, so können wir ein gemeinsames Wesen herausheben, und dieses Wesen enthält, was die Themata anlangt, die wirklichen, unmodifizierten Themata S und Q, also nicht etwa die subjektiven Erlebnisse, sondern die Sätze, die, wie ich sagen würde, von vornherein ideale Einheiten sind und als solche in allgemeine Wesen eintreten können. Denn das Wesen, das wir hier bilden, ist ein allgemeines, das, was im idealen Gegenstand, genannt Thema, beiderseits zu finden ist. Deutlicher gesprochen: Einmal in dem „logischen Urteil“ und das andere Mal im „logischen Gedanken“, das dritte Mal in der logischen Vermutlichkeit (Wahrscheinlichkeitssatz) usw. Andererseits, von den intentionalen Erlebnissen sagen wir, dass sie das Allgemein-Wesentliche eigentümlich haben. Mehrere Urteilserlebnisse können wesentliche Gemeinsamkeiten haben, sofern sie dasselbe „Urteil“ urteilen, also identisch dasselbe Thema haben. Mehrere intentionale Erlebnisse können das gemein haben, dass sie so fundierte sind, dass hinsichtlich der fundierenden Akte diese Iden-

text nr. 5

5

10

15

20

25

30

35

89

tität des Themas besteht, also eine entsprechende Wesensgemeinschaft in diesen Akten, dass andererseits hinsichtlich der fundierten Erlebnisse eine allgemeinere Gemeinschaft des Wesens besteht, die eben der allgemeinen Wesensgemeinschaft der Themata entspricht. Also in dieser Hinsicht ist wohl alles klar. Gehen wir nun auf das angeregte Problem zurück, wie die Wesensgemeinschaft von theoretischen Themen, von Urteil, Gedanke und wieder von Urteil, Wahrscheinlichkeitssätzen, Frage etc. aufzuklären ist. Im Urteilen ist geurteilt „S ist p!“, im Sich-bloß-Denken ist gedacht „S ist p“. Durch Ideation, in welcher wir die beiden Themata zu Gegenständen machen, erfassen wir als gemeinsame allgemeine Idee das Wesen des Urteils als identisch mit dem Wesen des Gedankens? Nein, das Wesen des Urteils ist Urteil, das Wesen des Gedankens ist Gedanke, wird man sagen. Aber ist das Wesen des Rots rot, das Wesen des Dinges Ding? Das Wesen des Rots ist „Rot“, das Wesen des Dinges ist „Ding“, so ist das Wesen des Urteils „Urteil“. Das Wesen des Gedankens ist „Gedanke“, das heißt, jeder Gedanke steht unter der allgemeinen Idee Gedanke (Eidos Gedanke), jedes Urteil unter der allgemeinen Idee Urteil, jedes Rot unter der allgemeinen Idee „Rot“. Dabei ist es gleich, ob mir Urteil, Gedanke, Rot aktuell gegeben ist oder „eingebildet“. Frage ich aber, was haben das wahrgenommene Rot und das phantasierte Rot, das wahrgenommene Ding und das phantasierte Ding „als solches“ gemein, so ist das nicht genau dieselbe Frage wie die unsere, denn es handelt sich um das Thema der Rotwahrnehmung als Rotsetzung und um das Thema des RotDenkens, nicht aber um das gemeinsam Gegebene in der Rotwahrnehmung und des Rot-Phantasierens. Im Rot-Wahrnehmen steht dasselbe als seiendes Rot gegeben da, was im Rot-Phantasieren als Rot-Phantasma, als „vorschwebendes“ und quasi-seiendes bewusst ist. Müssen wir nicht sagen, dass das ein Letztes ist, ein Irreduzibles? Im R ot - W ah r n e hm e n u nd R o t - P ha n ta s i e r e n kann ich durch Ideation das W e s en (Eidos) Rot entnehmen; es ist darin gegeben.1 I m R ot - S e t ze n un d R o t - De n ke n kann ich durch Ideation nicht das Wesen Rot entnehmen, sondern das Wesen Rot-Gemeintes als solches. Nehmen wir „rundes Viereck“, so gibt es gar nicht das

1

Wie die beiden Akte selbst-gebende, quasi-gebende sind.

90

zur intentionalität der objektivation

Wesen „rundes Viereck“, aber wohl das Wesen „Rundes-ViereckGemeintes“ (das Thema, genauer der thematische Inhalt). Also immer wieder ist daran zu mahnen, dass nicht Gedanke und Phantasie verwechselt wird. Ist das richtig gestellt, so können wir wohl 5 nicht anders sagen als, das ist eine ursprüngliche Gemeinschaft; ein allgemeines Wesen ist bei Urteil (Satz) und Satzgedanken zu entnehmen.

§ 6. Ist die Vermutung in einem bloßen Gedanken fundiert oder stehen sich alle Qualitäten und ihre gedankenhaften Modifikationen einander gleich?

10

15

20

25

30

Wie steht es nun mit den modalen Unterschieden des Urteils, der Vermutung, der Frage? Natürlich kann man hier ebenso sagen, sie haben denselben thematischen Inhalt, und zwar haben wir hier zwei Möglichkeiten der Interpretation. Entweder wir sagen: Im Urteil ist dieser Inhalt unmittelbar charakterisiert als Gewissheit und ebenso unmittelbar charakterisiert als Wahrscheinlichkeit, Möglichkeit, Fraglichkeit. Oder wir sagen: Hier ist die Charakteristik keine so unmittelbare, vielmehr ist der Inhalt zunächst gedankenhafter Inhalt, und durch das Medium dieser Quasi-Charakteristik ist er als wahrscheinlich, fraglich charakterisiert. Dieser Inhalt ist zunächst Inhalt eines Gedankens und als solcher derselbe wie der des entsprechenden Urteils, und der Gedanke ist unmittelbar als Thema oder thematischer Inhalt der Vermutlichkeit charakterisiert. Dann hätten wir die Analogie mit der Freude (Werthaltung). Die Tatsache ist erfreulich (wert). Oder noch mehr mit dem Seinsollensbewusstsein: Guthaltung. Das als erfreulich Gedachte ist erwünscht, ist ein Seinsollendes. Die Setzungsweise des „Sein-Sollens“ „setzt“ ein gedachtes Sein als gedachte Materie einer Erfreulichkeit.1 So ist das „vermutlich“ eine Setzungsweise, und diese Setzungsweise betrifft ein gedachtes Sein. Ebenso das „fraglich“. Ein gedachtes Sein wird gesetzt in der Weise des „fraglich“. Aber auch ebenso im Fall der „Anerkennung“, der Zustimmung. Ein gedachtes Sein wird gesetzt

1

Materie der Guthaltung bzw. des Gutseins.

text nr. 5

5

10

15

20

25

30

35

91

als „Es ist wirklich so, in der Tat so“. Und im Fall der Verwerfung, des Nichtigkeitsbewusstseins: Ein gedachtes Sein wird gesetzt in der Weise des „nicht so“. Aber man kann dieser Auffassung Folgendes e nt ge g e ns et z en: In der Erwägung vermittelt ein gedachtes Sein; aber sollte eine schlichte Seinsanmutung nicht genauso einfach sein wie ein schlichter Glaube? Bei der Vermutung haben wir freilich oft – als Bewusstsein nämlich verstanden von überragender Wahrscheinlichkeit – eine Komplikation. „S ist p“ steht in der Weise passiver Anmutung da, zugleich spricht allerlei dagegen, es ist durch negative Anmutungen charakterisiert, und eine Entscheidung geht als Bewusstsein des Vorzugs auf die eine Seite. Aber sollte da noch eine weitere Komplikation durch Unterlegung von Gedanken statthaben? Das ist doch nicht (oder ich vermag es jetzt nicht) durch Analyse zu konstatieren. Natürlich kann man auch sagen, der Gedanke „dass S p ist“ ist fraglich, dafür spricht etwas, er ist wahrscheinlich. Aber besagt das Wort „Gedanke“ hier das, worauf es ankommt, und nicht vielleicht eben das, was wir thematischen Inhalt nennen? Oder das Bewusstsein von diesem Inhalt, der ja nach jeder Auffassung eine Komponente ist des betreffenden intentionalen Erlebnisses? Also hier finde ich ke in e e nt s c h e i d e nd e n Mo t i v e , di e S t e l l u n gna h me d er L og is c hen U n t e rs uc h u n ge n z u v er ä nde r n. Aber die früher, auf p. 212 = S. 86,11–87,6 vorgebrachten Motive für eine solche Fundierung sind durch das nicht berührt worden! Und einen Unterschied nicht sehen, ihn nicht konstatieren können, heißt nicht, dass er nicht da und bei besserer Analyse schließlich zu konstatieren sei. Wie klärt sich die Äquivalenz auf zwischen „Vermutlich ist S p“ („Dass S p ist, ist vermutlich“) und „Vermutlich ist, dass S p ist, wahr“? Ginge die Vermutung auf den gedachten Sachverhalt, so hätten wir die Quasi-Wahrheit „S ist p“ vor Augen, etwa so, dass S als Wirklichkeit unmodifiziert dasteht und dieses in Wirklichkeitsweise bewusste S „gedacht“ wäre als p, nämlich darauf eine QuasiSetzung „ist p“ gegründet wäre. Auf dieses gedachte „Wirklichsein“, „Wirklichsosein“ richtet sich nun die Vermutung. „Vermutlich ist es so“ und „Vermutlich ist es wirklich so“ ist ein und dasselbe. Sachlich dann. Ein Unterschied besteht darin, dass einmal der schlichte Gedanke (das schlichte Quasi-Urteil) „S ist p“ vollzogen ist, das andere Mal der Reflexionsgedanke „S ist wirklich p“, und beide sind

92

5

10

15

20

25

30

35

zur intentionalität der objektivation

ja miteinander äquivalent, sofern zum Wesen des Urteils gehört, dass das Geurteilte in Wirklichkeitsweise bewusst ist, aber nicht (was ein unendlicher Regress wäre) prädikativ vom Urteilsinhalt ausgesagt ist; was aber jederzeit möglich ist. Es ist also, scheint es, klar, dass die unmittelbare Äquivalenz der beiden Wahrscheinlichkeiten eine Konsequenz des Aufbaus der Vermutung wäre, ihre Fundierung in dem Gedanken, dem QuasiUrteil. Es würde sich überhaupt erklären, warum wir in Vermutungen hinsichtlich der Vermutungsinhalte Äquivalentes durch Äquivalentes ersetzen können: bei Äquivalenz der Vermutung selbst. Ebenso bei der Frage etc. Wäre die Vermutung dessen, dass S p ist, eine direkte Charakterisierung des „Inhalts“ „S ist p“, so würde die Prädikation „Dass S p ist, ist vermutlich“ bloß auseinanderlegen Charakter und Inhalt, und es wäre nicht verständlich, wie nun der Inhalt durch einen äquivalenten ersetzbar wäre: für das prädikative Wahrscheinlichkeitsurteil. Dagegen: Ist das alles wirklich völlig klar? Die Wahrscheinlichkeit mag in einem Gedanken fundiert sein, aber wahrscheinlich ist nicht der Gedanke (der ja als Gedanke ist), sondern eben dies, „dass S p ist“. Und ändere ich diesen „Inhalt“ (sei es auch in logischer Äquivalenz), so ist die Vermutung doch eine andere. Es ist und bleibt ein ursprüngliches Gesetz, dass jede Veränderung des Vermutungsinhalts, der die „Sachlage“ ungeändert erhält – also innerhalb der Sphäre unmittelbarer Äquivalenz, der Äquivalenz im eigenen Wesen –, Wahrscheinlichkeiten konstituiert, die ebenfalls äquivalent sind. Ebenso wie es ein ursprüngliches Gesetz des Urteils ist, dass Urteile verschiedenen Inhalts dieselbe Sachlage konstituieren können. Hier haben wir bloß zu sagen: Es gibt so etwas wie Äquivalenz. Ja aber, wird man sagen: Sage ich aus „Dass S p ist, ist wahrscheinlich“, so ist das ein Urteil. Und in jedem Urteil kann ich äquivalente Glieder durch äquivalente ersetzen. „Dass S p ist“ kann ich eben beliebig in der Sphäre der Äquivalenz verschieben. Das bleibt aber, ob die Anmutung durch Gedanken oder nicht durch Gedanken fundiert ist. Indessen, das ist ein T ru g sc h l us s. Das Subjekt des Wahrscheinlichkeitssatzes ist der unqualifizierte Sachverhalt, das Prädikat ist „wahrscheinlich“. Als Gegenstand genommen ist er immer wieder ein anderer, möge ich auch Äquivalentes nehmen. Der Inhalt als

text nr. 5

5

10

15

20

25

30

35

93

Inhalt ist nicht äquivalent mit dem anderen Inhalt: Für Inhalte gibt es keine Äquivalenz. Äquivalenz sagt Gleichwertigkeit in der Wahrheit; wenn das eine wahr ist, so ist das andere wahr. Wenn das eine besteht, ist, so ist das andere, in Bezug auf Sosein und Sein. Der Inhalt als Gegenstand ist aber immer, was er ist. Man könnte auch Folgendes überlegen: Ich stelle mir bloß vor, dass S p ist. Ich urteile nicht. Von dem so Vorgestellten sage ich dann aus, dass es wahrscheinlich ist. In der Vermutung liegt diese bloße Vorstellung zugrunde, das Vorgestellte hat den Charakter vermutlich, wahrscheinlich, aber ich prädiziere nur nicht. Was ist das für ein bloßes Vorstellen? Wenn ich prädiziere „Dass S p ist, ist wahrscheinlich“, setze ich den „nominal vorgestellten“ Sachverhalt nicht als wahren, nicht als Tatsache, Sachbestand. Aber es ist in diesem kategorischen Urteil an Subjektstelle doch etwas gesetzt. Dies, dass S p ist, dieser „Sachverhalt“ – ich setze ihn, aber nicht besteht das Setzen in der Setzung der Tatsächlichkeit, sondern in der Subjektsetzung für die jetzige Wahrheit, und in dieser ist gesetzt der bloße unqualifizierte Sachverhalt. Aber kann ich diese Setzung vollziehen, ohne zunächst „S ist p“ vorzustellen (vor der nominalen Umwendung), und ist dieses Vorstellen nicht ein Sich-Denken? Ein Sachverhalt ist entweder wirklich gegeben bzw., wenn nicht das, in Wahrheitsweise gesetzt (vollzogenes Urteil), oder er ist im Denkbewusstsein quasi-vollzogen. Anders kann ich ihn nicht zur Verfügung haben; er ist entweder Urteilsinhalt oder er ist Inhalt einer bloß „propositionalen“ Vorstellung. Nichts anderes als dieser Inhalt kann doch das Subjekt des prädikativen Wahrscheinlichkeitsurteil sein; ich kann ihn hier nicht aus einem wirklichen Urteil entnehmen, also muss ich ihn aus einem modifizierten, aus einem bloßen SichDenken entnehmen. Nun wird man aber sagen: Ist das nicht-prädikative, schlichte Wahrscheinlichkeitsbewusstsein eine unmittelbare Verbindung von diesem Inhalt und der „Qualität“ „wahrscheinlich“, dann kann ich ihn ja aus dem Wahrscheinlichkeitsbewusstsein selbst entnehmen. Freilich, die sprachliche Bildung des Ausdrucks für das Wahrscheinlichkeitsbewusstsein ist entweder prädikativ „Dass S p ist, ist wahrscheinlich“ oder „S ist wahrscheinlicherweise p“, „S dürfte p sein“, wobei es zweifelhaft ist, ob Prädikation zugrunde liegt. Jedenfalls ist der Ausdruck der versuchten Auffassung nicht günstig.

94

5

10

15

20

25

30

zur intentionalität der objektivation

Es ist angedeutet, dass „S ist p“ (bzw. das „ist p“) „vorstellig ist“ und darauf sich die formale Fassung des „wahrscheinlich“ gründet, als Charakter. Spricht aber nicht die Vergegenwärtigung der Bewusstseinslage für die durch den sprachlichen Ausdruck ohnehin nahe gelegte Auffassung? Das Wetter dürfte trüb bleiben. Es wird vermutlich so bleiben. Das „Es wird bleiben“ ist doch ein bloßes Sich-Denken und darauf gegründet das Vermuten, und objektiv: Die prädikativ gefasste Sachlichkeit, der prädikative Sachverhalt ist in gedanklicher Weise bewusst, und den gedachten Sachverhalt finde ich als Träger des auf ihn bezogenen „wahrscheinlich“ oder „vermutlich“. Sowie man aber geneigt ist, die Frage für entschieden zu halten, wird man wieder auf die Gegenseite hinübergeführt durch die Antwort: Wenn ich den bloßen Gedanken bilde, so ist jede „Qualität“ ins Gedankenhafte hinübergeführt (von einzelnen ausgenommen). Was ist es mit diesen gedankenhaften Modifikationen der Qualitäten? Sind sie mit da, neben der Vermutungsqualität? Ist nicht vielmehr die Sache so, dass im bloßen Sich-Denken die betreffenden Qualitäten in Modifikation bewusst sind (wie wenn ich mir denke, dass es jetzt schneit), während, wenn ich vermute, an ihrer Stelle Vermutungsmodifikationen sind? Dann wäre die Sache so, dass jeder logischen Form entspricht ein Vollzug im Charakter „wahr“ und ein Vollzug im Charakter „wahrscheinlich“; wir hätten überall dieselben Synthesen und Syntaxen, alles genau gleich. Es wären alle Akte genau dieselben, nur in einer gewissen Charakteränderung, bzw. in den Korrelaten hätten wir alles gleich, nur die Qualitäten verschieden: Das Gleiche wären die „Materien“, die Abstrakta sind. Demgemäß würden die prädikativen Formen „Dass S p ist, ist wahrscheinlich“, „Dass S p ist, ist fraglich“, ebenso „Dass S p ist, ist wahr“ einander ganz gleichstehen und auf nicht-reflexiv-prädikative Formen zurückweisen. Natürlich kann ich überall zunächst die Gedankenbildung vollziehen, aber der Gedanke als solcher ist nicht wahr etc., sondern der thematische Inhalt ist identisch mit dem Inhalt einer Wahrheit, Wahrscheinlichkeit etc. und kann als Subjekt einer Prädikation von wahr etc. fungieren.

beilage vii Beilage VII Die Beziehungen zwischen thematischem und doxischem Bewusstsein. Prädikation über den Gegenstand und seine Eigenschaften einerseits und über den Charakter der Wirklichkeit und des Wertes andererseits. Die Möglichkeit der Objektivation des Themas1

5

10

15

20

25

30

35

95

Seite 20 = S. 83,29–85,18 sage ich: Objektiv stehen die und die Gegenstände mit den und den Eigenschaften und Verhältnissen da in einem Objektivitätsbewusstsein doxischer Art, einem Bewusstsein mit einem doxischen Thema. Im Wünschen selbst ist aber der „Wunschcharakter“ nicht objektiviert, er kann aber objektiviert werden. Das Wünschen hat als Thema den Wunsch, es ist aber kein objektivierendes Thema. Die große Frage ist hier die, das thematische Bewusstsein und so überhaupt jederlei „Bewusstseinvon“ (also auch das gedankenhaft modifizierte Bewusstsein) in die richtige Beziehung zu setzen zum doxischen Bewusstsein und die nähere Bestimmung dieses letzteren selbst. Im Wünschen steht der Wunsch da, ist das „S möge p sein“ bewusst, in der Freude steht das Erfreulichsein da, im Sich-Entschließen steht der Entschluss da. W a s is t d a s f ü r e in D a st e hen? Ich kann, während ich mich über etwas freue, das erfreuliche Objekt in „theoretischem Interesse“ betrachten, um es „näher kennenzulernen“. Ich freue mich als Naturforscher über ein neues Element und lebe nicht in der Freude in dem Sinn, dass ich auf das Erfreuliche achte, sondern ich freue mich, betrachte aber das Objekt, „studiere“ seine Eigenschaften etc. Ich begehre nach dem Besitz eines Landguts. Ich durchwandere, betrachte es, prüfe seine Vorzüge, die Begierde schweigt nicht, aber ich bin beschäftigt mit der Kenntnisnahme des Objekts, ich interessiere mich dafür, wie es ist und nicht ist. Genauer besehen stelle ich fest, wie es ist, aber alsbald auch, was es wert ist. Ich betrachte die Nützlichkeiten, die Güter, und das wieder um Feststellung, ob es wirklich so „begehrenswert“ ist (in Relation zu anderem, was ich auch haben könnte, zu dem, was ich an Werten dafür dahingeben soll), ob es die begehrende Schätzung bestätigt. Was ist das: Freude, Begehren und dgl. erleben, den Objekten aber theoretisch zugewendet sein, sie in theoretischem Interesse betrachten? Ich bin da gerichtet auf Sein, auf Wahrheit. Wenn ich die Schönheit, Güte, den Begehrungswert etc. hereinziehe in die „Objektivation“, so bin ich nicht

1

Wohl 1911. – Anm. der Hrsg.

96

5

10

15

20

25

30

35

40

zur intentionalität der objektivation

gerichtet auf das Schönsein, Gutsein, auf das Seinsollen etc. in der Weise des ästhetischen Schätzens, des praktischen Wertens etc., sondern in der Weise der Urteilsrichtung. Das ist klar – aber freilich auch sehr unklar. Ist es so, dass durch das jeweilige Gesamtbewusstsein eine Objektität höherer Stufe bloß „konstituiert“ ist, das Erfassen, das Ein-Sein-erfassend-(ein Objekt im Seinscharakter)-sich-Hinwenden, geht aber nur auf eine Schicht, einen Teil des Konstituierten. Also etwa so, wie ich ein ganzes Objekt vor Augen habe, aber nur auf einen Teil achte? Hier aber wird man sagen: Das ist doch etwas ganz anderes. Beim Objekt, das in der theoretischen Wahrnehmung erfasst ist, ist nicht das Sein erfasst, sondern das Objekt; um das Sein zu erfassen, muss ich prädizieren und sagen: A existiert und dgl. Indessen, dem wird man mit Recht entgegnen, dass das Erfasste das Objekt nicht als bloßer Inhalt ist, sondern das Seinsobjekt, das heißt, der Gegenstand ist eo ipso der „wirkliche“ Gegenstand. Zum Thema gehört mit der Charakter der Tatsache, er wird nicht prädiziert, so wenig sonst etwas, was zum Gegenstand, näher zu seinem Inhalt gehört, prädiziert wird, scil. in der schlichten Erfassung. Freilich gehört das Sein nicht zum Inhalt, es ist „Charakter“. So hat nun derselbe Inhalt eventuell noch einen zweiten Charakter (oder der schon charakterisierte Inhalt hat einen neuen Charakter). Ich kann nun neue Prädikationen bilden: 1) einerseits solche über den Gegenstand und seine Eigenschaften; dann expliziere und prädiziere ich aufgrund der Explikation, und all das hält sich in der Schicht des Wirklichkeitsbewusstseins. Was das ist, müsste nun beschrieben werden. Ich urteile fortgesetzt, ohne auf „Wirklichkeit“ zu reflektieren oder auf Werte etc. 2) Ich kann dann urteilen über Wahrheit und Falschheit, über Existenz und Nichtexistenz, und wieder über Wert und Unwert, über Seinsollen etc. Wie steht es mit dem Bewusstsein, in dem der Charakter der „Tatsache“, der „Existenz“, Wirklichkeit, andererseits der Charakter des Wertes, des Schönen, des Guten etc. gegeben ist? Ein Gegenstand ist gegeben, im weitesten Sinn erfasst = ein erfassendes Bewusstsein erfasst (erschaut etc.) einen Gegenstand. Und es ist ein „Seinsbewusstsein“, der Gegenstand steht (im Modus der Gewissheit, Wahrscheinlichkeit etc.) als seiend da, ein Wirkliches steht da (modifiziert ein Quasi-Wirkliches); ein Wert ist gegeben. Aufgrund jederlei Bewusstseins lässt sich sein Thema objektivierend fassen, und zwar so, dass der thematische Inhalt zum Subjekt eines Prädikats „wahr“, „wahrscheinlich“, „existierend“, „schön“, „gut“ etc. wird. Aber wie kommt es, dass diese Urteile „Der Sachverhalt besteht“, „Der Satz ist wahr“, „Die Tatsache ist erfreulich“, „Der Sachverhalt ist seinsollender“, „Der Sachverhalt ist Inhalt einer Frage“, „Der Gegenstand existiert, ist schön

beilage vii

5

10

15

20

25

97

und gut“ nur aussagen, was in dem betreffenden Bewusstsein „erscheint“? Diese Urteile legen auseinander, was der betreffende Akt vermeint. Alle diese Akte sind vermeinend und als solche haben sie ein Thema, und das Thema auseinandergelegt in jenen Prädikationen ergibt, was da vermeint ist: Vermeintlich ist der Gegenstand schön, er „erscheint“ als schön; vermeintlich ist ein Sachverhalt wahr, er erscheint als wahrer usw. Alle solche Urteile haben eine bestimmte Anpassung an das Bewusstsein und haben über sich „Normen“. Dabei haben wir doppelte Urteile: 1) Die Urteile: „Dass S p ist, das ist wahr, das ist so“ (ich urteile nämlich), „Der Gegenstand ist schön, gefällig“ (ich betrachte ihn mit Gefallen). 2) Die Urteile: „Ich urteile, dass S p ist, und in diesem Urteil erscheint ‚dass S p ist‘ als wahr.“ „Ich habe Gefallen an G und in diesem Gefallen erscheint der Gegenstand als gefällig usw.“ Die letzteren Urteile sind evident. Evident ist, dass mir jetzt ein Urteilsthema bewusst ist (ich urteile) und dass darin der thematische Inhalt bewusst ist im Charakter wahr usw. Urteil als Korrelat des Urteilens = Thema = thematischer Inhalt im Urteilscharakter und Urteilscharakter (ontisch) = vermeintlich wahr. Nun ist aber das Merkwürdige eben der Gegensatz von vermeintlich wahr und wirklich wahr, von Urteil und Wahrheit (vermeintliche Wahrheit und Wahrheit selbst), und so überall. Und dem soll entsprechen das Gegenüber zwischen Urteilsbewusstsein und Evidenzbewusstsein, kategoriale Wahrnehmung und Erfüllung von Urteil durch kategoriale Wahrnehmung etc. Das Prädikat „Geltung“ weist hin auf „Auswertung“ der Wertvermeintheiten, und Auswertung ist der Prozess der Erfüllung, des Rückgangs auf Gründe und Begründung.

Nr. 6 D as M ei ne n als B ew u sst s ein v on e in e m Inh al t un d v on e in er g egen s tä n d l ic he n E i nhe i t 1

§ 1. Das Meinen und sein Gemeintes als solches. Ein auf das Gemeinte gerichtetes Hinblicken und eine darauf gegründete Denksetzung. Objektivieren niederer und höherer Stufe

5

10

15

20

25

30

Was heißt das „als Gegenstand dastehen“? Was heißt das „Indem ich Bewusstsein habe, habe ich Bew us st sei n v om G e ge n st a nd“, „Ich bin auf einen Gegenstand gerichtet“? Und andererseits heißt es doch: Bewusstsein ist seinem Wesen nach B ew us s t se in v on ei ne m I n ha l t, Bewusstsein ist Haben einer Meinung. Natürlich liegt nicht im Meinen zweierlei, als ob es irgendwie zwei unterscheidbare Seiten oder Momente hätte, darin eines sagte „Haben eines Inhalts“ und das andere „Richtung auf einen Gegenstand“. Wie sollte das auch hierdurch verständlich werden? Das Meinen ist in sich Meinen und nichts anderes als Meinen, und das Erste, was uns die phänomenologische Beschreibung des Meinens hergibt, ist, dass es ein Was hat, ein Gemeintes als solches, eine Meinung. (In der Reflexion aber, d.h. im Vollzug der Beschreibung des reellen Gehaltes der cogitatio, finden wir Abschattung, Apperzeption etc.) Das Was des Meinens, sagte ich, ist das Erste. Nämlich: Was ist im Meinen, fragte ich, „wirklich gegeben“? Nicht: Was ist Erlebnis, sondern was ist in diesem Erlebnis als einem Bewusstsein Bewusstes? Nehme ich es genau so, wie es bewusst ist, so gewinne ich ein evident „Gegebenes“, eben das „Gemeinte als solches“. Wenn ich jetzt davon spreche, sehe ich darauf hin, setze es als dieses, urteile darüber. Natürlich im puren Meinen stecken nicht diese Dies-Setzungen, diese Denk-, Urteilsinhalte und all das, was zu ihnen gehört. Es ist einfach ein Meinen Erlebnis, und dieses ist eben Bewusstsein, und

1

Wohl Frühjahr 1911. – Anm. der Hrsg.

text nr. 6

5

10

15

20

25

30

35

99

wenn ich auch im Hinblicken es konstatiere, so ist es doch evident, dass auch ohne Hinblicken darauf das Bewusstsein seinem Wesen nach „Bewusstsein von“ ist, vom „Inhalt“. Und wenn nun Meinen in Meinen übergeht, wenn sich Einheitsmeinungen bilden, so sind das wieder Meinungen, synthetische Meinungen von einer Einheit und je nachdem in Wirklichkeitscharakter oder Unwirklichkeitscharakter usw. Nun kommt das Denken, das sich auf Meinungen gründet (auf Akte des Meinens) und welches nun sagt: „Dies!“, welches in einer Synthese unterscheidet und wieder identifiziert, aussagt „Dies und jenes ist dasselbe“ oder „Dies jetzt in der Lage seiend ist dasselbe wie das, das dann in der Lage ist“ usw. Denken ist wieder Meinen, Urteilen ist Meinen „S ist P!“, und das ist sein Inhalt; dieses Setzen ist eben das Bewusstsein „Dies!“, und das ist sein Inhalt, von dem ist es Bewusstsein. Nun kann ein neues Meinen, etwa ein „Hinblicken“, sich „auf den Inhalt richten“, auf das oder jenes in ihm achten; es kann auf dieses schauende, hinblickende Meinen sich ein Denkmeinen gründen, ein Dies-Setzen, ein prädizierendes Urteilen usw., und es ist dabei gleich, ob ich zuerst hatte ein vorstellendes, urteilendes, wünschendes, wollendes Meinen. Immer wieder kann ein „Hinblicken“, ein schlichtes Erfassen als ein neues Meinen sich etablieren etc. Sehe ich einen Baum, so „habe“ ich die Wahrnehmungsmeinung, die Meinung dieser äußeren Wahrnehmung. Dies ist Grundlage für ein denkmäßiges „Dies!“, und etwa als „dieser Baum“. Ich kann auch eine andere Denksetzung vollziehen; nämlich indem ich sage „diese Wahrnehmungsmeinung!“ Aber dann ist vorausgesetzt ein Neues, ein Hinsehen, so etwas wie „Wahrnehmen“ (aber nicht im eigentlichen Sinn!), das sich auf die Wahrnehmungsmeinung (Gemeintheit) „richtet“. Das gewöhnliche Wahrnehmen selbst ist „H i n se he n a u f d e n Ge g e n s t a nd“, das aber heißt gar nichts anderes als eben, wahrnehmendes Meinen hat die und die Wahrnehmungsmeinung. Fragt man aber: Woher wissen wir von diesem „Wahrnehmungsmeinung-Haben“, so lautet die Antwort: eben durch solches Hinblicken und durch die Evidenz, dass das, was ich da in der eben vollzogenen Wahrnehmung, auf sie reflektierend, als ihr Was erfasste, nicht etwas jetzt erst durch mein Hinblicken ihr Eingelegtes sei.

100

5

10

15

20

25

30

zur intentionalität der objektivation

Beim Wahrnehmen müssen wir nun unterscheiden: 1) Da s , w a s S ac h e des Wa h rne hm en s selb s t i st; wir erfassen also den Gegenstand, das ist eben Wahrnehmen, Bewusstsein des Inhalts haben. Und im Fortgang des Wahrnehmens fassen wir den Gegenstand als Einheit in der fortlaufenden Synthesis der Meinungen der wahrnehmenden Phasen. Ich blicke über „den“ Gegenstand hin, immer wieder habe ich andere Erscheinungen, aber in einheitlicher Verbindung; ich fasse die Einheit (das ist nichts anderes, als ich erlebe kontinuierlich Einheit von Wahrnehmungsakten, ich habe diese Synthese, Einheit in der Kontinuität der Meinung). Und so steht eines da, und an ihm achte ich immer wieder auf Neues, auf seine Farbe, auf seine Form, auf die und jene Merkmale. 2) Andererseits aber ist zu betonen, dass gesondert bleibt, das, was Sache des b egri ff li c he n F a s se ns, des Urteilens, Aussagens ist.1 Erst da haben wir Merkmale, haben wir einen G e g e ns t a n d - w o rüb er und ihn, der Merkmale etc. hat, die ihm „zukommen“. Sowohl beim Vorstellen als auch beim Denken handelt es sich um ein Objektivieren: ein Objektivieren niederer, ein Objektivieren höherer, spezifisch verstandesmäßiger Stufe. Das D e nk e n ist es, das den Ge gen st a nd i m p r äg nan te n S i n n „ s e t z t “, nämlich als Gegenstand-worüber; ein Gegenstand, der ein „Dies“ ist und die und die Eigenschaften hat. Vor dem Denken steht aber schon die Einheit da, die noch ungedachte, noch nicht d e nk m äß i g g e s e t z t e und erkannte, bestimmte Einheit. D i e E i nh e it de s Vo r s t e l l e n s i s t „ u nb e s ti mm te “ E i nh ei t. Im Vorstellen geht seinem Was nach Meinung in Meinung einheitlich über; die b e vor z ug e nd e M ei n un g, die den oder jenen Teil, dieses oder jenes Element an der Einheit zum spezifisch Intendierten macht, ist noch nicht wirkliche „Teilsetzung“, ist noch nicht Merkmalsetzung. Ebenso wenig wie die auf die Einheit ständig gerichtete Meinung Setzung ist als Gegenstand-worüber (d. h. als „dies“, woran sich knüpft „welches“ oder „ist eine“). Es sind Hebungen, Heraushebungen etc., und immerfort ist dabei Einheit bewusst, und Einheit der Meinung ist im zusammenhängenden Meinen als Inhalt gehabt. Ich mache nun

1 Beziehendes Perzipieren vor dem Begreifen muss doch angenommen werden. Also das Begreifen lassen wir sein und dafür nur die spontane Synthese.

text nr. 6

101

diese Einheit zum Gegenstand-worüber, ich sage „dies“, ich sage nun weiter aus: „Dies ist α etc.“ Es kann aber auch sein, dass Einheit erscheint, aber nicht besonders gemeint ist, vielmehr ausschließlich gemeint ist ein Moment in der Einheit, diese Form und dgl. Dann 5 wird sie für sich und nicht in dem Einheitlichen zum „dies“. Nun aber „erscheint“ im kategorialen Akt wieder ein Gegenstand. Es ist ja ein Bewusstsein von einem Inhalt, und zwar so, dass in diesem Inhalt ein Gegenständliches bedeutet ist: der Sachverhalt. Darauf kann wieder hingesehen und ein Denken darauf gerichtet 10 werden. D e r Sa c h ver h al t w i rd z u m „ di e s “ und zum Subjekt von bestimmenden Denkakten.

15

§ 2. Das spezifische Meinen als Meinen von Einheit. Urteilen über die gegenständliche Einheit und Urteilen über den vergegenständlichten Inhalt. Der gemeinte Gegenstand schlechthin und der gemeinte Gegenstand im Wie

Mit all dem ist die Sache noch nicht ganz geklärt. Wir haben also schlichte, unterste „Vorstellungen“, immanente, transiente.1 Jede Vorstellung ist Bewusstsein eines Was, und das ist immer Bewusst20 sein von einer Einheit. Denn eine Phase einer Anschauung ist eine bloße Abstraktion. Aber auch wenn der Inhalt sich nicht verändert, so haben wir ein Kontinuum; es erscheint eine Dauer und in ihr ein Einheitliches. In dem Fall der Veränderung allerdings haben wir immer wieder einen anderen Inhalt, ein stetiges Inhaltskontinuum, 25 aber so, dass in diesem stetig veränderten Inhalt eine Einheit „liegt“. Jed e s v o rs te l l e n de B e wu s s t s e i n i s t e i n E i n he i ts be w u ss ts e i n , B e wu s s ts e i n v on E i nh e it. Habe ich dieser Bewusstseinseinheit hinreichend gut Rechnung getragen in den vorstehenden Blättern? M us s i ch n i c ht s a g e n: In j e de m v or s t el l e nde n 30 B e w us s t se i n li e g t e in e r se i t s B e wu s s ts e i n v o n e i n e m I n h al t, a nd er e r se i ts B e w us s ts e i n v o n e i n e r E i nh e i t d e s

1 Jede konkrete Perzeption ist stetige Perzeption und als solche Bewusstsein einer Einheit, der Einheit in der Dauer, und jedem Moment entspricht ein anderer Inhalt.

102

5

10

15

20

25

30

35

zur intentionalität der objektivation

Inh alt s – oder im Inhalt: eben Bewusstsein vom „Gegenstand“? Und wenn wir das vorstellende Bewusstsein als ein im spezifischen Sinn meinendes Bewusstsein nehmen, so geht doch das Meinen eben auf die Einheit, auf Einheit als Gesamteinheit, die zum gesamten stetigen Inhalt gehört, auf die Momente der Einheit: auf diese Fläche, diese Färbung der Fläche etc., nur nicht in denkmäßiger Fassung, in prädikativer. Was ist darauf zu sagen? Muss ich nicht unterscheiden, wie ich es ja getan habe, bei jedem vorstellenden Bewusstsein d i e Ma nn i gfa lt i g k e it im G an z en st et i g i ne i na nd er ü be rg eh en d er I nh al t e un d d i e E i n hei t des I nh a lt s? Im Wahrnehmen lebend unterscheide ich natürlich nicht. Bewusst habe ich immerfort Einheit. Ich habe nämlich nur Bewusstsein von dem sich so und so Konstituierenden, und das ist Bewusstsein einer Einheit. Das spezifische Meinen (Merken) ist immer Meinen von Einheit. Sollen wir da sagen: Bewusst ist dabei der Inhalt, gemeint die Einheit? Aber auch, wo wir im Besonderen auf Seinsmerkmale, auf eine Form oder Farbe meinend gerichtet sind, sind Einheiten das Gemeinte. M e in e n i st i m me r u n d n ot w e ndi g M e in e n v on E i nhe it, Meinen von Gesamteinheit, die doch Einheit des Gegenstandes ist und Meinen-von von Partialeinheiten, die „impliziert“ sind in der gegenständlichen Einheit und die durch das Sondermeinen nur zur „E x p li ka t io n“ kommen. Und soll ich weiter sagen: Es könne nun doppelt geurteilt werden? Einmal könne solche Anmessung des Urteilens an das Vorstellen, wir dachten hier an Wahrnehmen, statthaben, dass eben eigentümliche Deckung besteht, die überall vorliegt, wo wir von irgendeinem Urteilen (und jedem) sagen, indem es urteile, liege ihm ein Vorstellen der Gegenstände-worüber zugrunde (ein Vorstellen, das sie so vorstellt, wie es das Urteil eben „fordere“). Und das andere Mal urteile ich anders; ich blicke auf den „Inhalt“ der Wahrnehmung hin, der von Phase zu Phase ein anderer werden kann, und sage etwa: Dieser Inhalt, sich konstituierend, sei immer wieder ein anderer, und es sei ein Inhalt, in dem bei aller Änderung Einheit sich bekunde, Bedeutung „von“ Einheit. Dabei setze ich offenbar Inhalt und Gegenstand in Bezug; ich vollziehe also beiderlei Urteilsweisen und verbinde sie logisch, wie es dieses Relationsbewusstsein eben fordert.

text nr. 6

5

10

15

20

25

30

35

103

B ew u sst s ein d es un d d es s i ch ba ld v er änd er n de n , b a l d u n verän d ern den I n h alt s „ h ab en “, das is t g e g en st än dl i ch ger ic ht et s ei n. Näm li c h , so lc h es B ew us sts e in hab en , das ist , al le B e di n gu n gen erf üll t h ab en fü r e in s ch li c ht si ch an m es sen des Ur t e il en ü b er d en Ge g e ns tan d , ü b er d ie E i nh e it. Aber so geartet ist das Bewusstsein, dass auch noch jener „Hinblick“ möglich ist, der dem Bewusstsein sein Was entnimmt, den In h al t z um G egen st an d m ac ht und neue Urteile nun auf dieser neuen Vorstellungsunterlage ermöglicht. So geartet ist Bewusstsein, dass d ie se z we i U rte i l sw ei se n un d d a zu noc h w ei t e re m ög li c h sind und dem vorstellenden Bewusstsein kann mehrerlei „entnommen“ werden. Es ist Richtungauf den Gegenstand, es ist Bewussthaben eines „Inhalts“, u nd de r I n ha l t i s t d a b ei n i ch t a n de rs al s d ie E i nh ei t , so w ie si e s i ch v on P ha s e z u Pha s e vor st el lt, so und so orientiert, in dem klar, in jenem unbestimmt etc. Aber wenn ich nun die ganze, in mannigfaltigen Phasen sich fortbewegende Wahrnehmung nehme, so ist der ganze Inhalt doch das Eine, das sich von Phase zu Phase in bald derselben, bald neuer Orientierung etc. zeigt. I nha l t ist doch von vornherein eines oder et wa s , d as si ch s o un d so v or st el l t, und in dieser Kontinuität etwas, das unbeschadet der verschiedenen Vorstellungsweise immerfort dasselbe ist. Und auch in diesem ganzen Zusammenhang genommen hat es seine Weise, und in einem anderen Zusammenhang, etwa in der Fortführung der kontinuierlichen Wahrnehmung in eine sich anschließende Kontinuität neuer Wahrnehmung, is t d a s se l b e i n e i ne m n eu e n W i e der Me i nu ng bewusst. Und auch jetzt bleibt vieles unbestimmt und unklar, das Eine, so wie es sich da vorstellt, ist in dieser Phasenkontinuität so und so Bestimmtes und sich Klärendes, aber so und so immer unbestimmt und offen Bleibendes. Aber ist es nicht ein Unterschied, au f E i nh e i t zu  a c ht e n un d au f da s W i e de r G e ge b e nh e i t de r E in h e i t z u  a c ht e n? Gewiss. Ich kann einfach im Bewusstsein der betreffenden Anschauung leben, und ich kann unterscheidend auf das jeweilige Wie der Gegebenheit achten, auf die verschiedene Weise der Orientierung des bestimmt und klar Gegebenseins nach der Seite und den Momenten, der Unbestimmtheit nach jener usw. Muss man andererseits aber nicht sagen, Bewusstsein ist eo ipso Bewusstsein einer sich in der und der

104

5

10

15

20

25

30

zur intentionalität der objektivation

Weise gebenden Einheit und die sich in der Weise gebende Einheit ist Einheit der „Meinung“?1 Meinung ist hier nicht Meinen, sondern Gemeintes als solches, gemeinter Gegenstand als solcher in seinem jeweiligen Wie. Es kann in immer neuen Akten mit ihren immer neuen Meinungen das Gemeinte dasselbe sein, nicht als ob die Verschiedenheit jener Meinungen aufgehoben würde, sondern es konstituiert sich Einheit der Meinung im synthetischen Vereinigungsakt, und in der Einheit der Meinung ist das hier so und dort so Gemeinte als Eines gemeint. Was sagt das aber? Das sagt, dass eben das Meinen mit Meinen und korrelativ Meinungen mit Meinungen sich in der Einheit eines meinenden Aktes als Inhalt zusammenschließen können zu einer Meinung und dass eine Meinung wieder zerteilt und innerlich unterschieden werden kann in Meinungen (etwa den Zeitteilen der Wahrnehmung entsprechend) und dass diese Einigung der Meinung eine solche ist, dass evident gesagt werden kann: „Gemeint ist in der Einheit ein Etwas, das sich jetzt so und jetzt so darstellt, jetzt in der, jetzt in jener Orientierung erscheint etc.“ Oder, das Etwas, das zu jeder dieser Teilmeinungen gehört und das das ist, was in der oder jener Weise erscheint, ist in allen Teilmeinungen der einheitlichen Meinung ein und dasselbe. „Ist“, das heißt: ist im Sinn aller dieser Meinungen dasselbe, ist dasselbe Gemeinte. Jede Meinung meint also etwas, das sagt, sie meint Eines = Etwas und meint es in den oder jenen Bestimmtheiten und in den oder jenen Unbestimmtheiten so und so, teils eigentlich anschaulich, teils unanschaulich etc. A n j e dem G em ein t e n h a b e n wi r e i n E t wa s ode r E in e s a l s G em ei nt es un d e i n W ie d es ge m e i n t e n Et w as zu un te r sc he i d en. U nd be i ve r s ch i e d en e m W i e d e s G em e i n te n a l s s ol c he n ka n n Id e nt i t ät de s E i ne s od e r Et w a s s t a t t ha be n , da s g e m e i nt is t. Das gehört zum ursprünglichen Wesen des Gemeinten; ein solches Gemeintes (etwas in einem Wie) bewusst zu haben, das ist das Wesen

1 Hier ist zu beachten, dass „Meinen“ hier nur ein anderes Wort ist für Bewusstsein, und Gemeintes (Gemeintheit, Meinung) für Bewusstes als solches. Also jedes Perzipieren ist Meinen und das Perzipierte als solches die gemeinte Einheit. Denn das „Meinen“ in dem speziellen Sinn des Herausmeinens, des Zugewendetsein etc. kann hier nicht bevorzugt werden.

text nr. 6

105

des Meinens. Das Etwas ist der gem ein t e Ge ge ns ta n d schlechthin. Das Etwas aber ist nur etwas im Wie, das ist der g e me i n te G eg ens t and i m Wi e.

Nr. 7 C o g itat io un d ih r Ko r re l at. D er z ur c o gi ta ti o ge hö r e nd e Ic hs tr ahl . Das K or re la t a ls Ve rm e in t h ei t sch l e c h t h i n. E vi den z a ls h ö h er st u f ig er Ch ar ak t er vo n Ko rr el at en 1

5

10

15

20

25

30

Cogitatio und ihr Korrelat, z. B. Wahrnehmung oder auch vager Gedanke. Der wahrgenommene Gegenstand als „Kor re lat“. Dem „entspricht“ die ideale Möglichkeit, die cogitatio in gewisse Deckungszusammenhänge mit anderen cogitationes zu bringen (z. B. die Wahrnehmung in Zusammenhang mit anderen Wahrnehmungen, Erinnerungen etc.) und dazugehörig die Evidenz: gemeint ist dasselbe. Jede dieser cogitationes hat verschiedenen r e el l e n G e ha l t, sie ist als cogitatio verschieden: Achte ich auf die Verschiedenheit, so kann sie in verschiedener Richtung liegen. Zum Beispiel, ich urteile „2 mal 2 ist 4“ einmal klar, das andere Mal unklar, einmal deutlich (in sich absetzenden Schritten artikuliert), das andere Mal undeutlich. Das Was, das Urteil ist dasselbe. Auch kann ich z. B. ein und dasselbe mit lebhafter Überzeugung urteilen, das andere Mal mit geringer Überzeugung etc. Oder viele Wahrnehmungen von einem Gegenstand: In jeder kommt etwas anderes vom Gegenstand zu „wirklicher“ Wahrnehmung, in jeder ist die „Orientierung“ des Gegenstandes zu mir geändert. Auch ist das Zeitliche ein anderes: Das Dauernde ist dasselbe, aber aus der Dauer ist immer wieder ein anderer Zeitpunkt des Gegenstandes „gegenwärtig“, und von der Dauer des Gegenstandes ist in jedem Jetzt ein anderer Aspekt der Dauer, die zeitliche Orientierung eine andere. Eine andere Serie von Verschiedenheiten ist aber die: Ich achte auf die darstellenden Momente, in denen sich der Gegenstand nach den oder jenen Beschaffenheiten eben darstellt. Und ich achte auf das „Was“ der Darstellung von dem und dem. Die Beziehung auf das Dargestellte hängt nicht am „Gegenstand“, sondern am Darstellenden. Ich unt e rs c h ei d e i n de r Re f l e x i on di e c o g i t a t i o s e l bs t u n d d a s d a r in C og i t i e rt e. Die „cogitatio“ sagt hier, ich kann

1

Wohl 1911, mit Zusätzen aus der Zeit nach 1913. – Anm. der Hrsg.

text nr. 7

5

10

15

20

25

30

107

„reflektieren“ und Darstellung finden und Darstellung von dem finden und die Evidenz gewinnen: „Das ist in gewisser Weise schon ‚Erlebnis‘ gewesen, wenn ich darauf auch nicht den ‚Blick‘ gerichtet hatte“. Ich hatte ursprünglich den Blick „natürlich“ auf den „Gegenstand“ gerichtet. Ferner die Unterscheidung zwischen dem identischen Was, dem Intendierten, das aber bald Aufgemerktes ist, bald nebenbei Beachtetes, bald im Hintergrund Verschwimmendes, und wieder dem Etwas, das „Gegenstand“ ist, das als „wirklich“ charakterisiert sein kann, als durchgestrichene Wirklichkeit, als nichtig, als vermutlich etc. Ich unterscheide im Korrelat „Gegenstand“ und Charakter. Ich sage: Ich bin aufmerksam auf den Gegenstand, der Gegenstand ist im Mittelpunkt meiner Aufmerksamkeit, er ist mein Thema, er ist Subjekt meines Urteils etc., oder der Gegenstand ist mitbemerkt. Oder der Gegenstand ist für wirklich gehalten, oder ich setze ihn als wirklich; ich halte ihn für nichtig, ich glaube nicht an seine Wirklichkeit, an sein Sein, ich bezweifle sein Sein etc. Dem „Gegenstand“ zugewandt und aussagend, was ich an ihm finde, sage ich: Der „Gegenstand“ ist wirklich, ist nichts, ist vielleicht. Andererseits, „normal urteilend“ sage ich: Der Gegenstand ist rot, ist ein Haus etc. Und dabei rede ich vom wirklichen Gegenstand, nämlich dem in der Weise „wirklich“ gesetzten und nicht von dem Gegenstand in Anführungszeichen. Phänomenologisch: Ich nehme wahr, und das Wahrgenommene ist in eins der Gegenstandsinhalt (der „Gegenstand“) und „Charakter“, und dieses Ganze ist selbst wieder Gegenstand in Anführungszeichen, sofern ich ja jetzt phänomenologische Reduktion übe; a ls o G e ge n s ta n d i n A n f ü hr un g s ze i c h e n i s t do ppe l sin ni g.1 Im ganzen Intentionale scheiden sich I nh a l t und Ch a r a kte r, und zwar habe ich wieder zu scheiden das Intentionale der Wahrnehmung, wo diese Scheidung nicht vollzogen, wo eben das Wahrgenommene Wahrgenommenes ist, und die Reflexion, in der ich das „Etwas“ setze und den Charakter daran setze. Wie erfasse ich das „Wahrgenommene schlechthin“ phänomenologisch? Ich nehme nicht einfach wahr (oder versetze mich nicht einfach in ein Wahrnehmen, etwa in der

1

Das heißt, in der Redeweise der Ideen, es scheidet sich bloßer „Sinn“ und Satz.

108

5

10

15

20

25

30

zur intentionalität der objektivation

Erinnerung oder Phantasie), ich reflektiere und sage, es ist eine Einheit da, und diese zerlege ich in das Etwas und seinen Charakter. Wie st eh en nu n d ie C har akt er e z ur „ Su bj ek ti v i tät “? Das kann sagen: z um „ I c h “. Es kann aber auch gefragt werden, was da S ac he d e r c ogi tat io W ah rn ehm u ng ist. Ich habe dem „Etwas“ der Wahrnehmung entsprechend, das da dauerndes, so und so bestimmtes Etwas ist, nicht den reinen Einheitspunkt, sondern den Einheitspunkt in einer Zeitform und mit einem Gehalt an wieder räumlich bezogenem Bestimmungsmaterial, an Darstellungsmaterial und „Auffassung“-als und dazu Material motivierender Empfindung (Sinnliches). Im Fortgang der Wahrnehmung habe ich das „ein und dasselbe“, das „kontinuierlich eins“, aber das gehört zum Korrelat. Ich finde eine gewisse „Beziehung“ des Darstellungsmaterials auf das (jetzt in anderer Einstellung bewusste) Etwas, Haus etc. Und wo ist das „Ich halte für wirklich“, „Ich zweifle“, „Ich vermute“? Muss ich nicht sagen, eben da ist di e B e zi e h un g zum I ch, das keineswegs die Person besagt, sondern vor aller Objektivierung der Person etwas zu m We sen d es „ Ak te s “ s el bs t Ge h ö ri g e s i s t? Ein Ichstrahl gehört zur cogitatio, und der terminiert im Korrelat, und zwar in dem Charakter „wirklich“ des Gegenstandes, eine Weise ihn zu charakterisieren, so dass er dann jenen Charakter hat.1 Jede cogitatio hat ihren Ichstrahl, und rein ihrem Wesen nach hat sie ihren subjektiven Identitätspunkt i m r ei ne n Ic h de r t r a n sze n d en t al e n A p p er z e pt i o n, jede cogitatio, die eben zu einem Ich gehört (abgesehen von der Person). Und zum Ich gehört auch die „Auffassung“ in ihrem Modus als Wahrnehmungsauffassung, Phantasie etc.: Ich nehme wahr, ich habe die Einbildung. Aber hier besteht eine gewisse I c h f er ne. Ich fasse auf, ich setze als wirklich, halte für wirklich, für gefällig (ich habe Gefallen an), ich liebe, ich hasse. (Haben nicht Gemütsstrahlen die größte Ichnähe oder nicht vielmehr, wenn ich im Gemütsakt „lebe“? Im Aufmerken, Klarmachen etc. bringe ich es mir näher.) Da s D ar s te l l u ng s ma t e r i a l h a t di e gr ö ßt e Ic h f e rn e, im „Bewusstsein“ die größte Ferne vom

1

Husserl hat hinter diesen Satz ein Fragezeichen gesetzt. Darauf bezieht sich seine Randbemerkung: „Ja, als Zuwendung. Aber ohne Zuwendung doch wohl nicht, oder in anderem Sinn?“ – Anm. der Hrsg.

text nr. 7

5

10

15

20

25

30

35

109

Ichpunkt. Die Stellungnahme und insbesondere die Stellungnahme, in der Hinwendung-auf statthat, die führt am nächsten zum Ichpunkt. Es fragt sich nun, wie es mit dem Recht der Rede von „Korrelaten“ steht im Gegensatz zu dem „Entsprechenden“ auf Seiten der cogitatio. Das Recht der Unterscheidung wird doch wohl nicht anfechtbar sein. Das Korrelat besagt nichts anderes als das vorgestellte, geurteilte, bewertete etc. Was. Das heißt: Evident ist bei jeder cogitatio auszusagen, dass sie etwas bewusst hat und mit den und den Charakteren bewusst hat, und diese Beschreibung nennen wir Beschreibung des Korrelats (des Vermeinten als solchen). Auf das „Haben“ des Korrelats, auf das Sich-Beziehen auf das Korrelat, bezieht sich die N o r m i e r u n g: Das Korrelat „besteht in Wahrheit“, der „Gegenstand a ist wirklich“: In Wahrheit besteht das; in Wahrheit besteht es, dass der Gegenstand a nicht wirklich ist, vermutlich ist usw.: Das sehe ich, das ist evident gegeben, wenn das Phänomen im Zusammenhang einer Begründung steht und ich in ihr liegend das Korrelat identisch sich durchhaltend finde und finde, dass es dabei den C h a ra k t e r h ö he r er S t u fe „ w ah rha f t so “ annimmt. Aber ist dieser Charakter nur ein n eu er C h ar ak te r, also ein ne u es Ko r r e l a t? Komme ich nicht in einen Zirkel? Das Korrelat a l s v e r m e in t e s ist immer evident gegeben. Aber gegeben ist da dabei nur dies, dass das Phänomen das und das vermeint, dass das Vermeinte ist als Vermeintes dieses Phänomens. Jetzt aber ist etwas Neues gegeben, nämlich wenn das Phänomen ein „stellungnehmendes“, ein „setzendes“ ist. Dann ist im Fall der Evidenz das Meinen nicht ein leeres, sondern ein erfülltes Meinen, ein begründetes, rechtmäßiges. Der n eu e Ch a r a kt e r ist Charakter des identisch Vermeinten, der hindurchgeht; der Charakter des „wahr“, des „Es besteht rechtmäßig“, des „Es trifft zu“ trifft das ganze Korrelat des Phänomens, das ein Rechtsbewusstsein ist (oder unvollkommenes wie das Bewusstsein des Gegebenhabens der Wahrnehmung) und dann den Inhalt des Rechtsbewusstseins ausmacht. Fälle: Das Vermeinen als Nichtgegebenhaben, das Gegebenhaben, das immer vollkommenere Gegebenhaben; das bestätigend Gegebenhaben, welches das vorgängige Gegebenhaben selbst wieder bestätigt und uns aussagen lässt, das Gegebenhaben war wahres Gegebenhaben, seine Richtigkeit zeige sich im Fortgang.

110

5

10

15

20

25

30

35

zur intentionalität der objektivation

A lso au c h d as G egeb en ha ben is t e ve nt ue ll z un äc hs t ein Verm ein en gegeb en zu h ab en, und das Ausweisen des Gegebenhabens ist ein Vermeinen des Ausweisens, und so kommen wir in manchen Gruppen von Fällen (äußerer Natur) zu unendlichen Reihen aufeinander bezogener Unterschiede von vermeintlich und wahrhaftig, vermeintliche Wahrheit – wahrhaftige Wahrhaftigkeit usw. Demgegenüber ad ä q ua t e G ege b en he i t gegenüber der D ars t e ll un gsg egeb enh ei t: unendlich viele mögliche Darstellungen, das Etwas von unendlich vielen möglichen Seiten in unendlich vielen Orientierungen zu geben. Jedes Gegebenhaben ist nicht nur einseitig, sondern es hängt davon ab, ob die anderen Seiten „zu haben“ sind, ob das Haben und Gegebenhaben wirkliches Gegebenhaben ist und nicht bloß vermeintliches. Im Falle adäquaten Gegebenhabens habe ich keine Darstellung, keine Einseitigkeit, nichts, was offen geblieben, nichts, was unbestimmt geblieben ist, nichts, was sich erst zeigen soll und ob es sich wirklich zeigen lässt, alles, was Inhalt ist und gesetzt ist als seiend, ist gegeben und ist absolut gegeben, nicht relativ und in Abschattung gegeben. Korrelat des adäquaten Gegebenhabens oder der Evidenz: das „Objektiv-evident“-Sein, das Absolut-zweifellos-Sein, das Wahrund-wirklich-Sein. Aber: Dieses Korrelat hat die Auszeichnung, dass es keinen Sinn hat, dafür eine weitere Ausweisung zu verlangen. Im einen Fall habe ich d a s P h ä n om e n un d se i n Ve r m ei nt e s, das als Vermeintes evident dem Phänomen zukommt, im anderen nicht nur das, sondern wie das Phänomen ist, absolut, ist auch das Vermeinte und nicht bloß als Vermeintes. Das bloß Vermeinte: das sagt, es ist nicht etwa absolut seiend (gegeben und zu Gebendes), sondern es ist ungegeben Vermeintes; es ist gegeben, dass es vermeint ist. Eine Idee ist absolut: Sie ist einsichtig zu geben; eine Idee einer gebenden und absolut erfüllten Meinung, die sie gibt, ist möglich, und die Idee dieser gebenden Meinung besteht in Korrelation zur Idee des Gegebenen, die dann Idee und gegebene Idee ist. Die Ideen haben einen notwendigen Zusammenhang. D a s , wa s ge g e be n i s t , h a t ke i n e An fü hr u ng s ze i c he n ? W as b esa g en d ie An f ü hr u n g s ze i c h e n? Das Nicht-Urteilen über das Sein, die phänomenologische Reduktion? Sie betrifft die Natur,

text nr. 7

5

10

15

20

25

30

35

111

überhaupt, sie betrifft das Sein, dessen Erkenntnismöglichkeit ich jeweils untersuche. Wo ich Evidenzgegebenheit habe, da habe ich absolutes Sein und in idealer Überlegung Idee des absoluten Seins. Wo ich anderes Vermeinen habe, da habe ich das Vermeinte als Vermeintes. Ich habe eben die Evidenz, dass ich auf Grund dieses Vermeinens über sein Was aussagen kann, was es meint. Das Was ist aber eben „Vermeintes“, und al le s V erm ein te i n ein e r Ka te go ri e : Ver m ei n t es. Dagegen, besteht das Vermeinte, das heißt, entspricht der Vermeintheit eine Wahrheit, dann ist die Wahrheit eben nicht bloß Vermeintheit. Die Wahrheit „2 × 2 = 4“ habe ich gegeben im evidenten Urteil. Aber ist darin nicht auch eine Vermeintheit? Ja freilich. Die Wahrheit ist auch ein „Urteil“ (Urteilsvermeintes). Aber das Urteil finde ich nicht bloß als Urteil, sondern als Inhalt einer Wahrheit, und die Wahrheit finde ich. Und wie steht es mit dem Charakter „wahr“? Jener, der in der Evidenz zum Urteil gehört und das ganze Urteil durch und durch charakterisiert: Es ist nun gegebener Sachverhalt, „anschaulich“ nach allem gegeben, vollkommen. Nun, es ist ein eigener Grundcharakter, den nicht jedes Urteil annehmen kann (natürlich nicht der Begriff „wahr“, sondern das „wahr“ selbst), und er gehört zum Urteil nicht in Bezug auf den zufälligen oder besonderen Akt, sondern zum Urteil seinem Wesen nach gehört als dieser Vermeintheit, welchen Vermeinens immer, das „wahr“. Das heißt, rein durch das „2 × 2 = 4“ ist das „wahr“ vorgezeichnet. Nämlich mit ihm ist das „wahr“ verträglich, und zwar ideal: nicht bezogen auf den zufälligen Akt. Es besteht die ideale Möglichkeit, das Urteil „einsichtig zu machen“, es besteht die ideale Möglichkeit der Einsicht bzw. die ideale Möglichkeit dieses Korrelats Urteilswahrheit, das nicht für jedes Urteil besteht! K o rre l a t besagt nicht Vermeintheit im Gegensatz zu Wahrheit, sondern V e r me i n th e i t s c hl e c h t hi n, und Vermeintheit ist eben solche, die eventuell evident ist oder nicht; und E v i de n z ist immer schon ein Charakter von Korrelaten, ein Ch a r a kt e r höh er er St uf e, der aber selbst ins Korrelat gehört. Dieser Charakter kann sich mit gewissen Korrelaten verbinden (in entsprechenden cogitationes also), mit anderen nicht: immer im Rahmen der Gegebenheit. Es bedarf einer Formenlehre möglicher Korrelate nach allen Stufen als Analogon der Formenlehre der Bedeutungen. Und dazu gehört

112

zur intentionalität der objektivation

auch die Erwägung, zu welchen Korrelaten das Charaktermoment „Evidenz“, gegebenes „wahr“, hinzutreten kann und zu welchen nicht, ob es auch zu ihm selbst hinzutreten kann etc. Tritt es hinzu, so heißt der Gegenstand gegeben oder in seiner Wirklichkeit gegeben, in 5 seinem Sein, denn das charakterisiert das „Gegenstand im Charakter wirklich“; es heißt die Vermutlichkeit des Gegenstandes gegeben, denn das charakterisiert das „Gegenstand im Charakter vermutlich“. Gegeben kann sein „S ist p“ – der „Sachverhalt“ ist gegeben, das Urteil steht da als wahr. Wirklich ist S p, vermutlich ist S p – das 10 Urteil, die Vermutung: „das Sp ist wirklich“.

Beilage VIII Der Blick des reinen Ich auf die Phänomene. Das Übergehen des Blickes vom Phänomen zu dem in ihm Erscheinenden1 De r B lic k a uf Einzelnes (Individuelles), auf Allgemeines, zunächst im Sinn eines Wesens, auf Individuelles als Einzelnes des Wesens als eines „Allgemeinen“, auf ein Allgemeines im Sinn der Gattung, auf eine Art als Art der Gattung, auf Einzelnes und ein anderes Einzelnes, nämlich auf „beide zusammen“, nicht auf Einzelnes, aber auf eins von zwei Einzelheiten, 20 auf Einzelnes als „Teil“ eines anderen Einzelnen, auf sonstige „Relationen“ usw. „Der Blick auf“: ein bestimmter Sinn von „meinender“ und „setzender“ Zuwendung. Haben nun dieser „Blick“, diese „setzende Zuwendung“ nicht ihre „Weisen“, ihre Formen, denen korrelate Formen des Gemeinten als sol25 chem entsprechen? Ist er nicht selbst in einem neuen „Blick“ als Phänomen zu fassen? Wobei dieser neue Blick eben wieder „Blick“ ist auf? Nun eben dieser Blick geht auch auf das in den Phänomenen „Intentionale“, und zum Wesen des durch ein Phänomen hindurchgehenden Blickes gehört es, dass eben auch der Blick auf das Phänomen zu richten ist, durch 30 welches der Blick geht. Oder es gehört zum Wesen von Gemeintheiten einer großen Klasse, dass eine Reflexion des Blickes möglich ist auf die Phänomene, „durch“ welche das direkte Meinen ging. Der Blick und die „Ein h e it d e r t r a ns z e nde n ta l en Ap pe rz e pt io n“ K an ts, das „Ich denke“, das alle meine Vorstellungen muss begleiten können.

15

1

Sommersemester 1911.

beilage viii

5

10

15

20

25

30

35

113

Phänomenologie als Wesenslehre der puren Phänomene nach ihren reellen Momenten und nach ihren intentionalen Beständen. Ihrem Wesen nach begründen Phänomene Einheiten der Identifikation und Unterscheidung. Sie treten in Einheitsphänomene der Identifikation und Unterscheidung durch ihr Wesen ein. Dabei aber sagen wir, es ist „evident“, dass die so in Einheit tretenden Phänomene „dasselbe meinen“, in dem Sinn, dass dieselbe „Gegenständlichkeit“ in diesen Phänomenen „bewusst“ ist, dass dasselbe gedacht ist oder erscheint, anschaulich ist etc. Betrifft das unmittelbar alle Phänomene oder nur seinssetzende oder quasi-setzende Phänomene, während andere Phänomene ihrem Wesen nach in Seinssetzung oder QuasiSetzung eintreten können? Noch ist also nicht letzte Klarheit erlangt über das, was das Thema und den Sinn der Phänomenologie ausmacht. Ausgang vom „Dies da“, vom Phänomen, z. B. Phänomen des Gedankens, Phänomen einer Beweisführung, Phänomen eines Aussagens, Phänomen einer Wahrnehmung etwa jetzt, Phänomen des indirekten Sehens, Doppelbild etc. Phänomen des Hintergrunds, auf das ich „nachträglich“ die „Aufmerksamkeit“ lenke. Die Unterschiede der Aufmerksamkeit, des Übergangs von „Beachtung“ des Phänomens und jenes Phänomens und die zugehörige attentionale Modifikation usw. Das F u n d am en t : Ei n B li c k d e r S ch a u un g ri ch t et si c h a u f e in P h ä no m en und richtet sich bald auf dies, bald auf jenes Phänomen in einem phänomenalen Zusammenhang, und der Blick richtet sich eventuell auch auf sich selbst und richtet sich also darauf, dass sich ein Blick auf dies und jenes gerichtet hat und noch richtet oder im Übergang ist. Soll man das zur Id e e d es „ r e in e n I c h “, „der reinen Apperzeption“, in Beziehung bringen und sagen, wir unterscheiden hier einerseits verschiedene Blicke und andererseits sagen wir, der Blick geht von dem zu jenem über.1 Was an reduzierten Phänomenen in die Einheit eines Blickes, der von dem zu jenem übergeht und der ein I d en t i sch e s b eh ält, das Identische, das das „I c h blicke“ ausmacht, fällt und was in die Einheit eines Ichblicks fallen kann, das macht eine E in h ei t d e s I ch b ew uss t s ein s aus, nämlich macht eine Einheit von Phänomenen aus, die zu demselben reinen Ich „gehören“. 2 Der Blick geht von Phänomen zu Phänomen fort, er geht aber auch von dem Phänomen, das Jetzt-Erblicktes und Jetzt-Phänomen ist, zu dem vergangenen Phänomen als erblickt gewesenem zurück; er geht aber auch zu

1 Eine Setzung geht auf a und b und ist mehr als Setzung von a und von b. Alles, was in die Einheit einer Setzung eintreten kann, gehört einem Bewusstsein an. 2 Das bedarf aber der genaueren Bestimmung. Cf. Kolleg über natürlichen Weltbegriff 1910/11, 44 ff. = Husserliana XIII, Beilage XXVI (S. 219).

114

5

10

15

20

25

30

35

40

zur intentionalität der objektivation

dem vergangenen Hintergrund des gewesenen Phänomens über und bringt in einen Blick die Erinnerung, was nicht aktuell erblickt war, und erfasst die Möglichkeit, dass das hätte „damals erblickt sein können“, obschon es nicht erblickt war. Der Blick der Schauung, der identischer schauender Ichblick ist oder in getrennten Akten doch ein Identisches „enthält“, ist genauer besehen gegenwärtigender, „wahrnehmender“ Blick, Blick in die Gegenwart, aber auch Blick in die Vergangenheit. Der „Blick“ des reinen Ich, die „reine Apperzeption“. „Blick“ in die unmittelbare retentionale Vergangenheit oder Blick in die „wiedererinnerte Vergangenheit“, Blick in die Zukunft, Vorblick, der wieder anders ist. So der Blick auf die „ P h ä no m e n e “, die wieder ihre „Zeit“-Ordnung und Zeiterstreckung haben, sie sind „jetzt“, „vergangen“, künftig. Aber „derselbe Blick“ geht wie von Phänomen zu Phänomen, z. B. von diesem Undeutlichkeitsphänomen (des visuellen Hintergrundes) zu jenem oder vom Übergangsphänomen des Blickübergangs zu jenem Blickübergang etc., so von dem Phänomen über zu dem, w a s in ihm als Dingphänomen etwa erscheint. Das Undeutlichkeitsphänomen ist, sagen wir, Phänomen von einer Uhr, ich achte aber auf, blicke aber auf das Phänomen selbst, das immer wieder ein anderes ist, wenn ich das Auge darauf richte, es in Deutlichkeitsphänomene überführe. Andererseits wendet sich nun der schauende „Blick der ‚reinen Apperzeption‘ “ (des reinen Ich) darauf, dass das Phänomen und jedes Phänomen dieser Reihe und der kontinuierliche Übergang vom „undeutlichen“ Phänomen zum deutlichen immerfort Phänomen von der einen und selben Uhr ist, die bald deutlicher, bald weniger deutlich „erscheint“. Derselbe Blick geht über vom „Phänomen“ selbst zu dem in ihm Erscheinenden. Das, was vorhin Anlass gab, von einer Identität im Blick (reines Ich) zu sprechen, besteht hier fort. Ebenso in der Erinnerung und Erwartung, ebenso aber auch bei den „Denkphänomenen“, der Blick richtet sich auf das vage Vorgestellte, auf das logisch Gedachte anstatt auf das „leere Vorstellen“, auf das Phänomen des Leervorstellens, oder auf das Phänomen des Aussagens, wie es da abläuft, oder auf das Phänomen des Begründens etc. Das wäre soweit alles gut: Aber wie zeichne ich von vornherein den B e g r i f f de s P hä n om e n s aus? Brauche ich da nicht schon eben diesen Gegensatz zwischen Phänomen und dem, was im Phänomen „bewusst“ ist? Die Frage ist also, w i e f än g t e i ne a bs o lu t e B e t ra c ht u ng an , d i e wir k li ch ni c ht s v or a u s se tz t und an die Grundunterschiede führt? Und was heißt das für eine ab s o lu te B e tr ac h tu n g: „ n i ch ts vo r a us s e tz t “, und was heißt „absolute Betrachtung“ selbst? Anheben mit der phänomenologischen Reduktion, das heißt schon anheben mit dem betreffenden Unterschied zwischen Erscheinung und Erscheinendem usw.

beilage viii

115

Gibt es da einen anderen Weg als den, vom natürlichen Bewusstsein auszugehen, die skeptische Betrachtung durchführen, dann zu den Reduktionen übergehen, da s r e i n e P h ä n om e n u n d d a s r ei n e Ic h, den „Blick der Schauung“ postieren? Das „ Ic h “, das r ein e Ic h , s e tz t d as P h än o m en 5 u n d se t z t s ic h se l bs t. Alle Skepsis, sagt man, setzt voraus, dass etwas außer allem Zweifel verbleibt. W as is t di e Gr e nz e d e s Zw ei fe ls: das „Ich“ als re in es Ic h u n d se in F e ld v o n P hä no m e n e n und alles, was darin zur selben reinen Gegebenheit zu bringen ist wie das Ich und seine Phänomene?

II. ZUR ANALYSE DER EXPLIKATIVEN UND PRÄDIKATIVEN SYNTHESEN UND IHRER FUNDAMENTE

Nr. 8 5

10

 Di e Un te r schi e de u nd Ve rhä l tni sse zwi sch e n Ex p l ika ti on , b ez i ehe nde r S y nt h e s is u nd Prä di ka tio n 1 2

§ 1. Partialerfassungen auf dem Grund einer Gesamterfassung. Das Im-Griff-Behalten des thematischen Ganzen. Das Sondererfasste kann selbst zum Thema werden 1) Schlichte Erfassung eines Dinggegenstandes. Es mögen an ihm schon einzelne Teile oder Momente gehoben sein, aber sie sind nicht erfasst für sich.

1 September 1911, zweite Hälfte. – Neue, außerordentlich sorgfältige und durchaus auf strenger Intuition gegründete Überlegung. Vgl. weiter unten Πλ = Text Nr. 10: Die Weisen der Erfassung und ihrer Synthesis (S. 175). 2 Es scheint mir, dass ein wichtiger Mangel der Ausführungen in diesem Stück ist, dass ich nicht von vornherein das begreifende Erkennen, das überhaupt erst das Urteilen macht, in Betracht gezogen habe. Es muss genau erwogen werden, ob nicht alle Unterschiede, die ich tatsächlich zwischen Explikation und Prädikation machte, im Verborgenen voraussetzten, dass Erkennung statthat, die allein urteilsmäßige „Bestimmung“ ausmacht. Die sinnliche Bestimmung in der Klarlegung des sich explizierenden Objekts bereichert dieses, fügt ihm Klarheiten ein, und zwar auch solche, die es nicht gehabt hat, es bereichert seinen sensuellen Sinn, aber denkmäßig bestimmt sich das Objekt als Erkenntnisobjekt, also durch Erkennung. Das als a Erkannte wird dann neu erkannt, das ist, eben prädikativ erkannt als b, und das ist das Erste für alle weiteren Urteilsbildungen. Das τ ς wird zum ποιν.

© Springer Nature Switzerland AG 2020 117 U. Melle, T. Vongehr (Hrsg.), Studien zur Struktur des Bewusstseins, Husserliana: Edmund Husserl – Gesammelte Werke 43-I, https://doi.org/10.1007/978-3-030-35788-7_2

118

5

10

15

20

25

30

35

explikative und prädikative synthesen

2) Übergang in Partialerfassungen. Das erste, das schlichte SichZuwenden und Ergreifen ist eine Spontaneität, ebenso sind die Partialerfassungen spontane „Tätigkeiten“. Wenn ich aber die Partialerfassungen übe, so ist mit der schlichten Erfassung eine Veränderung vorgegangen und in verschiedener Hinsicht. Was uns hier interessiert, ist, dass sie kein Erfassen mehr ist, kein Ergreifen, sondern ein gewisses phänomenologisch wohlunterschiedenes Behalten. Wenn ich schlichte Erfassung übe ohne Partialbetrachtung, zum Beispiel, wenn ich einem einfachen Ton eine Weile erfassend zugewendet bin, ohne an ihm etwas zu unterscheiden, oder einem undeutlichen Objekt im indirekten Sehen, das ich eine Weile geistig fixiere, ehe ich Unterschiede finde und finden kann (ich wähle solche Beispiele, weil bei deutlichen Objekten sehr schnell das schlichte Erfassen in Explizieren übergeht), so haben wir ein dauerndes Erfassen als eine dauernde Spontaneität. Ich bin dauernd, wird man vielleicht sagen, „aufmerksam“ auf das Objekt, ohne in Aufmerksamkeit auf die Teile überzugehen. Nun, dann ist dieses Aufmerken die Spontaneität. Wenn ich nun in Partialbetrachtung übergehe, so lebe ich im Einzelnen, ich erfasse dieses spontan, das Ganze aber erfasse ich nicht mehr in dieser Weise, aber habe es noch im Griff. Dieser Griff ist ein dauernder, ruhender Zustand und nicht ein Greifen. Genau besehen kann man hier noch Unterschiede machen. Der Griff kann mehr oder minder fest sein, er kann fest sein und sich lockern, wohl auch locker sein und wieder fester werden, und er kann aufhören, und das Objekt schlüpft aus dem Griff. Man wird natürlich auch in dieser Hinsicht geneigt sein, von verschiedenen Graden der Aufmerksamkeit zu sprechen, aber es handelt sich nicht um Worte, sondern um Beschreibung von Phänomenen. Wenn ich ein sehr „interessantes“ Objekt erblicke, eine seltene Geige (ich bin Liebhaber) etc., so betrachte ich sie mit „konzentrierter Aufmerksamkeit“. Auf das ganze Objekt bin ich fest gerichtet, ich habe es erfasst und halte es ganz erfasst. Während ich die Einzelheiten besonders erfasse, die schöne Schnecke, den Lack, die Rundung des Rückens usw., vollziehe ich immer neue spontane Zuwendungen und Erfassungen, die ihre Vorzüglichkeit haben und das Erfasste vorzüglich hervortreten lassen. Das momentan nicht partial Erfasste, aber eben erfasst Gewesene, wird dabei „behalten“?

text nr. 8

5

10

15

20

25

30

35

119

Es fragt sich, ob man das sagen kann bzw. in welchem Sinn man es sagen kann. Und wieder, was uns hier noch vorher interessiert, fragt es sich, wie es sich dann mit dem Gesamterfassen, dem Erfassen der Geige, verhält. Die ist es doch immer, die ich „betrachte“. Muss man nicht sagen, dass die Geige immerfort erfasst bleibt, dass ich ihr erfassend immer zugewandt bin und dass sich mit dieser Erfassung die Partialerfassungen „decken“, derart, dass ich nicht nebeneinander Erfassungen übe, sondern so, dass ich in der Partialerfassung zugleich das ganze Substrat erfasse, sofern es den „Teil“ übergreift und in diesem Übergreifen bewusst ist? Das alles ist gut. Aber der Unterschied ist nicht zu übersehen, dass in der ersten Erfassung des Ganzen, mit noch „unverteilter“ Partialspontaneität („Aufmerksamkeit“), ein Strom der Spontaneität sozusagen auf das verworren-einheitliche Objekt ging, und ebenso, wenn die explizierende Betrachtung inszeniert ist, ein ebensolcher Strom originärer Spontaneität auf die betreffenden „Teile“ im Fluss der betreffenden Partialerscheinungen geht. Dagegen verbleibt nun nicht etwa ein Strom solcher urquellender Spontaneität gerichtet auf das „Ganze“. Sie hat sich offenbar verändert. Wenn es heißt, wir bleiben erfassend auf das ganze Objekt gerichtet, es sei ja gerade das Objekt der Betrachtung, so ist es nicht ein Verbleiben der spontanen Erfassung in der ursprünglichen und ursprünglich lebendigen Form. Die ursprüngliche Erfassung verwandelt sich in Substraterfassung bzw. thematische Erfassung, wie ich es sonst auch nannte. Das Phänomen ist dem Allgemeinen nach dasselbe in den Fällen, wo wir uns einem Objekt in spontanem Erfassen zugewandt haben und dann zu einem anderen (und ihm nicht als Teil Eingeordneten oder als Ganzes Übergeordneten) in gleicher Zuwendung übergehen, ohne unser erstes Objekt aus dem Griff zu lassen (also hinzunehmen und zusammennehmen, wobei anderes erblickt sein kann, aber nicht als Thema erfasst ist). Es handelt sich nicht um ein bloßes Phänomen der ursprünglichen „Erinnerung“, des noch im Bewusstsein Bleibens, obschon auch das statthat. Denn es ist zweierlei: „noch bewusst haben“ in dem Sinn des Perzipiert-Habens und noch Erscheinens und Noch-im-Griff-Haben, Noch-Halten. Ich kann meine Aufmerksamkeit abwenden, ohne festzuhalten. Es kann das Objekt dabei sich noch stark abheben: aber es ist nicht

120

5

10

15

20

25

30

35

explikative und prädikative synthesen

nur nicht originär erfasst, sondern auch nicht „noch im Griff“. In jedem zusammennehmenden Erfassen (auch wenn es nicht ein Perzipieren ist im Sinn eines Dingwahrnehmens, woran wir jetzt immer gedacht hatten) haben wir eine Folge von originären Erfassungen, wobei eine Einheit des Bewusstseins erwächst, in welcher bei jedem Schritt eine originäre Erfassung verbunden ist mit solchen Nochim-Griff-Behaltungen. Und schließlich kann eine Zusammenhaltung übrig sein, nachdem die letzte originäre Erfassung auch in Behaltung übergegangen ist, die kein Originärglied mehr enthält und doch Zusammenfassung ist. Der „Vollzug“ der Zusammenfassung besteht in diesem Prozess (und das Ende ist eine dunkle Zusammenfassung). Doch muss noch unterschieden werden dieses Festhalten im Griff und das Festhalten im Thema, wie schon in der spontanen Zuwendung und Erfassung die Erfassung überhaupt und die Erfassung als Thema. Gehen wir nun wieder zurück zum Fall der Explikation, der Betrachtung eines Gegenstandes in Prozessen der Einzelerfassung, der explizierenden „Kenntnisnahme von ihm“. Das Ganze verbleibt also im Griff, während die ursprünglich spontanen Erfassungen der Teile aufeinanderfolgen. Es ist aber zu bemerken, dass es auch dem Griff entschlüpfen kann: Das heißt, es wird nicht mehr festgehalten, ein „eigenes Interesse“ geht dann auf den Teil, der nun nicht mehr als Teil erfasst ist. Bei der Betrachtung des Gegenstandes ist, sagten wir, im Sondererfassten das Ganze expliziert. Nennen wir das Sondererfasste, sofern es hier in der Explikation des Ganzen erfasst ist und eigentlich in ihm das Ganze in der betreffenden Besonderung erfasst ist, das „Explikat“. Sowie das Ganze nicht mehr Thema ist, aus der thematischen Erfassung herausrückt, verliert das Sondererfasste den Charakter des Explikats und wird selbst zum Thema oder zum Erblickten. Dabei ist aber wohl zu beachten, dass ganz wohl die Einheit des Ganzen auch ohne Erfassung bewusst sein kann und seine besondere Abhebung besitzen kann gegenüber dem sonstigen Hintergrund. Und eine Deckung besteht immerfort: Der aktuell erfasste Teil ist zwar nicht als Explikat oder als Teil, nämlich auf dem Untergrund der Gesamtfassung erfasst, aber die auf ihn bezogene Erfassung greift etwas heraus, was einer umfassenden Auffassung, einem umfassenden Erscheinungsganzen eingeordnet ist, und wenn die Partialerfassun-

text nr. 8

121

gen fortschreiten, so bewegen sie sich auf dem Grund einer einheitlich abgehobenen Erscheinung, in der das ganze Objekt erscheint, das aber nicht erfasst ist. Endlich scheint es, dass wir auch Unterschiede des fester und lockerer Im-Griff-Habens unterscheiden müssen, wie 5 schon oben gesagt.

§ 2. Das Fungieren der Partialakte im Prozess der Kenntnisnahme. Die Bereicherung der Gesamtobjekterfassung durch die Einzelerfassungen. Die explikative Synthesis als Grundlage der Prädikation 10

15

20

25

30

35

Nun ist es aber ein Problem, zu verstehen, wie in der Folge der gegenständliche „Kenntnis“ gebenden Partialakte, der explizierenden (die gegenständliche Intention der Totalvorstellung schrittweise erfüllenden), die Partialakte eigentlich fungieren, und wie es mit dem „Im-Griff-Bleiben“ ihrer originär erfassten Objekte nach der Erfassung sich verhält. In gewisser Weise ist dies natürlich der Fall. Der ganze Prozess der Kenntnisnahme ist eine „Einheit des Bewusstseins“ (der Prozess der Betrachtung ist Prozess der Kenntnisnahme insofern, als dadurch als Ergebnis Kenntnis gewonnen wird: bleibende Kenntnis, Dispositionen zur Erinnerung solcher expliziten Vorstellungen in der Erinnerung, Aussagen darüber etc.). Es ist aber zu beobachten, dass im einfachen Fortlaufen des Betrachtens nicht besondere Zusammennehmungen die herausgehobenen Teile oder Eigenschaften des Objekts verbinden. Wäre aber ein In-jedem-Schrittdas-originär-Erfasste-des-vorigen-Schritts-Festhalten nicht soviel wie schrittweise Zusammennehmung üben oder Zueinanderhinzunehmung? Es ist ja ein Unterschied, notierend, aufzählend zu sagen „S ist p, q, r …“ und „S ist (p und q …), ist all das zusammen“. Man wird sagen müssen, dass Zusammennehmung erfolgen kann, aber im Allgemeinen nicht zur Explikation gehört, und dass das Zurückbehalten, das ihr zugehört, nicht eigentlich ein Festhalten im erfassenden Sinne ist. Bildlich kann man sagen, die in der stetigen Gesamtbehaltung (der thematischen) des ganzen Objekts enthaltene Objektauffassung hat all die herausgehobenen Einzelheiten in sich aufgeschluckt, bzw. das Im-Griff-Haben des in Explikation stehenden Objekts ist nicht ein Im-Griff-Haben desselben, „so wie es“ vor

122

5

10

15

20

25

30

explikative und prädikative synthesen

der Explikation bewusst war, vielmehr so, wie es mit jedem neuen Schritt bewusst ist, und das ist es verschieden. Oder: D e r Gr i ff d es G esa mt ob jek t s ist ei n so l c her , d e r in j ed e m S ch ri t t d as ei nz el n E r gri f f en e i n sic h au f ni m m t. Die Einzelergreifungen verwandeln sich nicht in festhaltende Einzelgriffe, sondern in Modifikationen des Gesamtgriffs, in Bereicherungen seines Inhalts.1 Die Erfassung des Ganzen, die ein Erfassthaben ist, ist also immerfort in Bewegung, und immerfort findet eine Synthese statt, eine „Deckung“ nach Auffassung und nach den Zuwendungen. Die Hinwendung auf das Ganze und die Hinwendung auf den Teil, hier originäre Erfassung des Teils, sind einander nicht äußerlich. Und die Partialerfassung erfasst das Ganze „nach diesem Teil“ in diesem Explikat, nämlich sofern sie eben nicht bloße Einzelerfassung ist, sondern in dieser eigentümlichen Weise auf dem „Grund“ der Gesamtobjekt-Erfassung (-Haltung) statthat. Und man kann auch sagen, in dieser Deckungseinheit, die Deckungseinheit insofern ist, als die Partialerfassung doch ein neuer spontaner „Akt“ ist, der sich mit dem bisherigen Gesamterfassen deckt, geht die Sache so zu, dass der unbestimmte, ungeklärte, unverdeutlichte Teil, eine eingeschmolzene Komponente der Gesamtintention des zu explizierenden Gegenstandes, mit dem eben Bestimmten, durch die Partialerfassung Herausgezogenen, -gehobenen sich deckt: Aber sie bleiben nicht zwei und sind nicht zwei kongruente Sachen, sondern das unbestimmte Ganze erhält anstelle des Unbestimmten, Unabgegrenzten, vage Eingewobenen den bestimmten und eventuell klaren Teil, der nun umgeben ist von dem Medium der sonstigen Unbestimmtheit des Noch-nicht-Bestimmten. S o wi r d da s G a nz e in j ed e m Sc h r itt e i n a n de r s B e wu ss t es, es erhält explikative Bestimmtheit innerhalb des Mediums der Unbestimmtheiten, und in dieser Weise ist da s B e wu s s ts e i n d e s G an z e n e i n so l c he s , d a s i m me r

1 Vielleicht sagt man auch so, es gibt zweierlei Modifikationen des spontanen Ergreifens. Die erste besteht darin, dass kein Ergreifen mehr statthat, aber ein Im-GriffFesthalten: Das Erfasste ist noch erfasst, aber in anderer Weise. Die andere besteht darin, dass kein Erfassen mehr statthat und Erfasst-Verbleiben, sondern ein Haben des Erfassten ohne Erfasstsein, ohne Im-Griff-Sein. Und die ermöglicht und macht aus die Bereicherung des Inhalts des ganzen, immerfort ergriffenen Objekts.

text nr. 8

5

10

15

20

25

30

35

123

n eu sic h be reic her t , n äml i ch d u rc h D e ut l i ch ke i ts pa rt i e n , d u rc h S on d er u nge n i nn erh alb d es Me di um s d er „ V er w o r renh eit “. Andererseits ist bei diesem Prozess das Bewusstsein vom Ganzen immerfort Bewusstsein von demselben Gegenstand, es waltet durch die „Einheit gegenständlicher Beziehung“. Den Prozess dachten wir so: Eine originäre Zuwendung und Erfassung geht auf G und dann folgen einander die verdeutlichenden Explikationen, Partialauffassungen. Dem entspricht prädikativ das „G ist α, β, γ …“. Aber ist das wirklich schon die Sachlage, die, wenn wir von der Schicht der Begrifflichkeit absehen, zu diesem Prädizieren gehört? Das ist nun die große Frage. Zunächst sieht man, dass hier doch Unterschiede sich aufdrängen. Wenn ich voll eigentlich vollziehe „Das Tintenfass ist aus Messing, gelb glänzend, hat eine Untertasse …“, muss ich da nicht sagen „Das Tintenfass ist aus Messing, ist gelb glänzend“, „G ist a, ist b, ist c“, und werde ich da nicht gezwungen, auf das G, während ich es in stetigem Erfassen halte, immer wieder zurückzugehen, es in neuen originären Erfassungen zu erfassen? Natürlich. Natürlich habe ich keine Trennungen, also nicht etwa „G ist a, G ist b, G ist c“. Das kann ich auch haben, und wenn das G fortdauernd erscheint, so wird eine Einheit hergestellt, eben durch diese „Identität“ der Erscheinung. Etwas anderes ist es aber, wenn ich G originär erfasse und nun an ihm das a explizierend erfasse, wenn ich, das als a bestimmte G festhaltend (im Griff haltend), eine neue originäre Erfassung G vollziehe, wodurch kontinuierlich einheitlich das jetzt originär Erfasste (als a bestimmte G) und das soeben im Griff Gefasste sich decken. Und nun wird eine neue Einzelerfassung geübt usw. Dabei ist nicht zu verwechseln: Da s wi e d e rh ol t e r fa s s t e G erf a s st zw a r d a s G , d a s s c h on a l s a v e rd e ut li ch t i s t , a be r e s er f ass t n ich t G a t t r ib u t i v, „G, welches a ist“, das heißt, es wird nicht G in Bezug auf das in einem Erfassen vorstellige a erfasst, in einem komplexen Akt, der eine eigene Festhaltung des a impliziert. Das ist vielmehr eine neue Sache. Nun bleibt es aber (nach der oben gegebenen Darstellung) offen, dass, wenn eine einfache Explikation des G statthat (ohne Rückkehr zu erneuten ursprünglichen Erfassungen des G), dass der erste Schritt der Explikation, der das erste Bestandsstück des G zur par-

124

5

10

15

20

25

30

explikative und prädikative synthesen

tialen ursprünglichen Erfassung bringt, zugleich diejenige Synthesis darstelle, die in ausdrücklich-begrifflicher Fassung sich ausspricht als „G ist α“ oder „G hat α“. Ohne hier in Näheres des Wesens der Prädikation und des Sinnes des „ist“ und „hat“ einzugehen, sehen wir doch bald ein, d as s s o lc he Sy nt he s i s h ie r no ch n ich t v or li egt. Oder eine Synthesis liegt zwar vor in einem gewissen Sinne, aber n i c h t s ch on völ l ig das, was zum prädikativen Zusammenhang erforderlich ist, n ic ht di e präd ik at i ve S yn th es i s. Freilich, hier bedarf es großer Vorsicht, und ich spreche mit allem Vorbehalt. Vertiefe ich mich intuitiv in eine volle, eigentliche Prädikation, so besteht sie ja nicht darin, dass ich mit der Subjektsetzung anfange, „ist“ sage und mich dann umsehe, was sich wohl als Prädikat ergeben möchte. Da hätte ich ja eine indirekte Vorstellung von einem zu Prädizierenden im Voraus. Sehen wir natürlich davon ab, so ist es klar, dass ich prädizierend jene „Synthese“, von der wir oben gesprochen haben, schon vollzogen habe, dass sie zugrunde liegt. E r st s e he n w ir un s d e n G e g en s t an d a n , „ b et r ac ht e n “ i hn , und d a nn p rä d i z i e r e n w i r : A u f g run d d er dur c h d i e B et r ac ht un g e r l a n g t e n Ke n n tn i s v o l l z ie h e n w i r ur t ei l en de E r ke nnt ni s. Bei der „Betrachtung“ vollziehen wir die G-Erfassung und, das G festhaltend, vollziehen wir „im Rahmen“ des G die Partialerfassung. Wir können sagen, die Partialerfassung, Explikaterfassung, fasst herausgrenzend, was bloß implicite im G-Erfassen schon erfasst war und immerfort erfasst bleibt. Das ist wichtig. Es stehen sich nicht zwei gesonderte Erfassungen gegenüber, um sich dann zu decken, sondern in die eine schießt die andere hinein.

§ 3. Der Übergang von der Explikation zur Prädikation. Die Prädikation als Wiederholung des explikativen Prozesses in geänderter Einstellung. Die prädikative Synthesis als schöpferische Erzeugung des Sachverhalts. Die Sachverhaltsreflexion

Nun ist die Frage, was die Erfassung „G ist α“ eigentlich hereinbringt. Und hier ist auch die Stelle, um sogleich den wichtigen 35 Unterschied geltend zu machen zwischen dem Ist-Inhalt, G ist α,

text nr. 8

5

10

15

20

25

30

125

und dem entsprechenden Relationsinhalt (der aber auch ein Beschaffenheitsinhalt ist),1 G hat T. G ist weiß. G hat Weiße. G ist Ganzes von „weiß“ als Teil. Ich fühle mich darin gar nicht sicher. Aber die bisherigen Analysen dürften uns schon geholfen haben. Ich habe immer von „Partialerfassung“ gesprochen: Ist das wirklich Erfassung des Teils? „Objektiv“ ja. Die Weiße ist ein Moment am Gegenstand, und gerichtet bin ich in der Explikation auf das Moment. Aber „Teil“ drückt eine kategoriale Form aus, und der Teil ist als Teil nur erfasst im artikulierten synthetischen Relationsbewusstsein: T ist Teil von G und G umfasst T, T ist in G, G hat T. In der Explikation betrachte ich das Papier, und in dieser Betrachtung bin ich auf das Papier gerichtet als Substrat, und „innerhalb“ dieser Richtung erfasse ich das Weiß:2 Es wird nicht für sich, sagte ich, zum Gegenstand, sondern es ist Verdeutlichung, Explikat des Gegenstandes, das heißt, in ihm betrachte ich den Gegenstand, ihn verdeutlichend, ihn nach einer Sonderheit erfassend, aber in ihr eben den Gegenstand erfassend nur „nach“ dieser Sonderheit, oder vielmehr den Gegenstand als so sich verdeutlichend, sich bestimmend. Gerichtet bin ich dabei auf den Gegenstand und diesen „Teil“ am Gegenstand in eins und ungeschieden; aber nicht gerichtet auf das „Sein“, auf den Sachverhalt „G ist weiß“: in seiner artikulierten und sozusagen auseinandergelegten Einheit. Sollen wir also sagen, dass e t w a s N e ue s eintritt? Z ue r st f än de E x p li ka t i on st a t t u nd da n n e i n e n eue E i ns te l l ung , ei ne n e ue R ic h t u ng a u f d a s , wa s du r c h d i e E x pl i ka ti on ko nst i t u ie r t i s t? Und die Frage ist, ob das Neue Sache des Ausdrucks ist und der begrifflichen Fassung. Nun, die Worte, Wortlaute können wir lassen. Also kommt dann in Betracht die Dies-Setzung oder SubjektSetzung des G und die Setzung des Weiß nicht als Setzung eines „Gegenstandes für sich“, sondern als „Bestimmung“. Der „Blick“ richtet sich, wird man sagen, auf das G, das als das durch die Explikationsbewegung als weiß Bestimmtes bewusst ist und in der Wieder-

1

Hinter den in Klammern stehenden Satzteil hat Husserl später ein Fragezeichen gesetzt. – Anm. der Hrsg. 2 Gute Ausdrücke sind „Explikand“, „Explikat“.

126

5

10

15

20

25

30

explikative und prädikative synthesen

holung dieses Übergangs auf die Einheit, auf das „Identische“, auf das „Ist“, in dem das explizierte G sich mit dem Explikat identifiziert: und das kommt in der Prädikation zum Ausdruck, zur begrifflichen Fassung. Was besagt das aber, der Blick richtet sich? Habe ich nach erster Ausführung der Explikationsbewegung ein Resultat, etwa ein Ganzes? Nun, das Ergebnis ist das „im Weiß verdeutlichte Objekt“. Das Weiß ist das, was im vollen Licht steht, was im besonderen Sinne erfasst ist, aber auf dem Grund der Richtung auf das Papier, das, soweit es mehr ist als das Weiß, nicht im vollen Licht steht. Auf das „Ergebnis“ bin ich eo ipso gerichtet, eben indem ich auf das Weiß hinsehe und es in dieser Weise, am Ende dieses Prozesses gegeben habe. Aber ich kann nun die „Aufmerksamkeit“ auf das Ganze (G) richten und es ins Licht setzen und darin liegt, das Ganze (G) in neuer Spontaneität erfassen, ihm eine neue spontane Zuwendung zukommen lassen: Aber das Ganze (G) ist nicht das Ganze vor dem expliziten Prozess, sondern nach ihm: Das Weiß ist lebendig erfasst auf dem Grund der vorangegangenen G-Erfassung, die in der lebendigen Weiß-Erfassung noch als Griff da ist und mit ihr sich „deckt“, und so gehe ich vom Griff in ein neues Ergreifen über, während das lebendig erfasste Weiß in den Griff übergeht. Kann ich also etwa sagen: Das Resultat der Explikation ist ein Ganzes, etwa ein synthetisches Ganzes, das ich nun „analysiere“, also expliziere? Das doch natürlich nicht.1 Wenn ich eine Explikation vollzogen habe, eine durchlaufende Gegenstandsbetrachtung, so kann ich auf den Prozess zurückschauen, einen schlichten Blick darauf werfen, ihn zum Thema einer Explikation machen. Auf den Prozess: das Nacheinander, in dem zuerst das schlicht erfasste G steht, dann das verdeutlichende Erfassen des α in G usw. Die Einstellung ist also ontisch. Und die Explikation dieser sukzessiven Einheit erfolgt im Durchlaufen der Sukzession, also im Erneuern der Explikation „in der Erinnerung“.2 Aber Explikation ist Explikation. Und was hier zur Wiederholung der Explikation in der

Das wäre ja ein unendlicher Regress, wie ich auch folgende Seite = S. 127,30–32 sage. 2 Besser darstellen. 1

text nr. 8

5

10

15

20

25

30

35

127

Erinnerung hinzutritt, ist, dass sie selbst als explizierend auftritt für die schlichte thematische Erinnerung an die Explikation. Aber das geht uns hier nicht an. Nicht um dieses Resultat der ursprünglichen Explikation handelt es sich, nicht um den Prozess, der in ihr sich konstituiert. Worauf blicke ich also, wenn es sich mir, nachdem der betrachtende Blick von G zu α, vom Papier (in der schlichten Erfassung) zum „weiß“ gegangen ist, darum handelt auszusagen „G ist weiß“? Ich blicke nicht auf das Nacheinander des Prozesses zurück. Blicke ich etwa1 auf das Ineinander, auf die Deckungseinheit, die sich in ihm konstituiert? Aber wie das? Blicke ich auf den Prozess zurück, aber nicht er interessiert mich überhaupt, nicht ihn mache ich zum Thema, sondern nur die in ihm und durch ihn sich konstituierende Einheit der Deckung zwischen „G“ und „α“, die im Endpunkt konstituiert ist, aber nicht Thema ist? Aber man wird hier seine Bedenken haben dürfen, wenn das besagen soll, dass ohne „Wiederholung“ des Prozesses und ohne geänderte Einstellung bei dieser Wiederholung ein schlichter Blick zurückgeht und Deckungseinheit in schlichter Weise erfassen sollte. Man kann doch nicht sagen, dass die angeblich schlicht erfasste Deckungseinheit zum Thema wird, dass sie Explikation erfährt in dem Sinn, wie die Erfassung des Papiers als Gegenstand, als Substrat, das Thema gibt für die weitere Explikation in „weiß“, „viereckig“ usw. Das zeigt sich ja auch daran, dass jede Explikation sich „entfaltet“ in Prädikation, wobei das Explikationssubstrat zum Subjekt wird und die Explikate zu Prädikaten. Die angeblich schlicht erfasste Einheit aber, die hier übergeführt werden soll in die entfaltete Einheit eines Sachverhalts, wird nicht zum Subjekt und die Sachverhaltsbestandstücke zu Prädikaten. Aber ist dann so etwas wie Erfassung einer schlichten Einheit nachweisbar? Wäre sie schlicht erfassbar, dann wäre ja die Auseinanderlegung Explikation und es drohen unendliche Regresse. Ich muss also wohl einerseits sagen: I c h v e r bl e i be ni c ht i n d e r b loß e n Ex p l i ka t i on , e s g e sc h ieh t e t w a s Ne u e s; und andererseits ist sicher: Der Blick wendet sich zu der verborgenen

1

Cf. 7a = S. 128,20–130,15.

128

5

10

15

20

25

30

explikative und prädikative synthesen

Einheit, die Einheit, konstituiert im Prozess, der beiden Glieder ist. Aber dieser Einheit sich zuwenden, das heißt, in geänderter Einstellung den Prozess erneuern. Sie ist nichts, was in einer schlichten Zuwendung erfasst werden, sondern nur im wiederholten Durchlaufen in den Blick treten kann. Das wiederholte Durchlaufen findet, sagte ich, unter geänderter Einstellung statt: I c h vol lz i ehe n ic h t w i e der ei ne b l o ß b e tr a c h t en d e E xp li k at i on , so nde r n ei n e p räd ik at ive Id ent i f i ka t i o n, und das ist ei n e rfa s s en des B ew us st sei n sy nt h et i sc her Art. Synthetisch vollziehe ich die Erfassung von G, und sie dient als Subjektion: Von ihr geht ein bestimmendes „Identifizieren“ zu weiß. Der erfassende Blick lebt im Identifizieren, im Erfassen des Ist, im Erfassen des Sich-Bestimmens als weiß. Im Explizieren bestimmt sich das Objekt implicite als weiß, nämlich es verdeutlicht sich, aber das „Sich-Bestimmen-als“ ist nicht erfasst. Erfassend im Blick sich bestimmen kann nur, was explikativ schon bestimmt ist. Das originäre Erfassen von „G ist weiß“ setzt die Explikation voraus, und das als weiß explizierte G erhält die Funktion des Subjekts und ist der notwendige Anfang für den prädikativen Prozess, der nur verlaufen kann in der Form „G ist α“. Danach ist das Erfassen des G jetzt ein anderes als vorhin. Allerdings darf man nicht zuviel Wert darauf legen, dass das G von vornherein als „weiß Seiendes“ an der Spitze einer Wiederholung steht, obschon das wahr ist. Denn wenn wir bloß die Explikation wiederholen, ohne Prädikation zu vollziehen, würde sich das ebenso verhalten, und wir hätten noch keine Prädikation. (Man wird natürlich nicht verwechseln das als weiß verdeutlichte G und das attributiv aufgrund einer Prädikation aufgefasste G, welches weiß ist.)1 Ein Zweifel: Wenn wir wiederholte Explikation vollziehen desselben Inhalts, so vollziehen wir immer wieder das Deckungsbewusstsein, in dem sich doch die Einheit konstituiert. Warum sollte da nicht schlichte Reflexion möglich sein auf die Einheit? Man kann antworten: auf welche Einheit? Natürlich kann ich im schlichten Blick

1 Das explikativ Verdeutlichte steht als Verdeutlichtes da und wird zum Subjekt der prädikativen Bestimmung. Dann aber ist es wieder als prädikativ Bestimmtes charakterisiert, und vollziehe ich vermöge neuer Explikationen neue Prädikationen, so kann ich „G, welches α ist”, oder Gα als Subjekt bilden. Wiederholt cf. 6a = S. 126,21–128,19.

text nr. 8

5

10

15

20

25

30

35

129

auf die Verdeutlichungsübergänge gerichtet sein und kann sich dem Blick die Einheitsform dieses Übergangs aufdrängen (genau so, wie sich im wiederholten Übergehen von einem Ton zu einem anderen, einem leiseren zu einem lauteren, die Form, die Form der Steigerung leiser – lauter, aufdrängen kann und vorher schon das gesamte „a leiser – b lauter“, der konkrete Übergang vom leiseren zum lauteren Ton in seinem Typus vermöge dieser Form). Aber auf diese Form, auf den Formcharakter eingestellt sein ist nicht, die bestimmende Synthese vollziehen (die natürlich keine Explikation des Übergangs in die Form ist). Ich setze G und bestimme es als weiß: G ist weiß. Und das Ist ist nicht eine bloße Form, die zwei Sachen in eins setzt, die Form in jenem Übergang ist Form der Phänomene, des Phänomens des zu Explizierenden, des Explikanden-Phänomens, und des ExplikatPhänomens. Gesetzt ist aber in der Prädikation das G und die Bestimmung (die als solche ihre Form hat). Das G muss expliziert bewusst sein, aber gesetzt ist es schlechthin als G, das identisch ist, wie immer es expliziert werden mag. Andererseits gehört zu seiner Form, dass es Explikand ist (nicht Explikand-Phänomen), und das „weiß“ drückt das Explikat aus, aber nicht das Explikat-Phänomen. Im Ist kommt die Form der Synthese zwischen Explikand und Explikat zum Ausdruck (und zwar jedes in seiner Form), und sie ist in der Prädikation Bestandstück des ganzen, zur Setzung kommenden „Sachverhalts“. Der Sachverhalt, der im „Urteil“ gesetzt ist (freilich sprechen wir hier nur von der prädikativen Synthese), ist darin ni cht s ch li c hte s , so n de r n s yn t h e t i s c h s i c h e r ze u g end e s un d e r zeu g t es T he ma . Es i s t k e i n Ob j e kt e in es s ch l ic ht be t r a c ht e nde n, s on de r n e i ne s s c h ö pf er i s c h e r ze u g e nde n Ak te s. In der schöpferischen Erzeugung konstituiert es sich schöpferisch und wird so erfasst (schöpferisches Erfassen). Nachher bleibt es eventuell noch „im Griff“. Der Unterschied zwischen spontanem Ergreifen und zuständlichem Im-Griff-Sein besteht auch hier. Ferner kann eine Reflexion statthaben, welche auf den synthetisch erzeugten und noch im Griff seienden Gegenstand einen Blick schlichter Art wirft: eben den Blick der S a c hv e rh a l t sr ef l e x i on. Di es e s „ s ch l i c h te E r f a s se n “ d e s S a ch v e rh a l ts i st a b e r ke i n or i g i nä r e s E r fa ss en , k ei n e G eg e b e nh e i t , e r „ w e i s t a u f e i n o r i g i n ä r e s E r f a ss e n

130

explikative und prädikative synthesen

z u rüc k “. D as gil t f ür a l le syn t h eti sc h s i c h ko ns ti t ui e r e n d en O bj ek t e, was ja nichts anderes sagt als für Objekte, die eine originär synthetische Konstitution haben. Wie steht es bei ihnen mit der Explikation? 5 Jede Explikation erfordert Rückgang auf originäre (artikulierte, nicht „anschauliche“) Konstitution, und originäre Konstitution lässt eine Einstellung der „schlichten“ Objektivation zu, welche, auf sie zurückbezogen, die Teile und Momente „explizierend“ entnimmt. Ich wiederhole etwa „S ist p“ und habe schon bei der Wiederholung die 10 Einstellung auf den Sachverhalt als „schlichtes“ Objekt. Wir sagen da lieber, a l s S u bs t rat. I n d er or i gi nä re n Sa ch ver hal tse r fa ss un g i s t d er S a ch ver hal t n ic h t S u bs t ra t (im Sachverhalt treten Substrate auf), aber in der Reflexion aufgrund wiederholter originärer Sachverhaltserfassung wird er zum Substrat und kann dann 15 expliziert werden. In all dem scheint ein wesentlicher Fortschritt in der Analyse wohl vollzogen zu sein. Aber ist nun alles schon völlig durchsichtig? Verstehe ich schon aus dem Grund das synthetische Bewusstsein in aller einfachen Prädikation?

20

§ 4. Das Verhältnis zwischen prädikativer und beziehender Synthese. Das in der Erfassung und in der Explikation waltende Absehen. Die Analogie mit dem Abzielen und Erzielen im Willensgebiet

Zunächst muss scharf gesondert werden das synthetische Bewusstsein, in dem die Relation zwischen Ganzem und Teil bewusst wird, 25 in dem ein relationeller Sachverhalt sich konstituiert, gegenüber dem synthetischen Bewusstsein, in dem sich ein nicht-relationeller prädikativer Sachverhalt, ein Sachverhalt der Art wie „Dieses Papier ist weiß“ konstituiert. Im G∩T- oder T∩G-Bewusstsein, in den betreffenden Übergängen erhält T bzw. G einen Charakter, es erfährt 30 Bestimmung. Und prädikativ heißt es dann „G hat als Teil T“, „T ist Teil von G“. Besser: „G ist Ganzes von T“. Parallel damit steht „Dieses Papier ist weiß“, „G ist α“ (wo α eine innere Bestimmung ist). Das Teil-von, das Ganze-von sind „äußere“ Bestimmungen, relative. Das Weiß-Sein ist innere Bestimmung und 35 keine relative. Es hängt jetzt alles davon ab, den Unterschied ins

text nr. 8

5

10

15

20

25

30

35

131

Klare zu bringen. Das Gemeinsame ist Bestimmung. Das G erhält in dem betreffenden Übergang eine Bestimmung; das G setze ich, und in dem Bewusstsein der „Identifikation“, des Ist, erfasse ich das Bestimmtsein. (Nämlich das G, als welches es da im Übergangserlebnis bewusst ist, ist das „Bestimmte“, und ich vollziehe nun die „Id e nt if i kat io n“ dieses G mit der B est im m un g.) Ebenso, das Papier wird gesetzt, nämlich die Setzung ist Unterlage einer „Identifikation“ eines Bewusstseins der Ist-Einheit mit der Bestimmung weiß. Nun ist hier das Beirrende, dass man sich gedrängt sieht zu sagen: Das Verhältnis von Papier und „weiß“ ist ein Teilverhältnis. Gehe ich vom auffälligen Weiß, das ich zuerst gegenständlich gemacht habe, über zum Papier, ist das nicht in Bezug auf die Weiße „Ganzes“? Nehme ich damit nicht ein Mehr in meinen Blick auf, ganz ähnlich, wie wenn ich von dem Fuß des Aschenbechers übergehe zum Ganzen? Soll man danach sagen: „Das Papier ist weiß“ hieße soviel wie „D a s Pa p i e r ha t W e i ße“? Wenn aber die Analyse lehre, dass jede Relation, jedes Teilverhältnis auf Prädikatseite eine Bestimmung hat, so ist damit das „größer als b“, „Teil von b“, „umfassend b“ etc. gleichgestellt mit „weiß“, nicht mit „hat Weiße“, nämlich „umfassend als Teil Weiße“. Sonst hätten wir ja einen unendlichen Regress. Das „größer als b“, das „Teil von b“ ist gehabt, ist zukommend, und wäre das Haben ein Teilverhältnis, so wäre auch das „größer b“ ein Teilverhältnis, und wir müssten sagen, auch das „umfasst b“ besagt „hat den Teil ‚b zu umfassen‘ “ etc. In der Tat, nach unseren Analysen liegt das Teil-von-b-Sein am G als Bestimmung, als etwas, das G genauso „ist“, wie es weiß „ist“. Und „G hat Weiße“ muss also besagen „G ist Weiße habend“ und muss einen ganz anderen Sinn haben als „G ist weiß“. A b e r wi e kl ä r t s i c h nu n a l l d a s a uf, wie versteht sich der schlichte Sinn des inneren Prädikats? Ich versuchte früher zu sagen: Ein Teil ist ein Gegenstand für sich, ist „Objektiviertes“ (selbständiges Thema). Eine Bestimmung ist nicht Objektiviertes, sondern nur in Identifikation zu Habendes. Ich sehe freilich daraufhin, aber das ist kein „Objektivieren“, kein Zum-„Gegenstand“-Machen. Sowie ich es tue, was ich kann, habe ich eine Relation. Was ist daran Wahres? U n d kan n j e de r T e i l zu r B e st i mmun g , j e de B e s t i m mu ng z u m Te i l we r de n? Es ist nun die Frage nach dem Verhältnis

132

5

10

15

20

25

30

explikative und prädikative synthesen

zwischen prädizierender und relativierender (beziehender) Synthese, zwischen prädikativem Sachverhalt und Beziehungsverhalt. Jede Prädikation (das Wort so eng gefasst, dass ihr Korrelat ein „primitiver“ kategorischer Sachverhalt ist), jede primitive prädikative Synthese beruht auf Explikation. Man möchte sagen: Diese vollzieht sich doch im Übergang von Totalerfassung zu Partialerfassung; es kommen also zur Deckung erfasstes Ganzes und erfasster Teil. Bezieht also nicht ganz selbstverständlich jede prädikative Synthese Ganzes und Teil aufeinander? Also z. B. „Dieses Papier ist weiß“. Das Weiß ist doch in gutem Sinn Teil des Gegenstandes, näher, seine Oberflächenfärbung ist Teil der konkret vollen Dingoberfläche. Also, die prädikative Synthese in „Dieses Papier ist weiß“ ist gerichtet auf das Subjekt als den Teil habend, und sie bezieht darauf das Prädikat: den Teil. Sollen wir also sagen (wie das Bo lz ano tut, vielleicht durch analoge wie die sich hier darbietenden Motive bestimmt), der Prototyp der einfachen prädikativen Synthese sei am klarsten ausgedrückt durch „A hat b“, und sollen wir zudem dies interpretieren durch „A, das Ganze, hat den Teil“? Um hier tiefer zu sehen, müssen wir tiefere Blicke in das Wesen der Explikationen werfen. Wir haben sie zwar schon gründlicher Analyse unterworfen, aber noch haben wir wichtige Momente nicht zur Abhebung gebracht. Wir haben bei jeder Explikation unterschieden Explikand und Explikat.1 Das letztere kann wieder als Explikand fungieren usw. Dabei aber besteht ein Unterschied: Es kann von vornherein die Erfassungsform haben, die zu einem Explikanden gehört, oder erst in die Form gebracht werden. Nämlich jeder Explikand hat solch eine Form, und diese wächst ihm nicht erst im Zusammenhang der aktuellen Explikation zu: als ob er zuerst ohne diese Form wäre und erst, wenn das Explizieren des Objekts anginge, sie erwüchse. Natürlich, eine solche ihm zuwachsende Form hat er auch, es ist die

1 Neu ausarbeiten, da die Form des Abgesehenseins, Thematischseins und die des substantivisch Nominalen verwechselt ist. Vgl. die Blätter 1–3, die nachfolgen, mit den Hauptbestimmungen zur Umarbeitung = Beilage IX: Schlichte explikative Betrachtung gegenüber prädikativer Synthesis. Die Übergangssynthese als Grundlage der Prädikation (S. 148).

text nr. 8

5

10

15

20

25

30

133

spezifische Form des Explikanden als solchen als eines Explikation Erfahrenden. Aber es gehört zu ihm wesentlich eine schwer zu bezeichnende Form, es ist die des Bestimmbaren überhaupt und nicht nur die des Erfassens als G ege nst an d, a uf de n es a b ge seh e n i st. Es ist ein auf ihn in speziellem Sinn als Gegenstand Gerichtetsein; in dem Erfassen waltet eine t he ore ti sc he (o bj e kt iv i e re nde ) „ A b si c ht “, ein Abgesehen-Haben und zugleich ein Erfassen als Bestimmbares.1 Indem der Gegenstand das Abgesehene ist, expliziert wird, vollzieht sich korrelativ in eigener Weise eine Entfaltung des Absehens. E s z ei gt si ch , wa s im A b s eh en li eg t – es zeigt sich, was im Abgesehenen liegt: Beides kann man sagen. Nun ist aber das Wort „absehen“ gerade hier zweideutig, sofern man doch sagen wird, dass bei einer Explikation das Explikat, das Herausgeholte, in der Linie des Absehens, in seiner Richtung liegt und somit selbst abgesehen ist. Und wenn doch in der Explikation ein besonderer Strahl des Erfassens auf das Explikat geht, so wird man ebenfalls sagen, es bestehe darin ein Gerichtetsein auf oder ein Abgesehen-Haben auf das Explikat. Genauer besehen bestehen hier aber wesentliche Unterschiede. Von A b si c ht sprechen wir im Wil le n sg eb i et, und wir sprechen da auch von Abgesehen-Haben-auf, von „eine Absicht haben“ = einen Entschluss gefasst haben (freilich zuständlich und dispositional). Es ist ein Abzielen, das noch kein Erzielen ist, und andererseits sprechen wir vom Erzielen selbst, die Absicht ausführen, den Entschluss ausführen. Es ist nun klar, dass das Abzielen, Absicht haben, und zwar das Aktuell-sich-Entschließen phänomenologisch anders charakterisiert ist als das Erzielen, obschon in diesem die Absicht fortgesetzt „waltet“. Nun, hier haben wir eine genaue Analogie.2 Wir haben eine bloß theoretische Absicht, wir haben ein Absehen auf einen Gegenstand. In der Explikation „waltet“ fortgesetzt das Absehen, aber die explizierenden Sonderakte mit ihren Explikaten sind nicht selbst

1 Es muss scharf geschieden werden das Abgesehen-Haben und die Form des Bestimmbaren, die notwendig jeder Explikand haben muss und die ein Explikat eventuell annehmen kann, wenn es sie nicht hat. 2 Absicht, Abzielen und Erzielen im voluntativen Sinn und theoretischen Sinn parallelisiert.

134

explikative und prädikative synthesen

in demselben Sinn absehende Akte, sondern in ihnen waltet Absehen vermöge ihrer Deckung mit den abzielenden, nämlich Absehen auf den Explikanden. Es ist vielleicht nicht ausgeschlossen, dass sie in sich selbst ein Absehen implizieren, ein neues Absehen, aber das 5 ist dann etwas Besonderes und nichts dem Explikat Wesentliches. Man kann hier wieder auf das Willensgebiet hinweisen. Der absehende Wille kann sich „explizieren“, hier nämlich Ausführung erfahren in einem erzielenden processus, der ungebrochen zum Ziel führt. Ich will zum Rohns1 gehen und gehe in einem Zug dahin. Es kann aber 10 sein, dass der Wille zum Ziel, die Absicht, nur in gebrochener Linie erzielbar ist (und im Verborgenen hat ihrem Wesen nach schon die Absicht die Diskontinuitäten in sich) und erzielt wird. Es vermitteln dann Akte, die selbst den Charakter von „Absichten“ – untergeordnete, dienende –, von „Entschlüssen“ haben (Entschließungen). 15 So ähnlich hier. Das absehende Erfassen kann sich explizieren in solcher Weise, dass die Explikat-Akte selbst wieder den Charakter absehender haben.

20

§ 5. Schlichter thematischer Akt. Unterschiede thematischer Richtung schon vor der Explikation: singuläre und plurale thematische Intentionen

Dazu gehören aber wichtige weitere Überlegungen. Von einem absehenden Akt in dem jetzigen ausgezeichneten Sinn sagen wir, er setze einen Gegenstand thematisch. Den Ausdruck „thematische Akte“ werden wir in einem weiteren Sinne nehmen müssen, nämlich 25 setzende Akte, deren Themata thematischen Zusammenhang haben, worüber später mehr. Eine relative Rede ist das. Thematische Setzungen liegen voraus, und thematisch ist dann alles, was mit ihnen thematische Zusammengehörigkeit hat. Es ist nun zu beachten: Jeder thematische, ein thematisches Objekt 30 setzende Akt (ein thematisches Objekt: ein Was, das im ausgezeichneten Sinne „Gegenstand“ ist) ist ein spontaner Akt, eine Spontaneität, eine Tätigkeit der Freiheit – und doch ist es kein Willensakt. Thema1 „Der Rohns“ war ein beliebter Gasthof auf dem Hainberg bei Göttingen. – Anm. der Hrsg.

text nr. 8

5

10

15

20

25

30

35

135

tisch auf einen Gegenstand als Thema gerichtet sein, ist nicht etwa gerichtet sein willentlich auf Explikation. Das brauche ich gar nicht. Ich werfe einen Blick des Interesses auf einen Gegenstand. Ich erfasse ihn, aber ich gehe nicht in Explikation über, das heißt, ich bin nicht gerichtet auf mein Tun als ein reales bzw. zu realisierendes in der psychophysischen Wirklichkeit, während das, was zur Explikation wirklich kommt, nur minimal das Thema entfaltet, geschweige denn, dass es es erschöpft. Eine Tendenz auf Explikation ohne realisierende Objektivierung, die ja schon theoretisches Interesse voraussetzt,1 mag beim thematischen Erfassen vorhanden sein und mag bis zu einem gewissen Maße Erzielung finden, aber wir unterscheiden diese Tendenz von der theoretischen „Intention“, von der ihr zugrunde liegenden thematischen Richtung auf. Wir lassen das Willentliche nun außer Spiel. Da wir den Ausdruck thematischer Akt erweitern werden in dem Sinn, dass thematische Akte auch zusammengesetzt sein können aus thematischen Akten, so wollen wir jetzt von s chl i c ht en t he mat is c he n A kt e n sprechen, die in schlichter Weise auf ein thematisches Objekt gerichtet sind (also nicht mehrere Akte mit sonderthematischen Objekten enthalten). Ein schlichter thematischer Akt kann, unbeschadet seiner Schlichtheit, nur ein einziges oder auch eine Vielheit von thematischen Objekten haben, und er kann im letzteren Fall die Vielheit der thematischen Objekte in der Einheit eines sie umspannenden Themas haben. Man wird vielleicht sagen müssen, jeder thematischer Akt hat zunächst ein Thema, aber dieses kann in seiner Einheit viel enthalten. Aber wenn es auch zweifellos ist, dass jeder schlichte thematische Akt zunächst auf eine Einheit geht, so ist darin ein Unterschied, dass mitunter diese Einheit bloßer Durchgangspunkt für das Bündel von eigentlichen thematischen Strahlen ist, die auf die eigentlichen Objektthemata gehen, während in anderen Fällen, wie mir scheint, die Einheit wirklich Thema ist und zugleich Durchgangspunkt für die thematische Richtung auf gewisse ihrer Glieder. Geben wir Beispiele. Wenn ich dieses Papier, dieses unbeschriebene weiße Blatt Papier, mir ansehe, den Blick darauf richte, so ist darin das Papier als Thema-Objekt gesetzt. Und es ist der thematische Strahl ein einfacher. Es ist nur eines „gegenständlich“, eben 1

Wir kämen also auf einen unendlichen Regress.

136

5

10

15

20

25

30

35

explikative und prädikative synthesen

das Papier. Wenn ich, von der Höhe ins Tal blickend, Landstraßen mit Baumalleen sehe, so kann das Absehen, das „Interesse“, auf die Alleen gehen; ebenso sehe ich Ortschaften, und das Absehen geht eben auf die Ortschaften: Sie mögen Komplexe sein von Bäumen, von Häusern, und das gehört natürlich insofern mit zum Abgesehenen, als es ein Ganzes von solchen Gegenständen ist, ebenso wie vorhin zum Papier als Abgesehenem gehörte, dass es die Farbe, die quadratische Form usw. hat. Aber demgegenüber gibt es n oc h ei ne an d er e W ei se der Ri ch t u n g a uf di e All e e, auf die Ortschaften usw. Die Allee ist z. B. eine Pflaumen-Allee. Und ich blicke hin (und betrachte eventuell) mit dem Auge des Obstzüchters, des Pächters und dgl. Dann geht das Absehen nicht schlechthin bloß auf die Allee, sondern gleichsam Strahlen des Absehens, thematische Strahlen gehen auf die Einzelheiten, auf die Bäume. Wieder anderes Beispiel: Ich sehe meine Kinder herankommen. In einem Blick erfasse ich die Gruppe, aber gerichtet bin ich auf die Einzelnen zusammen, und doch nicht eigentlich auf die Gruppe, auf das Zusammen. Ein lebendiges Bild interessiert mich als Ganzes und zugleich jedes einzelne Glied. Mögen neben dem, worauf es uns hier ankommt, dem „theoretischen Interesse“, auch Gefühle und dgl. vorhanden und maßgebend sein, in welcher Hinsicht auch immer: Sicher ist, dass wir U n te rs c hi ed e d e r t h e m a ti s c he n Ri c h t u n g h a b e n , un d z w ar sc ho n v or de r E x p l i ka t i o n, schon im einfachen thematischen Erfassen. In der Einfachheit einer thematischen Setzung können mehrere und viele „thematische Strahlen“ sein.1 Ob das besagt, dass reell viele unterscheidbare Komponenten unter dem Titel „thematische Strahlen“ in die Einheit der thematischen Setzung eingeschmolzen sind (als ein verbundenes Liktorenbündel sozusagen), oder ob das Eingeschmolzensein ideell zu verstehen ist, und endlich, ob bald das eine, bald das andere, das ist Sache besonderer Untersuchung. Jedenfalls bezeugen sich hier Wesensunterschiede der thematischen Setzungen, die sich ausweisen in Unterschieden der Explikation. Die einen Fälle können wir leicht erledigen, nämlich wenn zunächst eine Einheit, eine Gruppe erfasst wird und durch ihre Einheit hindurch der thematische Blick auf die Einzelheiten geht, die ausschließlich die abgesehenen sind: Dann ist eben das Thema das 1

Für Thema immer thematisches Objekt.

text nr. 8

5

10

15

20

25

30

35

137

Zusammen als Plural dieser Einzelheiten und nur das. Das besagt nicht, dass das Zusammen ein singulärer Gegenstand ist, der die Einzelheiten als Glieder in sich fasst, sondern dass wir hier statt eines Themas viele Themen haben und nicht etwa die Vielheit, als Einzelheit zusammengenommen, auch noch als Thema. Doch es ist gut, näher auszuführen. Wir sagen zunächst: Die thematischen Akte zerfallen in thematische Setzungen eines singulären Themas und in thematische Setzungen mehrerer pluraler Themen, und dabei sprechen wir hier von einfachen thematischen Setzungen, die in einer Setzung ein Strahlenbündel von thematischen Richtungen-auf haben und so mehrere Themen als Plural. Die Explikation erfordert hier Sonderexplikation, das heißt, jedes Thema muss Thema für sich werden in einer eigenen Setzung und sich in einer eigenen Explikation explizieren. Aber all diese Explikationen müssen sich in der Einheit eines Bewusstseins, einer Zusammennehmung halten, sonst wäre jedes Thema zwar expliziert, aber nicht die durch die Vielheit der Themen hindurchgehende Einheit der thematischen Richtung expliziert. Das ist freilich ein schwer zu beschreibender Punkt. Es ist ein Unterschied, ob eine plurale thematische Intention Explikation erfährt oder ob ein Inbegriff Explikation erfährt, der plural zum einheitlichen Thema gemacht ist, und durch dieses Thema hindurch thematische Strahlen zu den Einzelheiten gehen. Andererseits aber waltet in der pluralen Setzung doch eine Einheit, eine thematische Einheit, aber nicht eine solche, die ein Thema, den Inbegriff, setzt (als singulären Gegenstand). Nehmen wir nun die Fälle, wo ein thematisches Objekt, ein singuläres, gesetzt ist, aber das Thema ist eine Ei nh e i t a u s me h re r en The me n, auf die also mehrere thematische Strahlen gehen. Das sagt: D ie Ex p li k a t i o n f o r d e r t h i er t h e m a ti s ch se t z e nde A kt e. Ich bin auf die Allee, und das sagt auch, auf die Bäume der Allee gerichtet, und diese Themata muss ich erst in eigenen thematischen Akten erfasst haben und sie dann explizieren. Die Explikation vollzieht sich also notwendig in Stufen derart, dass die erste Stufe zwar expliziert, aber dabei zugleich schlichte thematische Akte vollzieht. Ich sprach früher wiederholt von Zuhandensein im Gegensatz zu Ergriffensein. Hier haben wir ein bestimmtes Zuhandensein: das Enthematischsein, Mittelbar-thematisches-Objekt-Sein.

138

explikative und prädikative synthesen

Im Thema (thematischen Objekt) sind vielfältige Themata i mp l i z iert: Das Thema hat eine thematische K om pl ex ion, aber der thematisch setzende Akt ist nicht eine k o mp l e x e S pon ta ne i tä t; es entspricht nicht jedem Enthema eine eigene es setzende Spontaneität, 5 ein eigenes Erfassen. Durch das thematische Objekt hindurch geht ein mehrfältiges „Gerichtetsein“ (ein mehr oder minder deutlich abgehobenes), ei ne Meh rh ei t v on e n t he m a ti s che n S tra hl en, di e k ein e s po n t anen S e tz un ge n si n d, auf die Enthemen, auf die thematischen Glieder. Der Gegenstand hat Glieder und ist seinen 10 Gliedern nach „gemeint“, aber die Setzung ist eine einfältige.

§ 6. Der Unterschied zwischen den Explikationen, deren Explikate selbständige Themata sind, und solchen, deren Explikate nicht als für sich geltende Gegenstände gesetzt sind 15

20

25

30

35

Im Allgemeinen wird ein beliebiges thematisches Objekt – ein beliebiger abgesehener „Gegenstand“ – in verschiedenen Beziehungen teilbar sein, z. B. ein Dinggegenstand, er wird verschiedene Gegenstände an sich unterscheiden lassen, die ihm eingeordnet sind, eben als Teile. Aber damit ist nicht gesagt, dass die thematische Intention, die Setzung als Thema, auf diese Teile enthematisch (also in besonderen „Strahlen“) gerichtet ist. Das setzt vielmehr einen besonderen Bau des auf den Gegenstand als Thema gerichteten und durch dieses Thema hindurch auf Partialgegenstände gerichteten Aktes voraus. Es kann so sein, dass die Zuwendung zu dem Gegenstand G nur Durchgangszuwendung ist, das heißt, dass G Thema nur ist um eines „interessierenden“ Teiles, etwa der Form, willen: Sie ist das Motiv der Zuwendung zu G, und die Explikation führt alsbald zu diesem Motiv hin als dem „eigentlichen Thema“ (Zielthema). Hierbei kann es sein, dass dieser processus insofern notwendig ist, als dass da s be t re ff e nde T h em a n u r mi t t e lb a r e s s e i n ka nn, nämlich eine Zuwendung zunächst zu dem G (oder überhaupt einem dasselbe „Thema“ Habenden) führt. Doch sind die Fälle hier nicht ganz klar, und es scheint mitunter, dass ein vorthematisches „Vorhandensein“ des G genügt. Es kann aber auch sein, dass die Zuwendung zu G nicht bloß Durchgangszuwendung ist, dass vielmehr G selbstberechtigtes

text nr. 8

5

10

15

20

25

30

139

Thema ist und nicht bloß Medium für den Teil, der enthematisch bewusst ist. Zum Beispiel, ich bin auf diesen Aschenbecher gerichtet, und dabei fällt mir von vornherein sein eigentümlicher Fuß auf oder zugleich zwei Füße, ein paar eigentümliche Buckel etc. Es kann ferner sein, dass ein Gegenstand Thema ist mit den oder jenen oder gar keinen herausgehobenen Enthemen, und d as s im Lau f de r E xpl i k at i o n s ic h Ri c h t ung en a u f E nt he m en e i n st ell en , d as s s ic h al s o da s t h em ati s ch e In te re ss e, d er I n h al t der t h em at is c h e n S et z un g, ber e ich e rt u m e ig en e e n t h em a t i sc he St ra hl en. Die Explikation hat dann in Beziehung auf sie (oder die Erzielung) den Charakter eines schlichten setzenden Aktes, der ein eigenes Thema setzt.1 Wir werden vielleicht genauer sprechen müssen. „Die schlichten thematischen“ Akte, von denen wir hier immer sprechen, haben das Eigentümliche, dass sie einen G ege ns t a nd f ür si c h setzen – einen, der für sich selbst gelten will und nicht um eines anderen willen –, dass sie etwas Gegenständliches als Thema für sich, a l s h e r r s c h e nd e s (a u ch f r e i es abs o lu t es ) T he m a setzen. Ihnen stehen gegenüber Akte, die nicht „Gegenstände“ oder Themen für sich, sondern dienende Themen (Mittel-Thema, abhängiges) setzen. Worum es sich mir hier vor allem handelt, ist, den Unterschied zu klären zwischen den Ex p l i ka t i o ne n , in d en en di e E x pl i kat e G e g e n st ä nd e f ü r s i c h, f re i e T h e ma t a s in d, un d s ol c he n, be i d e n e n si e e s ni c ht s i n d. Wenn ich ein Gruppenganzes expliziere und die auf die einzelnen Glieder der Gruppe (Kegelpyramide, Baumreihe, Wald) gerichteten Intentionen in Form von Einzelerfassungen expliziere, so sind die Explikate freie absolute Themata und zugleich Partialthemata. Wenn ich aber dieses Papier betrachte und auf die Farbe, Form etc. achte, so haben diese Momente des Gegenstandes in der Explikation, also als Explikate, nicht den Charakter von selbständigen Themata, sie sind nicht als für sich geltende Gegenstände gesetzt.

1 Die thematischen Strahlen sind hier in der Einheit der thematischen Richtung so charakterisiert, dass das, was sie treffen, wieder als Gegenstand „für sich“, als herrschender gemeint ist. Das ist nicht bei allen thematischen Akten und thematischen Strahlen der Fall. Siehe folgende Seite.

140

5

10

15

20

25

30

35

explikative und prädikative synthesen

Man wird sagen können, wenn ich einen schlichten Gegenstand expliziere, der kein Enthema enthält, so wird auch im Voraus mancher Richtungsstrahl auf Einzelheiten gerichtet sein können, und insbesondere, wenn ich zu explizieren anfange, so liegen die Reize für die Schritte der Explikation in voraufgehenden Richtungsstrahlen; es hebt sich die Form, die Farbe ab, es drängt sich auf. Vielleicht kann man sagen, dass „innerhalb“ der einheitlichen „Gesamtintention“, d. i. der „Materie“ der einheitlichen thematischen Setzung, sich, noch ehe ein eigener Setzungsstrahl ein Explikat herstellt, eine Abhebung vollzieht, die schon eine Absonderung innerhalb der einheitlichen thematischen Richtung bedeutet. Die thematische Setzung setzt das Gesamtthema in dem „Sinn“, in dem es bewusst ist, und jede Abhebung im Sinn besage zugleich in der Richtung-auf Besonderungen. Aber dann ist i n d ies en im p li zi er te n R ic ht u ng e n e be n e i n k a r di na l e r U nt e rsc hie d. Die eine ist Richtung auf ein selbständiges Thema, auf einen Gegenstand für sich, die andere Richtung auf etwas, in dem sich ein selbständiges Thema entfaltet derart, dass aber das Explizierte nicht als etwas für sich gelten will. Unter allen Umständen bleibt der Unterschied zwischen schlichtem Thema (und zwar freiem und nicht gerade aus freien zusammengesetztem, überhaupt keine freien Themata als Teile implizierend) und dem Gegenteil. Kann man nun sagen: Ein schlichtes und einfaches Thema expliziert sich in thematischen Akten, die keine neuen selbständigen Themata setzen? Jedes unselbständige Explikat (unselbständig als Thema) kann aber in ein selbständiges verwandelt werden; es kann ein „eigenes Interesse“ daran erwachsen, es wird zum selbständigen Thema und expliziert sich dann in seiner Weise: So z. B. das Ding in einem ungegliederten thematischen Setzen betrachtend, durchlaufe ich die Farbe, die Gestalt usw. Die Gestalt kann nun zum selbständigen Thema werden, ich zergliedere sie nun als neues Thema usw. Dabei lehrt, wie mir scheint, die sorgsame phänomenologische Analyse, dass der betrachtende Blick auch Stücke, Glieder, die ihre Abhebung haben, so durchlaufen kann, dass das Interesse für das Ganze das ausschließliche bleibt und sich in dem Durchlaufen nur auslebt bzw. sich bloß expliziert. Im Allgemeinen wird bei Stücken, die die Artung von Gegenständen haben, die normalerweise ein selbständiges thematisches Interesse erregen, die Neigung groß sein, in selbständige thematische

text nr. 8

141

Erfassung überzugehen, und diese wird sich eventuell ganz verselbständigen, sofern das Interesse für das Ganze fallengelassen wird, oder dies ist nicht der Fall, dann ordnet sich die Explikation des Teils der des Ganzen unter: In ihr vollzieht sich in zweiter Stufe die des 5 Ganzen.

10

15

20

25

30

35

§ 7. Die Explikation als bestimmendes Übergangsbewusstsein. In ihr ist der Sachverhalt schon vorhanden, aber noch nicht synthetisch erfasst. Explikation und beziehende Synthese stehen nicht auf gleicher Stufe. Der Unterschied zwischen Explikation von Eigenschaften und der beziehenden Synthesis von Ganzem und Teil Es scheint, dass wir da noch einmal das Wesen der Explikation studieren müssen. Ich wende mich einem Gegenstand zu und halte ihn im Einheitsbewusstsein fest, in seinem „Sinn“. Und nun wende ich mich speziell seinen inneren „Eigenschaften“, seinen inneren Bestimmungen zu und lege mir auseinander, was der Gegenstand „ist“, ohne dass ich doch prädiziere. Ich lasse zunächst dahingestellt, ob das Prädizieren nur hereinbringt das „begriffliche Fassen“. Ist es nun nicht ein wesentlicher Unterschied, statt sich auseinanderzulegen, was der Gegenstand ist, vielmehr sich anzusehen, was er an Teilen, Stücken, Momenten „hat“? Doch das ist zweideutig. Sich auseinanderlegen, was der Gegenstand ist, reicht so weit, dass es nicht nur die „inneren“ Eigenschaften, sondern auch die relativen befasst, und so ist es auch ein Auseinanderlegen des Seinsgehalts des Gegenstandes, wenn ich dem nachgehe zu bestimmen, was er hat: Er ist besitzend diesen oder jenen Teil, ist in Relation zu dem und jenem. Wir müssen daher vielmehr sagen: Es ist ein wesentlicher Unterschied, auseinanderzulegen, was ein Gegenstand ist, an sich oder relativ, und damit ihn eigenschaftlich zu bestimmen, und andererseits „Analyse“ zu vollziehen und die Teile herauszuanalysieren, die er hat. Das Haben der Teile gehört in das, was er ist; die Teile selbst aber sind seine Habe. Also, das Sein und die Habe, Explikation bzw. Bestimmung und Analyse sind zu trennen. Und im Besonderen auch stellen wir gegenüber, was ein Gegenstand an und für sich, also nicht in Bezug auf andere Gegenstände,

142

5

10

15

20

25

30

explikative und prädikative synthesen

betrachtet, ist, und auseinanderzulegen, was er an Teilen hat. Innerhalb der Bestimmung (dessen, was ein Gegenstand ist) sagen wir: Es ist ein Unterschied, einen Gegenstand durch irrelative, „absolute“ Prädikate bestimmen und ihn durch relative bestimmen, und es ist nicht zu verwechseln innere Bestimmung durch „absolute Prädikate“ und relative Bestimmung als Haben von Teilen und Momenten, darunter durch vergegenständlichte Prädikate. Relative Bestimmung konstituiert sich dabei komplizierter als absolute, wenn es richtig ist, dass in der beziehenden Synthese dem Beziehungssubstrat ein Inhalt zuwächst, der allererst durch Explikation daraus zu gewinnen ist.1 Aber das kann Bedenken erregen. Überlegen wir näher. Wir wenden einem Gegenstand ein thematisches Erfassen zu und explizieren in der bekannten Weise, dabei spontan verfahrend: das Objekt im Griff behaltend und in Sondererfassungen es verdeutlichend.2 Das ist also das explikative Einheits- und ÜbergangsBewusstsein. Wir können schon sagen: Im Explizieren, in diesem Übergang, „bestimmt sich“ das Objekt, das als Substrat ausgezeichnet ist, nur dass kein synthetisches Erfassen vollzogen ist, das der Einheit in der Bestimmung zugewandt ist und den Sachverhalt zur originären Erfassung bringt. Wir sagen also, das explizierende Bewusstsein ist ein bestimmendes Bewusstsein, ein bestimmendes Einheitsbewusstsein im Übergang. Es wird die Frage sein können, ob nicht jedes Einheitsbewusstsein im Übergang bestimmend ist. Wir sprachen bei dem explikativen Übergang von einer Deckung der nominalen und thematischen Intention auf das Objekt und der verdeutlichenden Intention (= Erfassung). Sie konstituiert die Einheit, die nachher in Form der prädikativen Synthese substanziale Erfassung finden kann. Und wesentlich ist bei ihr, dass das thematisch Gesetzte im Griff bleibt als Festgehaltenes; nur dadurch verdeutlicht sich die thematische Setzung in der Explikat-Setzung.

1

Die aufgegebene Lehre. Versuch, explikative und beziehende Synthese auf gleiche Stufe zu stellen und die letztere in sich selbst als bestimmend anzusehen, also in gleicher Weise unmittelbar als bestimmend anzusehen, wie es die explikative ist: so dass die Erfassung von Sachverhalten beiderseits in derselben Weise vonstatten ginge. Diese Ansicht wird aber weiterhin widerlegt, cf. 17a ff. = S. 144,9 ff.. 2

text nr. 8

5

10

15

20

25

30

35

143

Gibt es nun nicht noch andere Weisen einer Konstitution von Einheit im Übergang von einer thematischen Setzung, die in Festhaltung übergeht, in einen anderen thematischen Akt (der bei der Explikation kein Thema „für sich“, kein Selbständiges, setzt); und sind diese Übergangssynthesen in demselben Sinne bestimmend, wie es die explikative Synthese ist, oder werden sie erst in bestimmende umgewandelt, wodurch eben eine „Bestimmung“ als Explikation hereinkommt? Am nächsten steht der besprochenen Explikation der synthetische Übergang von einem Gegenstand zu einem Glied oder Teil. Müssen wir nicht auch diesen Übergang als bestimmenden bezeichnen, nämlich sofern wir sagen dürfen, dass der Sachverhalt „G hat T“ in eben derselben (und nicht in komplizierterer) Weise aufgrund des synthetischen Übergangs zur artikulierten Erfassung kommt wie der Sachverhalt „G ist α“ in der Explikation? Dann wäre α ein Explikat, aber in „hat T“ = „ist T habend“ wäre das „T habend“ kein Explikat. Das Gemeinsame beiderseits wäre Bestimmung. Das „ist“ würde (und ebenso seine grammatischen Äquivalente) die Synthesis der Bestimmung in ihrer Erfassungsform ausdrücken.1 Ebenso hätten wir die „Umkehrung“ der beziehenden Übergangssynthese von Ganzem zum Teil als beziehende Übergangssynthese von Teil zum Ganzen. (Die Explikation hat keine Umkehrung, und zwar einfach aus dem Grund, weil zwar das Explikat wieder zum Explikanden werden kann, aber niemals die Explikation des Explikats B von A auf ein Explikat führen kann, das identisch ist mit A selbst. Es ist das ein Sachverhalt, der sich umwenden lässt in den, dass der Teil eines Teils niemals das Ganze sein kann.) Auch die Übergangssynthese von Teil zum Ganzen wäre also unmittelbar bestimmende Synthese und wieder ebenso die Übergangssynthesis der Vergleichung, besser der Gleichheit, der Steigerung, der räumlichen Lage, der zeitlichen Folge usw. Man kann nicht sagen, jedes Übergangsbewusstsein, das mit einer Setzung und Festhaltung angeht bzw. fortgeht, sei schon ein bestimmendes Bewusstsein oder Einheitsbewusstsein im Sinne eines „Einheit der Bestimmung“ „Konstituierenden“ (vorhanden Machenden): Denn die Zusammennehmung ist keine Bestimmung. 1

A ist grün, A ist nicht „grüne Farbe“, ist nicht Grüne.

144

5

10

15

20

25

30

explikative und prädikative synthesen

Vielmehr gehört es zum Wesen gewisser Erfassungen, ihrer Materie nach, dass sie im Übergang synthetische „Einheit“ stiften, und die Einheit wäre, wenn die versuchte Ansicht richtig ist, immer Einheit der Bestimmung (von Sich-Bestimmendem und Bestimmtem). Zum Wesen der Materie eines schlicht und für sich thematisch setzenden Aktes gehört es, dass Explikabilität, und bestimmte, besteht; zum Wesen der Materie von G und T gehört die Synthese der Bestimmung des G als T habend und diejenige des T als Teil seiend usw. Indessen, ist die versuchte Ansicht (wiewohl sie sehr bestechend ist und ich ihr auch zunächst unterlegen bin) nicht unrichtig?1 Das heißt, es geht nicht an,2 „Explikation“ und Synthesis der Beziehung auf gleiche Stufe zu stellen und beide in gleichem Sinne als bestimmend zu bezeichnen. Womit gesagt wäre, dass die Sachverhaltskonstitution sich bei beiden in gleicher Art und Einfachheit vollzieht. Vielmehr ist zu sagen: Die Explikation entfaltet in sich selbst, was der zu explizierende Gegenstand ist; es fehlt nur die auf den Sachverhalt bezogene, ihn originär erzeugende Erfassung. Der Sachverhalt liegt schon bereit, ist unmittelbar schon vorhanden in der explikativen Übergangssynthese, nur ist er nicht erfasst. Anders in der toto-partialen Synthese, zunächst in der (nicht ohne weiteres mit ihr identischen) Hat-Synthese, und ebenso in jeder anderen beziehenden Synthese. Im beziehenden Hinblick von A auf B findet eine je nach den Wesen der A B (bzw. nach Art der Relation) verschiedene „Synthese“ statt, eine gewisse Verknüpfung und Überschiebung. Aber eben dadurch erhält das A einen „Charakter“, das heißt, es erfährt eine Sinnesbereicherung, und nun kommt es zur Bestimmung, wie es in der nicht so vermittelten Explikation zur Bestimmung kommt. Das durch den Übergang bereicherte A erfährt Explikation in Hinsicht auf die Bereicherung (die originär nur durch den Übergang „erwachsen“ kann). Und wie bei jeder Explikation, so entspringt durch passende Blickrichtung das Erfassen des Sachverhalts „A ist ρ B“ (A ist Teil von B, ist größer als B etc.). Wir haben also zweierlei Bestimmungen, zweierlei Explikationen, wie wir auch sagen können, voneinander zu unterscheiden:

1 2

Falsch. Nur, wenn ich die falsche Ansicht noch einmal überlegen will.

text nr. 8

5

10

15

20

25

30

35

145

1) in gewissem Sinn unmittelbare Explikationen, innere Explikationen (Eigenschaftsexplikationen), irrelative, absolute; 2) in gewissem Sinn mittelbare (nicht zu verwechseln mit jener Mittelbarkeit, von der oben die Rede war, wonach das Explikat wieder Explikand wird), wir sagen besser, äußere, durch Beziehung vermittelte, relative, bei welchen der Explikand, ehe er noch als solcher schon fungiert, auf ein zweites Thema bezogen und der infolge dieser Beziehung bereicherte Explikand hinsichtlich der Bereicherung expliziert wird. Gewöhnlich vollzieht sich eins in Verbindung mit dem anderen, zuerst wird innerlich expliziert, dann bezogen und wieder expliziert. Alle Bestimmung liegt in Explikation, die ihrem Wesen nach überall einerlei ist, nur ihren Wesensvoraussetzungen nach die bezeichnete fundamentale Verschiedenheit hat. Die Hat-Synthese gehört zu den beziehenden und steht nur in der eigentümlichen Relation zu der explikativen Synthese, dass a priori jedes Explikat, wenn es nicht schon selbständiges Thema ist, zu verselbständigen ist und dann Explikand und Explikat in Bezug gesetzt und eine neue Explikation (die teil-relative) etabliert werden kann. Wichtig ist dabei zu sehen, dass nicht das bloße Verselbständigen des Explikats schon eine relationelle Synthese herstellt (wie ich ursprünglich gemeint habe), wofern man unter Verselbständigung nichts weiter versteht als dasjenige Objektivieren, das jeder mögliche Explikand haben muss. Vielmehr gibt es eine andere Verselbständigung, die in der „Gegenüberstellung“ liegt, als Gegensatz der explikativen Entfaltung. Im Beziehen gehen wir über A hinaus (nicht in A hinein) zu B als einem zunächst fremd und für sich Genommenen. Im Explizieren gehen wir in A hinein und bleiben im Leben des A. Die explikative Synthese ist Synthese, sofern sich die beiden „Glieder“ „decken“. Dabei ist A „mit sich selbst identisch“. Total verschieden ist die Deckung in der relationellen Synthese. In gewissem Sinn, aber in ganz anderem und eigentlicherem, ist auch da Deckung und bei allen Relationen. Im Übergang legt sich das Ausgangsglied der Synthese auf das Endglied, es bezieht sich darauf: Es genügt nicht, beliebig die beiden Glieder zusammenzubringen (unter Festhaltung des ersten etc.), sondern in gewisser Weise muss im Übergang eines mit dem anderen zur „Einheit“ gebracht werden.

146

5

10

15

20

25

30

35

explikative und prädikative synthesen

Doch haben wir hier große Unterschiede, und gegenüber dem Allgemeinen dieses Sich-Aufeinanderlegens „im Beziehen-auf“ besagt auch Deckung eine allgemeine Eigentümlichkeit gewisser Synthesen, wonach ein „Gemeinsames“ das Band der Vermittlung und Korrelat der Deckung ist. Und die relationellen Synthesen zerfallen danach in Deckungssynthesen im eigentlichen Sinn und Verknüpfungssynthesen (bzw. die Relationen, wie schon Le i bn iz gesehen hat, in Relationen der Verbindung und Relationen der innerlichen Beziehung, Relationen der Vergleichung: Vergleichen wir A mit B, so ist A Ganzes und B Teil oder umgekehrt, oder es besteht ein anderes mittelbares Teilverhältnis. Ferner, im Vergleich mit A ist B größer, intensiver; die Vergleichung ergibt natürlich Gleichheit und Verschiedenheit, auf der anderen Seite stehen Abstand, Ordnung etc.). Formal haben alle relationalen Synthesen eben dies gemeinsam, dass sie „Gegenstände“ selbständiger Themata für sich zur beziehenden Einheit bringen. Und darin stehen alle der explikativen Synthese gegenüber. Während jede Relation ihre umgekehrte hat, entbehrt die Explikation der Umkehrung. Jede Relation hat mit ihrer Umkehrung das „Fundament“ gemein, nämlich sie entquellen aus demselben gattungsmäßigen Wesen der Beziehungspunkte (bzw. phansisch der Materie der beziehenden Akte und ihrer thematischen Unterlagen) und sind selbst gattungsmäßig verwandt. So ist ferner die Explikation, die Eigenschaften des Gegenstandes im engsten Sinne expliziert (innere Beschaffenheiten, die dem ganzen Gegenstand zukommen, in denen er als ganzer und nur in seiner Ganzheit für die Synthese in Aktion tritt), von Explikationen, die Teile hervorheben, wohlunterschieden. Die „metaphysischen Teile“ B r en ta n os als sich ganz und gar durchdringende Momente des Gegenstandes sind solche Eigenschaften: Hier ist die explikative „Deckung“ die allerinnigste, es ist gewissermaßen das allerintimste „Ist“, was da herauskommt. Indem ein „metaphysisches“ Moment expliziert wird, eint sich damit jedes andere „metaphysische“ Moment ganz und gar und so der Gegenstand selbst in seiner voll umfassenden Ganzheit. Wenn wir solche Momente herausheben als metaphysische Teile und sie als Teile dem Gegenstand als ganzem zusprechen, so vollziehen wir eine Relation, die aber wie jede Teilrelation voraussetzt die ursprüngliche Explikation. So ist sie, phänomenologisch gesprochen, konstitutiv für die metaphysischen Teile.

text nr. 8

5

10

15

20

25

30

147

Wie steht es aber mit G a t t u n g s m o m e n t e n? Sie sind wesentlich mittelbare, in mittelbarer Explikation aufgrund metaphysischer Teile sich konstituierende. Also, das ist wieder eine Charaktereigenart. Dann weiter S t ü c k e. Es will mir immer wieder scheinen, dass die Rede mit „hat“ bald relativ, bald bloß explikativ orientiert ist. Bei der eigentümlichen Wesenslage ist es begreiflich, dass die Ausdrucksformen nicht gesondert sind. Wenn ich sage „Im Sack ist ein Apfel“, „Er enthält einen“, „Er hat einen“, so ist das eine Relation. Was macht also das „Eigenschaft“-Sein?1 Man sagt, „Eigenschaften durchdringen sich im Gegenstand“; das kann uns leiten. Wenn der Gegenstand sich expliziert, indem er in der Explikation seine inneren Eigenschaften entfaltet, so ist an dieser Deckung der Gegenstand ganz und gar, d. h. nach seinem gesamten Sinn, mit dem er thematisch gesetzt ist, beteiligt. Er deckt sich ganz, nach allem, was er ist und hat, mit dem Besonderen, was da als ein Ist hervorgehoben ist; so beim Dinggegenstand: Farbe (Gesamtfärbung), Gestalt und dgl. Wenn die Betrachtung aber auf einen „bloßen Teil“ stößt, wenn der Blick auf diese Glanzstelle für sich geht oder auf diesen Fuß oder auf diese Seitenfläche (als Form) für sich, so findet eine Partialdeckung statt. Da ist die Synthese eine andere. Ein Teil des Sinnes bleibt außer Aktion oder bleibt ungedeckt. Im Ganzen, im Gesamtsinn lebend, durchlaufe ich seine Sinnesschichten sozusagen, die sich durchdringen: so, wenn ich Eigenschaften expliziere. Wenn ich aber auf Teile gehe, so ziehe ich Schranken, ich verenge den Sinn, und in umgekehrter Richtung erweitere ich ihn. Und das bekundet sich auch ohne „Beziehen“. Von Eigenschaft zu Eigenschaft übergehen ist nicht das Ganze fahrenlassen und bloß „festhalten“. Durchlaufe2 ich bloß explizierend, bloß die Sinnesschichten lüftend, das Ganze, so vollziehe ich eine kontinuierliche Modifikation an der Erfassung des Ganzen, eben die der Verdeutlichung, der Hervorhebung, Betonung, Erleuchtung der Komponenten. Es ist klar, dass der Fall radikal anders liegt als bei der beziehenden Synthese,

1 Eigenschaft als unselbständiges Explikat, und zwar ursprünglich unselbständig; andererseits charakterisiert durch die Eigentümlichkeit der explikativen Deckung. 2 An den Rand des folgenden Textes bis ungefähr S. 148,5 hat Husserl ein „Nota bene“ geschrieben, darunter steht eine Null. – Anm. der Hrsg.

148

5

10

15

20

25

explikative und prädikative synthesen

speziell bei der Synthesis von Ganzem und Teil, die oft durch das Hat ausgesprochen wird. Wenn ich, im Sinn des Ganzen lebend, ihn auseinanderlege, bloß „durchlaufe“, verdeutliche, so fasse ich keine Teile heraus und stelle sie nicht dem Gegenstand als Ganzen beziehend gegenüber. Ich könnte die Einheit der Körperlichkeit durchlaufen und dabei den Fuß treffen und durchlaufen, ohne doch den Fuß abzugrenzen und für sich zu vergegenständlichen. Ich lebe im Ganzen, in der ganzen Körperlichkeit, in der ganzen Färbung, Formung usw. und tue das, indem ich die Linien, Flächen etc. durchlaufe, wobei aber immer die Intention durch das Explizierte auf das Ganze geht, und das Ganze, wie ich es ja auch immer beschrieben, sich im Sondererfassen, Betontsein, Klären verdeutlicht. Aber vollziehe ich nicht „Sondererfassungen“ als neue Akte? Gewiß, aber keine Beziehungen. Man wird sagen: Ja freilich, es fällt bald die Umrandung mir auf, bald die Färbung, ich lebe bald in dieser, bald in jener. Aber ich lebe gleichwohl im Ganzen.1 Wenn das auch Sondererfassungen sind, so huschen sie sich gleich ins Ganze ein, verschwinden darin und bilden nicht etwa eine Synthesis der Deckung zweier sich aufeinander beziehender, einander gegenübergesetzter Gegenstände. Es ist nicht so wie bei der beziehenden Hat-Synthese, dass ich Ganzes und Teil gegenüber habe, dass ich zwei Akte der Erfassung habe, jeder „extra“ etabliert, der eben vollzogene, seinem Sinn nach festgehaltene und mit dem zweiten für sich vergegenständlichenden Akt zur Synthese gebracht, verbunden zu einem synthetischen Bewusstsein eben der Beziehung.

Beilage IX Schlichte explikative Betrachtung gegenüber prädikativer Synthesis. Die Übergangssynthese als Grundlage der Prädikation2 30

Wenn ich mich in irgendwelche Explikationen ganz vertiefe und über sie reflektiere, so finde ich, dass man unterscheiden muss: 1 Das hat mich immer bestochen. Eben damit habe ich auch noch kein Ist, also keinen Sachverhalt. – Ja, aber das liegt daran, dass eben keine spontane Synthese, keine prädikative, statthat, und das gilt für das Ist so wie für das Hat. 2 Wohl September 1911. – Anm. der Hrsg.

beilage ix

5

10

15

20

25

30

35

149

1) d a s s c h l ic ht e B et ra cht e n ( die r ei n e R ez ep t iv it ät, natürlich s p on t a n, ist dann das E rf a s se n des Sich-Darbietenden, aber weiter nichts). Das G ist erfasst und bleibt festgehalten, auf seinem Grund bewegt sich fortgesetzt das neue Erfassen, das immer neue „Explikate“ erfasst. Dieses kontinuierliche Ineinander ist keine „Synthese“, kein Sich-Decken, SichAufeinanderlegen, Sich-zur-Einheit-Bringen, sondern kontinuierlich einheitliches Sein. In der Sphäre dieser schlichten Betrachtung bestehen zwischen den Explikaten der Weise nach, wie sie dem G einverleibt sind, wie sie eben Explikate sind, allerlei formale Unterschiede, die Unterschiede der Explikation verschiedener Stufe: also Unterschiede der Explikation, die direkt aus G etwas verdeutlicht oder die in zweiter Stufe aus dem Herausgehobenen wieder etwas heraushebt. Dabei aber ist zu beachten, dass in der Sphäre der schlichten Betrachtung weder von einem prädikativen Subjekt der Bestimmung noch von einer prädikativen Bestimmung die Rede sein kann. Das G ist das h er r s ch e nd e S u b st ra t der Betrachtung (das entspricht dem Subjekt), und das in der Betrachtung Herausgehobene ist, in zweiter Stufe wie in erster Stufe, eben als herausgehobenes Explikat (das entspricht dem Prädikat) in eigentümlicher Weise im Bewusstsein einig mit dem festgehaltenen G. Das Explikat, das selbst wieder „Analyse“ erfährt, erhält in dieser neuen Explikation allerdings den Charakter eines Explikanden, eines Substrats, aber eines untergeordneten, seine Explikate den von mittelbaren Explikaten von G. Also, diese Formunterschiede bestehen, aber innerhalb der Explikate einer, etwa erster Stufe finden wir keine Formunterschiede mehr: doch „herrschendes Substrat“ usw. Zum Beispiel das Rot wird an diesem Papier in erster Stufe explizit erfasst, ebenso aber der schwarze Strich, der Klecks auf ihm. (Aber in der Weise, wie das eine und andere für die Explikation des „Substrats“ fungiert, ist doch ein großer Unterschied.) 2) V o n d e r E x pl ik a t io n a ls s ch li ch t er e xp liz ier e n de r B et r ac ht ung ha ben wi r s ch a rf zu u n te rs c he id e n die pr ä d ik ati ve S yn t h es e al s e in e Sp o nt an e it ä t h ö he r e r St u fe. Das G wird zum Subjekt der Bestimmung (der Prädikation), und das Explikat verwandelt sich in der oder jener Weise in Bestimmung, in prädikativ gesetzte Bestimmung, in „Me r k ma l e“, in das im Sachverhalt prädikativ gesetzte Merkmal. Aus dem Substrat der Betrachtung wird i n b e zie h en d er S etz u n g das als Subjekt Untergesetzte, worauf sich die Erfassung des in Hinblick auf das Explikat sich konstituierenden Merkmals als des Daraufhin-Gesetzten, Übergesetzten, gründet (daher das Wort „Gründung“).1 1 Beziehen: 1) der Übergang in die Explikation; 2) Untersetzung und Daraufsetzung, Setzung des im Einheitsbewusstsein mit sich selbst einheitlichen, neu erfassten G in

150

5

10

15

20

25

30

explikative und prädikative synthesen

Hier haben wir nicht mehr das bloß kontinuierliche Einheitsbewusstsein, sondern den beziehenden Übergang von G-Setzung oder, sagen wir einfacher, G-Erfassung zur Explikat-Erfassung, und hier erwächst erst die synthetische Einheit zwischen Subjekt und „Merkmal“, Bestimmung. Dabei hat in dieser Synthese G nicht nur passive Erfassung erfahren, sondern es ist als selbständiges thetisches Objekt, nominales, und zwar Subjekt gesetzt;1 und was die Explikate anlangt, so scheiden sie sich: Die einen fordern ihrem Wesen, ihrer Materie nach ebenfalls formale Fassung als selbständiges Thema (nominal), die anderen adjektivische Fassung.2 Die letzteren einigen sich mit dem Subjektthema als innere Bestimmung, als „G ist weiß“, die anderen als Gehabtes mit dem Habenden, „G hat T“. Und sofern jedes adjektivisch zu Fassende auch nominal-substantivische Fassung erfahren kann, ist jedes „G ist α“ in „G hat A“ zu verwandeln. Vielleicht ist nun noch folgender Unterschied zu machen: Setze ich G als nominales Objekt, und wende ich den beziehenden Blick auf das Explikat weiß, so erhält es die Setzungsform des „Merkmals“ (das adjektivische) am G, und man kann vielleicht sagen, dass es ein Unterschied ist, den Blick auf das Merkmal am G zu richten und im beziehenden Durchlaufen den Blick zu richten auf „G ist α“. Ich werde geneigt, immer mehr in die Explikation, und überhaupt in die betrachtende Kenntnisnahme hineinzulegen gegenüber der eigentlichen Prädikation. Schon dort: die nominale (substantivische) Form und das Adjektivische, das an dem Träger, der dadurch als „Subjekt“ charakterisiert ist, ist; ebenso hier schon der Unterschied zwischen Prädikation und Attribution – vor der Prädikation?! Wa s b r in gt als o d ie P r äd ik a tio n , un d zw a r a u ße r d e m Be gr e if e n, N e ue s he ra n? Betrachte ich einen Gegenstand, so ist der ausgezeichnet bewusst als Explikand, der immer reichere „Bestimmung der Explikation“ erfährt. Dabei erfährt er das, indem er in der Erfassungsweise in gewisser Art zurücktritt. Das starke Licht der „Aufmerksamkeit“ fällt auf das jeweils neue Erfasste. In der eigentlichen Konstitution des prädikativen Sachverhalts fordert die Erfassung des Subjekts des Sachverhalts als solches die „Aufmerksamkeit“, die Setzung im vollen Licht. Und wenn das S vorher erfasst war und nun bloß festgehalten ist, dann muss der Blick dahin zurückkehren.

der Form des hauptsächlichen Gegenstandes und Darauf-Setzung des „an ihm“, der Bestimmung im synthetischen Bewussten des „ist“. 1 Das alles aber schon im Explizieren. 2 Die Materie der Explikate, das sind wohl die ursprünglichen Kerne.

beilage ix

5

10

15

20

25

30

35

40

151

W as g eh ö rt w es e n t li ch a ls V orb e d in gu n g z ur eig en tli ch en K on s t it u t i on e i ne s S a c hv erh a lt s? Wir können sagen: Es muss ein Gegenstand (eventuell ein Inbegriff) als Träger logischer Akzidentien bewusst sein oder vielmehr, im einfachen Fall, eines Akzidens. Dieses Bewusstsein ist Voraussetzung der prädikativen Synthese, aber nicht sie selbst. Die logische Substanz trägt das Akzidens, ist in der Bestimmung durch dasselbe bewusst, aber es ist nicht bewusst „S ist P!“. Es ist nicht der Träger als Subjekt des Sachverhalts gesetzt und daraufhin gesetzt, dass es das P ist, dass es in dem Akzidens ist. Wie kommt aber ein Gegenstand dazu, als Träger eines Akzidens bewusst zu sein? Das ist ein Gegenstand nicht ohne weiteres. Er kommt dazu im Übergangsbewusstsein, im beziehenden Bewusstsein, in dem eine bestimmende synthetische Einheit sich vollzieht, aber noch keine prädikative. Dabei ist die Frage, ob ein bestimmter Verlauf des Übergangsbewusstseins vorgezeichnet ist, und wie gestaltet es sein muss. Zum Beispiel, es fällt mir während des Spaziergangs eine prächtige Herbstfärbung auf. Es fragt sich, ob ich vorher das Konkretum erfasst haben muss; aber wenn schon das, ob ich es festhalten muss. Mein „Interesse“ ist vielleicht dem Baum zunächst gar nicht zugewandt, und so findet kein Festhalten im Interesse statt (kein thematisches Festhalten), die schöne Farbe allein erfasse ich. Wenn ich nun aber zum Baum zurückkehre oder nun ihm ein thematisches Interesse zuwende, so steht er als Träger der schönen Färbung da. Es scheint klar, dass ich hier nicht den Übergang habe von einem interessierten Erfassen des S zu dem P (ich brauche nicht interessierte Betrachtung des S von vornherein zu üben), sondern es genügt, dass ich überhaupt von S (das ich flüchtig, uninteressiert betrachte) zu P übergehe und vielleicht, dass ich nur P wirklich erfasse und dann zu S übergehe. Es genügt der Übergang also von P zu S, um an dem S das P in der Form des Akzidens zu finden oder um Sp zu haben. P sei dabei ein Moment. Handelt es sich um Relationen, so mag ich zuerst B erfassen und dann übergehen zu A, B festhaltend. Nun mache ich aber A zum Subjekt: Es steht schon als Träger da, zum Beispiel, ich erfasse erst das Dünne und gehe über zu einem Dicken, und nun wende ich diesem das Interesse zu, und es steht als dicker da. Oder es fällt mir ein Objekt auf, und dann erblicke ich ein anderes Objekt (über ihm) und dieses mache ich zum Subjekt und erfasse an ihm das Höher. Zum Wesen eines solchen „Übergangs“, einer solchen beziehenden Synthese gehört, dass das Ende, das Ergebnis der Synthese, das ist, dass jedes der synthetisch verbundenen Objekte Träger ist eines akzidentellen Charakters; und es kommt nun darauf an, welche „Stellung“ ich einnehme, ob ich das Objekt, bei dem ich übergehend terminiere, als Subjekt fasse oder

152

5

10

15

20

25

30

35

40

explikative und prädikative synthesen

das Ausgangsobjekt, zu dem ich aber nun zurückkehren muss, um es zum Subjekt machen zu können: wodurch es aber selbst wieder terminus ad quem wird. Das ist also das eine, das zu studieren ist, di e A rt , w ie d ie Ü b er g an gss y n th e se d er P r ä di ka ti on z u g ru n d e l ie gt, wie ihr Erzeugnis das Substrat (der Träger) mit dem Getragenen ist und wie au s d e m T r äger d a s S u b je k t d e r U r t e ils s e t z u n g w i rd. Wenn wir öfters sagen, durch die Übergangssynthese hat das Ausgangsglied etwas erfahren, so müssen wir ebenso sagen, durch sie erfährt das andere Glied etwas: nämlich die Erfassung des Endes ist eine andere als die „desselben Inhalts“, der nicht Ende ist; auch er wird zu einem Substrat mit Akzidens. Je nach der Weise der Übergangssynthesen sieht nun das Akzidens anders aus, und ein Hauptunterschied ist der, dass unselbständige Momente, wenn sie nicht Nominalisierung erfahren, selbst durch die Übergangssynthese zu Akzidentien werden (diese Form annehmen), während sich anderenfalls, oder wenn selbständige Gegenstände erfasst und dann, wie nicht anders möglich, substantivisch erfasst werden, sich im Übergang neue Akzidentien konstituieren, die Relationsakzidentien, an die sich das „in Bezug auf die betreffenden selbständigen Gegenstände“ anschließt (ähnlich – in Bezug auf A, größer – als B etc.). Überall haben wir ein Recht, von „beziehendem Denken“ zu sprechen, sofern überall die Übergangssynthese es ist, welche konstitutiv ist für das Akzidens an der logischen Substanz (am Substrat). Aber einmal hat der im Prädizieren sich konstituierende Sachverhalt die Form des Irrelativen, es ist „ausgesagt“, was der Gegenstand schlechthin und an sich ist; das andere Mal ist ausgesagt, was er in Bezug auf ein anderes ist. Das heißt, einmal kommt dem A ein absolutes Akzidens zu, das kein „in Bezug auf“ und damit keine Setzung eines zweiten Substantivs erfordert, das andere Mal ist das eben der Fall. Im Relationsurteil ist ein Relationsverhalt konstituiert, in welchem ein Gegenstand auf einen anderen bezogen ist. Im Sachverhalt kommt das „in Bezug auf“ vor. Im eigenschaftlichen Urteil ist nicht ein Gegenstand auf einen anderen bezogen, es kommt das „in Bezug auf“ nicht vor. Das „in Bezug auf“ ist eine sachliche Form, die sich nur in gewissen Übergangssynthesen konstituiert; und heißt Beziehen eben dieses Konstituieren, dann ist nicht jedes Urteilen ein Beziehen. Andererseits verstehen wir unter Beziehen ein Erfassen, das nicht bei einem schlicht Erfassten verbleibt, sondern übergeht zu einem zweiten Erfassen, das also nicht ein einfacher Blick ist, sondern ein Über-das-erstErblickte-hinüber-auf-ein-Neues-Blicken. Dann ist jede Übergangssynthese ein Beziehen, und in diesem Sinn ist jedes Denken beziehendes Denken.

beilage x

153

Beilage X Die Übergangssynthesen: Das Subjekt braucht nicht der Ausgangspunkt zu sein. Die Übergangssynthesen sind noch keine prädikative Bestimmung1 5

10

15

20

25

30

35

Wenn wir einer Phänomenologie der prädikativen Bestimmung nachgehen, so geraten wir auf die „Übergangssynthesen“. Ich beginne mit der „Explikation“. Nun möchte man aber ernstlich schon bei den „Merkmalen“ fragen, ob denn nicht eine grelle Farbe auffallen kann, ohne dass der sie tragende Gegenstand zunächst für sich erfasst wäre. Dann hätten wir zunächst Erfassung des „Rot“, dann Übergang zum Gegenstand, und der steht nun doch als rot da, das Rot an ihm. Sicher, aber bei Stücken, bei selbständigen Teilen? Der Blick fällt auf den Knopf dieses Tintenfasses, ich erfasse ihn und gehe zum Ganzen über, ich nehme aber den „Standpunkt des Ganzen“. Das ist Träger, es hat den Teil. Kann ich nicht in einem Blick einen Gegenstand mit Teilen erfassen derart, dass in der Auffassung sich Teilauffassung und Gesamtauffassung decken, und nun nehme ich das Ganze als Subjekt und finde sogleich an ihm das in besonderem Erfassen herausgehobene Prädikat? Etwa sogleich an ihm das Haben dieser Glieder etc. Mein Blick fällt auf einen Fleck (dieses Kleidungsstücks). Ich gehe zum Gegenstand über, und dieser steht als fleckig da. Indem am Ende dieses Übergangs der Gegenstand erfasst ist, ist er zugleich in der Synthese mit dem Teil erfasst, und an ihm ist nun der Fleck („an“ als Relation). Der Gegenstand steht als ein Fleck habender da. Nun setze ich G und setze das Haben des T. Also, wenn S das Subjekt sein soll, so braucht nicht etwa das S im Übergang an erster Stelle zu stehen. Tut es das, muss ich „zurückkehren“. Ich habe zunächst vor der Prädikation S→P, dann P→S oder vielmehr in eins S→P→S → P und dann Subjektfassung und Setzung des S. S ist P, ist ρ P. Wenn oder S ← ich aber zuerst P erfasste, so habe ich P→S, S ist P, ist ρ P etc., also einfacher. Es ist weiter schwierig, sich klar darüber zu werden, welche Arten schlichter Betrachtung es gibt. Der einfachste Fall ist der, dass man irgendetwas erfasst, wobei ein umfassendes Ganzes oder eine Umgebung mitaufgefasst, aber nicht speziell erfasst ist; dass man dann, den allgemeinen Abhebungen nachgehend, immer neue Erfassungen übt, was einem gerade auffällt. Das früher Erfasste bleibt noch eine Weile erfasst in der Weise der Festhaltung, dabei mancherlei „Übergangssynthesen“, aber keine „Subjekte“ und „Prädikate“.

1

Wohl September 1911. – Anm. der Hrsg.

154

explikative und prädikative synthesen

Ein anderes ist es, wenn mich ein Gegenstand als Hauptsache interessiert und ich ihn schon bestimmend betrachte. Wenn alles sich in Bezug auf ihn gruppiert, die Übergangssynthesen auf ihn als Zentrum bezogen sind, da habe ich eigentlich schon alles beisammen, Substantiv und Adjektiv, Subjekt 5 und Bestimmung und bezügliches Objekt. Es fehlt nur die Konstitution der gegliederten Setzungsweise, das „S ist p!“. Da ist es schwierig, die Grenzen zu ziehen.

Beilage XI Bloße Übergänge und ihre phänomenologischen Charaktere gegenüber den Übergangssynthesen1

10

15

20

25

30

35

Ich spreche immer von Ü b er g an g ss y n th es e n, aber findet nicht schon „Synthese“ statt o h n e z usa m m e n ha lt en d e Sp o n ta n ei tä t? So, wenn ich von einem Gegenstand, ohne ihn festzuhalten, zu einem Teil, zu einem Glied übergehe. Ebenso beim Übergang von Gleichem zu Gleichem (wenigstens wo sich Gleichheit „aufdrängt“). Kommt es nicht vor, dass wir durch die sich im Übergang aufdrängende „Deckung“ allererst dazu kommen, zusammenhaltend und beziehend Gleichheit zu konstituieren? Und eventuell bewirkt dieser Deckungscharakter, dass wir Gleichheit aussagen, ohne V ergleichung vorgenommen zu haben. Aber freilich, ist das wirklich Deckung? Bei der Gleichheit könnte man fragen, ob es nicht eine „Gestaltqualität“ ist, ein Moment, das zur Sukzession gehört von Gleichem zu Gleichem, während die „Deckung“ im beziehenden Bewusstsein ganz offenbar etwas total anderes ist; obwohl wesentlich damit zusammenhängend, insofern mit Ersterem das Letztere möglich ist. Im Vergleichen lege ich die Sachen geistig sozusagen aufeinander. Ebenso scheint es ein phänomenologischer Unterschied zu sein, ein Steigerungs-Nacheinander zu erleben, einen bloß zeitlichen Übergang von Leiserem zu Lauterem oder umgekehrt, und andererseits ein beziehendes Steigerungsbewusstsein. Man könnte hier auch sagen: Wenn ich zeitlich den Übergang habe von leise zu laut, so kann ich nachher vergleichend und beziehend „geistig“ den umgekehrten Weg gehen und das Laut zum Substrat machen. Nun ist das vergleichende Übergehen oder vielmehr das beziehende auch etwas phänomenologisch Zeitliches, aber offenbar ist das Zurückblicken vom Lauten zum Leisen nicht das Phänomen der Sukzession lauter Ton – leiser Ton. Man darf die Phänomene hier nicht verwechseln. 1

Wohl September 1911. – Anm. der Hrsg.

beilage xii

155

Also, die b lo ß en Üb e rg ä n ge schaffen vermöge des Wesens der übergehenden Phänomene E i n he it s ch a r ak t er der S u k ze s si o n, und mi t d i es e n la uf e n M ög l ic h k ei t en d e r Sy n t he si s pa ral l el. A b e r m an d ar f n ic h t v o n „ D ec k ung “ , „ S yn t he se “ vo r der B e zi eh u n g u n d E xp li5 k a ti on s p r e c h e n. Im Allgemeinen ist nicht das Explikat eines Explikats wieder unmittelbares Explikat des Explikanden. Es gibt wesentliche Unterschiede zwischen unmittelbaren und mittelbaren Teilen. Für Stücke gilt allerdings, dass Stücke von Stücken wieder Stücke des Gegenstandes sind.1

10

Beilage XII Die unterschiedliche Weise der Deckung von Eigenschaften mit dem Gegenstand und von Teilen mit dem Ganzen. Der Unterschied zwischen explizierender und beziehender Einstellung2 G enthält T, G ist weiß. Das Gemeinsame: 1) G ist Subjekt einer Be-

15 stimmung, 2) G wird als etwas bestimmt.

Nun habe ich schon einmal und öfters gesagt, es sei ein Unterschied: im Ganzen leben und seinen „Sinn“, seinen „Inhalt“ entfalten, im einzelnen Moment das Ganze sehen „nach“ diesem Moment, von ihm Kenntnis gewinnen etc., und dem Ganzen das Moment gegenüberstellen als ein „anderes“, 20 als etwas für sich, und dann eines auf das andere b ez ie h en.3 Nehme ich Weiß für sich (etwa innerhalb der Farbenmannigfaltigkeit), so kann ich dann sagen, dieses Weiß tritt hier bei diesem Ding auf, kommt bei ihm vor, ist „Moment“ seiner Oberfläche. Ebenso, diese Gestalt ist die dieses Körpers, er hat diese Gestalt, sie ist ein das „Wesen“ des Körpers aufbauendes Bestandstück.

1 Sollen wir sagen, Explikation, explikative Synthese ist eine synthetische Übergangsform, und es besondert sich nun „Eigenschaft“ und „Teil“ je nach der Artung in der Form dieser Synthese? Sicher ist: Es handelt sich bei Eigenschaft und Teil um einen formalen Typus, der sich durch die „Weise des Vorgehens“ bestimmt. Treten nicht bei der Konstitution eines jeden bestimmenden Sachverhalts die korrelativen Übergangssynthesen auf? Ich gehe doch von A zu B und von B zu A. Aber den Standpunkt nehme ich in einem, in dem A. Den Standpunkt nehmen, eine Relation oder Komplexion von einem Standpunkt aus auffassen, das ist nichts anderes, als das A im Charakter der Subjektsetzung erfassen oder vorher das A in der Weise des sich Explizierenden, des sich Bestimmenden fassen. 2 Wohl September 1911. – Anm. der Hrsg. 3 Natürlich braucht es nicht bloß Entfaltung des schon konstituierten Inhalts sein. Vielmehr, im Allgemeinen „bereichert“ sich der Inhalt in der Bestimmung.

156

explikative und prädikative synthesen

Umgekehrt: Dieser Körper besitzt diese Weiße, besitzt diese Gestalt. Lebe ich aber einfach im Anschauen des Körpers, dieses Papiers, und entfalte ich sein „Sein“, so ist er „weiß“. Weiß, das enthält also die kategoriale Form des Explikats. E x pl izi e r en i st n ich t In - B e z ie h u ng -Se tz en. Explikat ist nicht Teil 5 (es fehlt die kategoriale Form von Ganzem und Teil). Auch wenn ich beim Durchlaufen des Dinges auf Teile scheinbar stoße, wie den Schnabel dieser Kanne etc., so ist die explizierende Einstellung eine total verschiedene als die beziehende Hat-Einstellung: Im Explizieren bestimmt sich mir die 10 Kanne, ihr Wesen lebt in dem Schnabel. Erst wenn ich ihn zum Gegenstand für sich mache und die Gegenstände Kanne und diesen für sich gedachten Schnabel aufeinander beziehe, habe ich eben eine Beziehung und beziehende Bestimmungen. Und nun is t das G Ganzes von T, und dieses „Ganze von T“ hat jetzt dieselbe Form wie „weiß“.

Beilage XIII Kenntniserweiternde gegenüber kenntniserläuternder Explikation (innerer Explikation)1

15

20

25

30

35

Explikation sagt Entfaltung. Was entfaltet sich? Der zu explizierende „Gegenstand“, nämlich sein „Inhalt“, was in ihm „liegt“, wird herausgeholt. Was in ihm liegt, das sind seine Gehabtheiten bzw. seine „Bestimmtheiten“, die dem Gegenstand „zukommen auch unabhängig von und vor der bestimmenden Tätigkeit“. Indem sich nun der „Inhalt“ auseinanderlegt und der Gegenstand doch als dieser Gegenstand, als Gegenstand seines Inhalts erfasst, gesetzt war, möchte es scheinen, dass Explikation als Explikation des gegenständlichen Inhalts oder Bestimmungsgehalts phänomenologisch auch besage Entfaltung des den Gegenstand „Vorstellens“, Entfaltung des Erlebnisses, in dem der Gegenstand „aufgefasst“ ist, „erscheint“ und mit dieser „Materie“ gesetzt ist. Das Gegenstandsphänomen habe sozusagen Falten; der Einheit des DenGegenstand-A-Vorstellens-und-Meinens wohnen Teilmeinungen in gewisser Weise ein, die in der Explikation zur Artikulation kommen (wenn sie auch nicht etwa gegenständlich würden). Indessen ist zu unterscheiden, einerseits die bloße Analysis (in dem Sinn, in dem man von analytischen Urteilen spricht), die analytische Verdeutlichung des Sinnes, mit dem der Gegenstand wirklich gemeint ist, und 1

Wohl September 1911. – Anm. der Hrsg.

beilage xiv

157

Auseinanderlegung der Sinneskomponenten, des Inhaltsbestandes, der in der „Gegenstandsmeinung“ wirklich schon lag, und andererseits die synthetische Bestimmung des Gegenstandes, das Näherbestimmen, wobei die Näherbestimmung noch nicht im Bewusstsein des Gegenstandes „enthalten“ 5 ist, oder die Neubestimmungen, die den Gegenstand überhaupt allererst näher kennenlernen und dabei neu und Neues von ihm kennenlernen. Das bloße Verdeutlichen (die Kenntnis, die man schon hat, sich verdeutlichen)1 und das Kenntnisnehmen (d. i. Erfassen und in steter Erfassung „desselben“ Gegenstandes), immer reichere Kenntnis von ihm gewinnen, 10 einen immer reicheren gegenständlichen Inhalt in die Erfassung hineinbringen: durch fortgesetztes Erfassen „neuer“ Einzelheiten, die fortgesetzt in den Sinn des erfassten Gesamtgegenstandes (des explizierenden) aufgenommen werden, ihn fortgesetzt bereichern, unter Vereinheitlichung der Bewusstseinseinheit des Gegenstandes. Phänomenologisch ist natürlich das bloße Erläutern, das bloße Verdeut15 lichen unterschieden von derjenigen Explikation, in welcher das Bestimmen die Kenntnis „erweitert“. Jede Relation erweitert die Kenntnis. (Jede äußere Explikation erläutert nur die Kenntnis, die durch Explikation schon gegeben ist?)

20

Beilage XIV Prädikative und vorprädikative Übergangssynthesen. Schlicht Abgesehenes und Abgesehenes im Übergang. Die Übergangsformen. Die Form des Bestimmbaren überhaupt gegenüber der Form des Substrats2

Man muss unterscheiden: I) die Erfassung bzw. Setzung eines Gegenstandes al s f ü r s i ch s e l bs t a b g e se h e n im Gegensatz zu der Erfassung eines Gegenstandes, der nicht „um seiner selbst willen“ erfasster, abgesehener ist. Ein Gegenstand ist „eigentlich“ betrachteter (oder schlechthin betrachteter), andere Gegenstände sind in der Betrachtung nur im Dienst 30 von Bestimmungen herangezogen: Sie sind erfasst, aber das Absehen geht auf

25

1 Kenntnisnehmendes Erfassen, Kenntnis-Inhalt. 1) K en n tn is-„ E rläu teru n g “, Verdeutlichung des Inhalts der Kenntnisnahme. 2) K e n n t n i s - E r w e i t e r u n g = Erweiterung des Inhalts der Kenntnisnahme in fortgesetzter Neubestimmung. Phänomenologischer Unterschied zwischen „analytischer“ Explikation, kenntniserläuternder, und „synthetischer“ Explikation, kenntniserweiternder. 2 Wohl September 1911. – Anm. der Hrsg.

158

5

10

15

20

25

30

35

40

explikative und prädikative synthesen

den Gegenstand, der Bestimmungssubjekt ist; in und mit ihrer Betrachtung bestimmt sich dieses Subjekt. Das p ri mä r e t h em at is ch e O b j ek t - d i e s e ku n d är e n t h e m a t i sc h en O bj e k t e. Ein Gegenstand wird erfasst: Seine Erfassung ist aber nur Durchgangspunkt für eine andere Erfassung, deren Objekt das eigentliche Absehen ist. Das Durchgangspunktsein kann besagen: 1) Der Gegenstand ist überhaupt nicht thematisches Objekt. Es kann aber auch 2) besagen: sekundäres thematisches Objekt sein, d. h. adjektivisches Thema oder bezügliches Objekt sein. Es fällt in den Rahmen des Absehens, aber das Absehen hat zwei Sphären, das primär Abgesehene, das Subjekt, und das sekundär Abgesehene, das im Dienst der Bestimmung Stehende. Wir haben hier also zwei Unterschiede: 1) das Thematische im weiteren Sinn: thematisches Objekt sein und nicht thematisches Objekt sein, obschon erfasst sein; 2) innerhalb des thematischen Objektseins den Unterschied zwischen thematischem Substrat und dem, was dazu dient, das Substrat zu bestimmen. Dabei ist weiter zu unterscheiden ein thematischer Singular und ein thematischer Plural, das Abgesehene ist ein Einzelnes oder eine Mehrheit als Plural. Es ist aber die Frage, ob nicht noch weiter zu scheiden ist, z. B. neben den Plural sei zu stellen das Disjunktivum. Ferner: Das Absehen geht auf Einheit, konjunktive und disjunktive Mannigfaltigkeit; es geht auf nominale Einzelheiten, Mehrheiten, Disjunktiva, oder es geht auf Sachverhalte (propositionale Gegenständlichkeiten) und dann wohl wieder auf propositionale Einzelheiten (einen einzelnen Sachverhalt), Mehrheiten und Disjunktiva. Dabei ist nicht zu verwechseln das Absehen auf einen Sachverhalt als Propositionales und das Absehen auf den nominalisierten Sachverhalt etc. Ob etwas thematisch ist als Subjekt (singuläres, mehrheitliches) oder als Bestimmung oder innerhalb der Bestimmung als bezügliches Objekt, das sind Unterschiede, die in die Sphäre der (propositional-singulären) Sachverhalte fallen. Und daneben gibt es vielerlei andere Unterschiede: Die Unterschiede thematischer Form, wie z. B. hypothetischer und disjunktiver Vordersatz und Nachsatz zu sein und dgl. Nun kann man Unterschiede betrachten innerhalb der Sphäre der Prädikation, also wirklich der konstituierten Sachverhalte, und Unterschiede des gegenständlichen Bewusstseins vor der prädikativen Konstitution der Sachverhalte: also Unterschiede der Weise gegenständlichen Bewusstseins in den Übergangssynthesen, in der Weise, in der ein Absehen auf ein Betrachtungsobjekt geht und in der es auf bezügliche Objekte geht in dem bloßen Übergangsbewusstsein, durch das sich das zu betrachtende Objekt bestimmt, aber vorprädikativ. In der vorprädikativen (in gewissem Sinn unteren) Sphäre haben wir dann nur den Unterschied des Singulären und Pluralen (Konjunktiven und Disjunktiven), das Abgesehenes ist, und zwar schlicht Abgesehenes

beilage xiv

5

10

15

20

25

30

35

159

oder als Bestimmungssubjekt Abgesehenes, im Gegensatz zu dem, was der Bestimmung dient. In dieser vorprädikativen Sphäre haben wir aber wohl zu unterscheiden II) das Abgesehene, und zwar primär Abgesehene (als Subjekt) und das Nominale (Substantivische). Das bezügliche Objekt ist nominal bewusst, aber nicht als Träger. Das Adjektivische ist nicht nominal bewusst.1 (Das Bezügliche kann übrigens ebenso wohl ein singuläres wie ein plurales sein.) Es ist aber nun die Frage, ob man sagen kann: Findet kein Übergang statt, haben wir ein schlichtes Erfassen und Absehen, so handle es sich u m b l oß n o m i n al e , su b s t a n t i vis c h e F o r m. Wir haben hier natürlich keinen Unterschied zwischen primär und sekundär, zwischen Subjekt und Bestimmung, zwischen Herrschendem und Dienendem. Erst im „Übergang“ wird das Abgesehene zum Substrat, zum Träger (eines Adjektivischen, eventuell eines In-Bezug-auf). Also da erwächst die Form des Substrats. Vorher haben wir schlicht Abgesehenes. Aber ist schlicht Abgesehenes eo ipso „nominal“?2 Wir können da, wenn wir das behaupten wollten, nur sagen: Vergleichen wir das schlicht Abgesehene mit einem als Träger Abgesehenen und wieder einem als bezügliches Objekt Abgesehenen, so finden wir ein Gemeinsames; das nennen wir eben das Substantivische. Innerhalb des Sachverhalts finden wir aber auch ein Adjektivisches bzw. innerhalb des Übergangs. Und darum sagen wir also, das Nominale sei schon vor der Übergangsform da. Ganz unzweifelhaft ist das aber nicht. Im Gegenteil, ich halte es für falsch. Überlegen wir, was wohl innerhalb der Übergangssynthese zu unterscheiden sei, und versuchen wir folgenden Ansatz: 1) das schlichte Erfassen des A (angeblich schon nominal), 2) das Übergehen zu B, das zunächst auch schlicht erfasst ist, auch wo es ein Unselbständiges ist, z. B. weiß. (Ist das etwa zunächst nominal = substantivisch?) 3) Die Einigung: Das Papier, das noch erfasst ist, erfährt Bestimmung durch das Weiß selbst, bestimmt sich als weiß; das Papier erfährt die Subjektformung, das Weiß die adjektivische Formung. 4) Dann ist aber die Schwierigkeit die, dass wir doch das Weiß, die Farbe (freilich auch das Prädikat weiß und das Weiß-Sein), nominalisieren können und die Bestimmung in der Form „A hat Weiß-Farbe“ vollziehen können. Wir sehen, wir müssen besser unterscheiden: Es ist zu unterscheiden zwischen schlichtem Erfassen und Erfassen als Abgesehenes in der Weise eines zu Bestimmenden oder Bestimmbaren. Das Weiß wird so nicht gefasst, es

1 2

Gemeint ist unter nominal hier substantivisch! Nein.

160

5

10

15

20

25

30

35

40

explikative und prädikative synthesen

kann aber so gefasst werden: Das ist die nominale (substantivische) Fassung. Also muss man doch eine eigene Fassung annehmen, die schon der Eingang in die Übergangssynthese, in die bestimmende, voraussetzt. Diese Form des Bestimmbaren ist aber nicht die Form des Substrats. Die erstere Form ist vorausgesetzt, damit etwas Subjekt werden kann, aber nicht selbst Subjektform. Das Weiß als Explikat kann, ohne dass es aufhört, Explikat zu sein, also im Dienst der Bestimmung des A zu stehen, die Form des Bestimmbaren annehmen, und eventuell sogar auch Bestimmungen annehmen. Es kann also zugleich Subjekt sein, aber freilich Explikat und Subjekt kann es nur sein in der Weise, dass das Subjekt eine Form angenommen hat, die das herrschende Subjekt, das Hauptsubjekt, natürlich nicht hat. Jedenfalls haben wir also die Form, die wir die substantivische nennen, die des B e st im m b ar e n üb e r ha upt, zu trennen von der Form des S u b jek ts (besser Tr äg er s), und die beiden Möglichkeiten, dass etwas innerhalb der Sphäre des Thematischen auftritt, das zwar Abgesehenes ist (wie alles darin), aber nicht die Form des Bestimmbaren hat, und andererseits diese Form annimmt (und alles Abgesehene kann sie prinzipiell annehmen). Demnach haben wir alles in allem zu scheiden: 1) Abgesehenes (wohlunterschieden gegenüber Nicht-Abgesehenem; innerhalb der Sphäre des Abgesehenen mancherlei Unterschiede); 2) schlicht Abgesehenes im Gegensatz zu Absehen im Übergang, wodurch verschiedene Formen auftreten. 3) Sehr wichtig ist es, zu beachten den Unterschied zwischen bestimmenden Übergängen und Übergängen schlechthin. Ich erfasse einen Gegenstand, dann lenkt sich die Aufmerksamkeit auf einen Teil, dann wieder auf ein Moment etc., all das ohne Bestimmendes und Bestimmtes. In diesem Übergang ist alles schlicht und in gleicher Weise erfasst, und es fehlen die Formen, auf die es uns jetzt ankommt, die Formen des Bestimmbaren und des Subjekts (bzw. allgemeinen Trägers). Soll der Übergang zu einer b es t im m en d e n Ü b er g an gs s yn t h e se werden, so muss das Übergangsglied Abgesehenes sein in der Form des Bestimmbaren, in der substantivischen Form. Indem die Synthese vollzogen ist, erhält es zugleich die Subjektform. Das im Übergang Erfasste hat im Allgemeinen nicht die Form des Bestimmbaren. Ist es ein unselbständiges Moment, so hat es einerseits die Form der schlichten Erfassung (wenigstens kann man vielleicht sagen, zunächst), andererseits (indem die Synthese einschnappt) die Form der adjektivischen Bestimmung. Es kann dann aber die adjektivische Bestimmung eine Umwandlung erfahren: Indem nämlich das zunächst schlicht Erfasste die Form des Bestimmbaren (des Gegenstandes im nominalen, substantivischen Sinn) erhält, und wenn es dann selbst Bestimmung erfährt, untergeordnete, attributive Bestimmung, so erhält es die Form des Substrats, des Themas.

beilage xv

161

Die Form des Subjekts: So bezeichnen wir am besten das in der gesamten Synthese zu Bestimmende, das H au p t su b j ek t. Form des Trägers:1 jedes Bestimmung (sei es auch mittelbare, dienende) erfahrende Objekt. Wir können vielleicht auch sagen, Gegenstand im prägnanten Sinn, das 5 ist die Form des „G eg en st a nd e s, w e lc he r“; „ d er G egen s tan d , w elc he r “ is t e nt w e de r „ G e g e n st a nd wo r üb e r “ ( nä ml ic h w or ü b er d ie A us s a ge g em a c h t w ir d e t c .) o d e r „ G e g e n st an d in B ez u g a u f d en “.

Beilage XV Schlichte und beziehende thematische Betrachtung. Wie das beziehende Betrachten sich zum Bestimmen in der prädikativen Synthesis wandelt2 3

10

Aber diese Explikation, diese betrachtende Kenntnisnahme vom Objekt, ist nicht Erfassung von Sachverhalten, ist nicht synthetisches Bewusstsein von Relationen und sonstigen Sachverhalten (Ist-Verhalten). Es soll jetzt das 15 synthetische Bewusstsein vollzogen werden: G ist  und relationell G hat T. Es ist artikuliert und synthetisch bewusst die Relation zwischen Ganzem und Teil bzw. das Subjekt als das die Bestimmung tragende. Sie setzt doch wohl jenes nicht-synthetische Bewusstsein voraus. Ich frage nun, setzt nicht jedes synthetische Erfassen einer Relation, 20 jedes „beziehende Erfassen“ schon eine irgendwie bewusste Einheit der Beziehungspunkte voraus? Die Frage ist zweideutig. Auf diese Schale hinblickend, habe ich schon im schlichten Erfassen einige Einzelheiten, z. B. diesen Buckel in Bevorzugung bewusst, nämlich schon abgehoben, obschon kein Sondererfassen, kein Explizieren noch statthatte. Man kann sagen, schon da 25 liegt eine Art verborgene Einheit vor. Der in der Gesamterfassung erfasste Gegenstand und das an ihm Abgehobene. Eine andere Einheit ist aber die, welche bei einer Explikation durch kontinuierliche Einigung der Gesamterfassung und Sondererfassung sich stiftet, im Übergang vom einen zum anderen. Also entspricht, hätten wir doppelt

1

Träger = Substantivität. Wohl September 1911. – Anm. der Hrsg. 3 Gegensatz: 1) das Sich-näher-Bestimmen in der „Verdeutlichung“ und 2) das Sich-Bestimmen in der Prädikation, in der synthetischen Beilegung von Bestimmungen als Prädikaten. Das explizierende Betrachten gegenüber dem Prädizieren; einerseits das analysierende Herausheben von gegenständlichen Inhaltsmomenten und Sondererfassen in Richtung auf den Gegenstand, andererseits das Konstituieren von Prädikaten an Subjekten. 2

162

5

10

15

20

25

30

35

explikative und prädikative synthesen

zu fragen, dem bei jeder beziehenden Erfassung, in der eine Relation eben beziehend, in artikulierter Synthesis, zur Erfassung kommt, etwas: Bedarf diese Synthese als Voraussetzung die Erfassung einer schlichten Einheit und dann eines Übergangs von Relationsglied zu Relationsglied? Doch das ist ungenau. Im Fall des Verhältnisses zwischen Ganzem und Teil erfasse ich zunächst das Ganze und bin darauf gerichtet: Aber der Teil ist abgehoben und hat schon verborgene Einheit mit dem Ganzen. Diese Einheit ist aber nicht das Ganze, worauf ich objektivierend-erfassend gerichtet bin. So bin ich bei einer sonstigen Relation zunächst etwa schlicht auf das eine Glied erfassend gerichtet, aber die Einheit mit dem anderen, noch nicht erfassten ist schon zuhanden, drängt sich hervor und ist sozusagen ein verborgenes Motiv für die beziehende Bewegung. Lassen wir die Frage nach den verborgenen „Motiven“, nach den die Bewegung „anregenden Tendenzen“ beiseite, und b e tr ac h t en wi r d ie Ü be r gä n ge u nd di e A r t, w i e es z u r ar t ik u lier t en s yn t h et is c he n Er fa s s un g d e r R e l at io n ko m m t. Nehmen wir an, wir betrachten einen Gegenstand: diese Tinten-Pipette. Sie ist das Objekt. Nun drängt sich die schwarze Tischplatte auf, auf der die Pipette liegt, der Blick wendet sich ihr zu, aber die Pipette bleibt das Objekt der Betrachtung. Habe ich jetzt zwei betrachtete Objekte? Stellen wir eine allgemeinere Betrachtung an. Ich kann betrachtend von Objekt zu Objekt gehen und im Übergang Festhaltung üben, und zwar als „aneinanderreihende“ Hinzunehmung; in ihr ist jedes Neue, das ich erfasse, Objekt, und jedes ist Objekt in gleichem Sinne. Aber nicht immer ist im Übergang von einem Objekt zu einem anderen Erfassten das letztere „Objekt“. Das zeigt sich ja auch daran, dass ich das erste Objekt und ein zweites oder auch noch ein drittes und so weiter „zusammennehmen“ und hierbei einen Abschluss machen kann derart, dass ein Hinausblicken über die in der abschließenden Einheit des Zusammennehmens zusammengenommenen Objekte zwar neue Sachen erfasst sein lässt, aber nicht als Objekte, die in „Betracht“ stehen, in Betracht gezogen werden und betrachtete Objekte sind.1 Ebenso kann es nun sein, dass ich ein Objekt betrachte, zu einem zweiten übergehe, aber dabei bliebe, das erste Objekt allein zu betrachten, es ist allein und bleibt allein das Objekt, das ich betrachte im eigentlichen Sinne. Aber nun ist noch ein Unterschied zu machen. Wenn ich zu Zwecken eines Beziehens den Blick von der Pipette auf den Tisch, auf dem sie liegt,

1 Kontinuität der thematischen Setzung, Erblicken eines Objekts, das „nicht hineingehört“, nicht in die thematische Betrachtung „gezogen wird“.

beilage xv

5

10

15

20

25

30

35

40

163

hinübergehen lasse, so hat diese Tischerfassung einen Vorzug gegenüber anderen gelegentlichen Erfassungen, wie wenn ich auch den Blick hinüberschweifen lasse zu dem Aschenbecher. Im Hinblick auf den Tisch ziehe ich den Tisch in die Betrachtung hinein; aber in die Betrachtung der Pipette. Das „Inbetrachtziehen“ ist also zweideutig. Denn wenn ich betrachtend in koordinierter Weise von Objekt zu Objekt gehe in fortschreitender Aneinanderreihung von Objekten der Betrachtung in der Einheit einer Zusammennehmung und Hinzunehmung, so ziehe ich, sprachlich kann man ja das auch sagen, eines nach dem anderen in Betracht, und so spricht man noch in anderen Bedeutungen von einem Inbetrachtziehen, zum Beispiel, ziehen wir in Betracht, dass A ist, so ist zu sagen, es muss B sein, also bei der Begründung. Indessen hier liegt offenbar ein Gemeinsames vor. Das In„Anbetracht“ bei der Begründung braucht nicht schon besagen, dass das In-Betracht-Gezogene vergegenwärtigt sei und besagt es an sich auch noch nicht. Was übrig bleibt, ist dann wieder dies, dass etwas im eigentlichen Sinne betrachtet ist, primär, und dass anderes in dienender Weise in Betracht gezogen ist. Freilich ist da schon von prädikativen Bestimmungen die Rede, und es ist das auch schon wohl ein plus. Jedenfalls wollen wir versuchsweise von t he m a ti s ch er Be t ra ch t un g sprechen, dabei zwischen schlichter und beziehender thematischer Betrachtung unterscheiden. Bei der letzteren sprechen wir von einem S u bs t r at d e r B et r ac h t un g und dem, was in Betracht gezogen worden ist, als a n ih m oder i n B e zu g d a r au f; ein zweiter, in Bezug auf das Substrat in Betracht gezogener Gegenstand: der korrelative Gegenstand, der G e g e np u n k t d er Bet ra ch tu n g. Es scheint, dass wir sagen müssen: Ein Gegenstand kann thematisch betrachtet sein schlechthin (das ist, ohne Beziehung, aber ganz analog wie ein Substrat der Betrachtung), auch wenn an ihm nichts Besonderes betrachtet wird. Als schlichtes Thema fungieren und überhaupt als Thema, das ist eine besondere Weise der Zuwendung zum Gegenstand bzw. seiner Erfassung. Er hat dabei eine auszeichnende Geltung. Wenn ich einen Gegenstand als Thema erfasse, so ist das eine Auszeichnung gegenüber einem nebenbei erblickten Gegenstand. Ich erinnere auch an die Fälle, wo ein „einheitliches Interesse“ mehr Gegenstände als Themata zusammennimmt und auszeichnet. Unter „I n te re s s e“ ist dabei aber nicht an Gefallen, Lust und dgl., überhaupt an Gefühle, zu denken, die unter Umständen oder in der Regel die thematische Zuwendung, und zwar die auszeichnende Zuwendung, motivieren, anregen mögen und dgl. (Wir sollten auch von theoretischer Zuwendung sprechen, obwohl das seine Bedenken hätte, bzw. von theoretischer Erfassung. Doch ist das bloß der Anfang des „Theoretischen“.)

164

5

10

15

20

25

30

explikative und prädikative synthesen

Untersuchen wir nun das b ez ieh e n de B e tr ac h te n und die Art, wie es sich zum Bestimmen in der prädikativen Synthesis und zum synthetischen Erfassen von Relationsinhalten wandelt. Wir beginnen also noch einmal: Wir betrachten die Pipette, wir wenden den Blick der schwarzen Tischplatte zu. Die Pipette sei unser Thema, und zwar unser Substrat und bleibe es. Die Tischplatte ziehen wir in der Betrachtung heran, sie ist nicht unser Substrat, aber sie tritt in den Kreis des „Interesses“, in das des Themas. Ebenso, sie „liegt (das erregt unser Interesse) neben“ der Zigarrenspitze: Ein zweiter Blick und ein zweites beziehendes Betrachten geht auf die Zigarrenspitze. Statt ein „neben“ kann aber das Verhältnis der Dicke zur Erfassung kommen: Die Spitze ist dicker als die Pipette. Ich bin einmal auf Lage, das andere Mal auf die Form „eingestellt“. Ich habe bei der Betrachtung gerade auf die schlanke Form geachtet, und nun drängt sich im „Kontrast“ dazu die dickliche Form der nebenbei liegenden Spitze auf: Ich blicke hinüber. Im Übergang erlebe ich in dieser Einstellung die Steigerung. Von der als schlank ausgezeichneten Pipette zur Spitze, die die Sonderauffassung als dickgeformt erhält, übergehend, erhält die letztere den Charakter der Steigerung, des „Mehr“, aber ich bin auf die Pipette als Substrat gerichtet: Der Blick wendet sich zurück zu der noch festgehaltenen Pipette, und sie steht nun als „dünn“ da, und dieses „dünn“ ist es, das ich bestimmend erfasse; sie ist nicht dünn schlechthin, sondern dünn mit Beziehung auf die Spitze. Ebenso, wenn sich bilden soll das Relationsurteil: „Die Pipette ist auf der schwarzen Tischplatte“, so wendet sich ein beziehender thematischer Blick auf die schwarze Platte, und nun hat oder vielmehr ist jeder der beiden Gegenstände etwas, das zur Erfassung kommt, wenn ich vom Substratgegenstand (dem ersten Betrachtungsthema, das Substrat, also Herrschendes, ist und bleibt) übergehe zum Gegenpunkt und rückkehrend in einem neuen Erfassen zum Substrat. Es ist etwas, und zwar in Hinblick auf den Gegenpunkt, durch dessen Erfassung ich hindurchgegangen sein muss.1 Es will mir scheinen, dass, wenn wir vom ursprünglichen Thema a ausgehen und ihm d en We rt d es B e t r a ch t un g ss u b s tr ats geben, wir zunächst also geführt werden zu b (dem Dickeren). Nun hat schon vermöge dieses

1 Man sagt, zu jeder Relation gehört (im alten Sinn) ein fundamentum relationis, eine Einheit, eine Tatsache, an der beide Beziehungsglieder beteiligt sind. Das kann man bei den Relationen der Verbindung sagen, wo man ein „Ganzes“, eine „verbundene Einheit“, erfassen kann und in ihr die Beziehungsglieder als Teile erfassen; das geht aber nicht bei Relationen von Ganzem und Teil. Hier sind nicht Ganzes und Teil an einem „beteiligt“, aber hier haben wir das Ganze als die eine Tatsache, in der wir auch das andere finden, den anderen Beziehungspunkt. Und bei Gleichheit und Steigerung?

beilage xv

5

10

15

20

165

ersten Übergangs das b den Charakter des Dickeren, aber doch eigentlich nicht des Dickeren als relatives Merkmal, sondern ein Charakter tritt daran hervor, die Dicke, und zwar die Dicke charakterisiert durch diesen Übergang. Wir erfassen das „b in diesem Charakter“, aber wir vollziehen da keine Synthese, wir sind einfach der Spitze in ihrer Dickheits-Charakteristik zugewandt und kehren alsbald zu unserem Thema zurück als dem zu bestimmenden. Und wir bestimmen es nun, wir erfassen: a ist dünner als b. Warum, möchte man fragen, dieser doppelte Weg? Man wird versuchen zu antworten: Solange ich a allein betrachte, finde ich an ihm kein relatives Merkmal (es sei denn, ein sinnliches Kontrastmerkmal). Ich muss also zu b übergehen. An b mag schon ein „Charakter“ hängen durch den Übergang von a, aber das ist nicht ein relatives Merkmal, das voraussetzt, dass b Substratstellung hat und die Richtung der Beziehung auf a geht. Das relative Merkmal am Substrat a ist erst voll konstituiert, wenn ich zu a wieder zurückgekehrt bin, was eine Wiederholung der erfassenden Aktualität ist, und nun bestimmend zu diesem Merkmal mich gewendet habe.1 Dasselbe gilt für jede Relation, auch für die Relation von Ganzem und Teil. Ich gehe vom Ganzen als Substrat zur Erfassung des Teils als Hinblick darauf, aber zum Ganzen zurückkehrend erhält dieses das durch diese hinund hergehende Bewegung konstituierte relative Merkmal: Ganzes von Teilen. Soll aber die umgekehrte Relation erfasst werden, so muss ich „mich auf den Standpunkt des Teils stellen“, d. h. den Teil zum Substrat machen und im Übergang zum Ganzen dieses in die Gegenstellung, die des „in Hinblick auf“, bringen, und rückkehrend hat nun der Teil das relative Prädikat.

1 Das b in dem Charakter des „lauter“, des „dicker“, der Steigerung, das ist ein eigener Modus des Gegebenseins des b, auf den ich reflektieren kann. Aber man darf diese Reflexion nicht verwechseln mit der Hinwendung auf b, die eben aus dem Charakter ein Beziehungsmerkmal zu a „macht“ oder entnimmt.

Nr. 9 A na l ysen z u r Ex pl ika t io n1

§ 1. Hauptexplikanden und dienende Explikanden. Die mögliche Eigengeltung der Explikate. Die Beziehung zwischen Ganzem und Teil als explikative Synthese von zwei substantivischen Objekten

5

10

15

20

25

30

In der Explikation unterscheiden wir den Ha up te x pl i k and en, den herrschenden, und die di e ne nd en E x pli kan de n (die selbst wieder Explikate sind). Dasselbe gilt von der Explikation im weiteren Sinne, der beziehenden, von einem Thema zu anderen, dienenden, hinübersehenden Betrachtung.2 In den Sac hv e rh al te n, die sich aufgrund der Explikation durch „Denken“ spontan konstituieren, unterscheiden wir Ha u pt s ub jek t e – jeder einfache Sachverhalt bzw. jede einfache Prädikation hat ein singuläres oder plurales Hauptsubjekt – und N e b e n s ub j e kt e, nämlich bezügliche Objekte, die selbst wieder Subjekte sind. Ebenso Hauptprädikate und Nebenprädikate, Hauptbestimmungen und Nebenbestimmungen, z. B. „S, welches p ist, ist q, welches r ist.“ Hier ist p das Nebenprädikat, q das Hauptprädikat; q ist verflochten mit seiner Nominalisierung, die wieder ein Subjekt ergibt, und zwar ein Nebensubjekt, für welches r das Nebenprädikat ist. In einer Explikation hat der Explikand eine Bevorzugung gewisser Art: Wir sagen, er sei als Gegenstand für sich aufgefasst. Das ist aber hier eine relative Rede. Nämlich das Explikat „gilt nicht für sich“, es hat statt der Eigengeltung die der Explikation des Substrats, als etwas, worin wir das Substrat sehen, verdeutlichen, kennenlernen, etwas, worin sich das Sein des Substrats (des Explikanden) offenbart, zeigt. D i es e „Unselbständigkeit“, dieser Mangel an Eigengeltung, gehört zum We se n d e s Ex p li k a ts, und wenn das Explikat wieder

1 2

Wohl September 1911. – Anm. der Hrsg. Cf. X0 p. 10 ff. = S. 132,24 ff..

text nr. 9

5

10

15

20

25

30

35

167

Explikand ist in der Einheit derselben Explikation, so hat es zwar keine Eigengeltung, aber doch wieder hat es seine relative zu seinem Explikat. Wir müssen sagen, es hat zwar keine Eigengeltung, aber erhält eine modifizierte, sozusagen bittweise angenommene, eine Eigengeltung unter dem Hut der Explikation: Mit Beziehung auf sie haben wir dann eine Unselbständigkeit zweiter Stufe, eben ein Explikat zweiter Stufe. Wieviele Stufen eine Explikation auch haben mag, wie oft Explikat wieder zum Explikanden werden mag, so ist doch zu betonen, da s s i n ne r h alb d e r E in he i t d er E x pl i kat i o n e i n do mi n ie ren der E xp l ik an d, der eine und einzige Explikand der ganzen Explikation vorhanden ist, der a bs ol ut e E xp l i kan d, unter den alle anderen Explikanden untergeordnet, dienende sind. Die Rede vom Herrschen und Dienen ist eine relative und so die Rede von Explikand und Explikat und auch die vom Explikand der ganzen Explikation. Nun finden wir aber beim Hauptexplikanden eine Eigengeltung, die er schon hat in der Zuwendung zu ihm, auch ohne dass wir zur Explikation übergehen. Der Gegenstand ist im prägnanten Sinne G e g e ns t a n d d e s „ t he o ret i sc hen I nt er e ss e s “, und zwar schlechthin, absolut. Diese Eigengeltung behält er in der Explikation, und sie fehlt nicht allen Explikaten. Dies ist also ein zw e i te r S inn v o n E i g e ng e l t un g. Diese Eigengeltung kann nun ein Explikat entweder schon haben oder sie hinterher annehmen. Hierbei zerfallen die Explikate in zwei Klassen, oder vielmehr die „Gegenstände“, die in möglicher Funktion als Explikate stehen können. 1) Die einen können diese Eigengeltung nur dadurch haben, dass sie vorher Explikate waren (also ohne jene andere Eigengeltung waren). Ein „unselbständiges Moment“, ein „unselbständiger Inhalt“ ist dadurch charakterisiert, dass er herausgehoben sein muss, aus einem Konkretum entnommen. Dieses kann dann fallengelassen werden und das Entnommene zum „Gegenstand für sich“ gemacht werden: als eigengeltender Gegenstand, z. B. weiß – Weiße. (Das habe ich in den Logischen Untersuchungen schon so angenommen, aber seitdem freilich öfters bezweifelt.) 2) Andere Gegenstände mögen als Explikate fungieren, aber sie können als eigengeltend erfasst sein, ohne vorher so fungiert zu haben, ohne entnommen zu sein – die „selbständigen Inhalte“, die konkreten. (Es wäre nun wohl auch relative Selbständigkeit zu erörtern?)

168

5

10

15

20

25

30

explikative und prädikative synthesen

Und nicht nur das, sie können, unbeschadet der Explikatstellung (also selbst in der Explikation), den Charakter der Eigengeltung haben. Das gilt wieder von den Konkreta. Ferner, ein Gruppengegenstand expliziert sich notwendig in „Gegenständen für sich“, das Explizierte hat von vornherein und notwendig den Charakter der Für-sich-Geltung.1 Also haben wir F ür- s ic h - G elt u n g i n ei nem D op p el si nn. Im Explikat betrachte ich, verdeutliche ich den Gegenstand, der expliziert wird. Insofern gilt er nicht für sich, wie der Hauptgegenstand es tut. Andererseits, ein Ding, mag es auch in der Explikation etwa einer Baumreihe auftreten, ist ein für sich geltendes: Ich brauche ihm keine neue Form zu geben, um es zum Objekt von Explikationen zu machen. Vielleicht könnten wir sagen: „Weiß“ ist seinem Wesen nach etwas Gehabtes, etwas, was auf der Prädikatseite steht. Ein Ding aber ist seinem Wesen nach etwas, was einen Seinsgehalt hat, es fordert seinem Wesen nach, so gesetzt zu werden wie ein Subjekt einer Explikation. Es fordert sozusagen Explikation; es lässt sie nicht bloß zu. So ist die Weise des Gegebenseins beiderseits eine wesentlich verschiedene. Diese zweite Selbständigkeit nennen wir das Objektsein, die ursprüngliche Substantivität. Endlich ist noch ein Drittes zu erörtern:2 Innerhalb einer Explikation kann ein Gegenstand ursprüngliche Substantivität haben, und zwar zugleich Explikat sein. Dann haben wir innerhalb der explikativen Synthese (wenn sie unmittelbar ist) zwei ursprünglich substantivische Objekte. Diese Objekte stehen in einer inneren Einheitsbeziehung, im einen expliziert sich das andere (natürlich in der aktuellen Explikation). Der Sinn des einen und der des anderen sind innerlich eins, sich, wenn auch nicht „total“, deckend. Und diese Deckung ist im Grunde keine Deckung. Denn Deckung ist ein Vorgang, in dem eines sich auf ein anderes, zunächst Getrenntes auflegt und so mit ihm eins wird. Hier aber haben wir das Gegenteil: Entfaltung; ein Objekt sondert sich im anderen und aus dem anderen. Nun ist es offenbar etwas wesentlich Neues, dass das, was sich aus einem Gegenstand herausgesondert hat, sich seinem Mutterboden

1 2

Cf. Πλ p. 6 f. = S. 182,26–184,15 f.. Cf. die Blätter vor 10a = vor S. 132,24.

text nr. 9

169

entfremdet, zu einem Gegenstand für sich gemacht und seinem Muttergegenstand als ein „Anderes“ gegenübergestellt wird. Und nun kann es sein, dass diese Gegenübergestellten in Bezug aufeinander ein Bewusstsein der Deckung begründen und Beziehung zwi5 schen Ganzem und Teil sich konstituiert; und natürlich braucht auch nicht eine Explikation vorhergegangen zu sein.1 Ich gehe von G zu T oder T zu G über und setze sie beziehend in ein Verhältnis, in eine äußere Einheit gegenüber der inneren, der explikativen. Was in Bezug zueinander tritt, das ist sich „äußerlich“, fremd, 10 jedes ein Fürsich, nicht nur jedes ein Objekt, sondern jedes abgeschlossen: ohne innere Einheit oder die innere Einheit ausgeschaltet.

15

§ 2. Die Frage nach dem Fundament des Relationsbewusstseins. Die sinnlichen Einheitsformen sind keine Relationen. Der Unterschied zwischen Kontrast- und Relationsprädikaten

Beirrend wirkte bei meinen Analysen die Unklarheit über das fundamentum relationis im alten Sinne. Es ist dabei mehreres auseinanderzuhalten: 20 1) Anstatt eine Relation wirklich im beziehenden Bewusstsein erfasst zu haben, in artikulierter, „eigentlicher“ Beziehungserfassung, kann ich auch, und ohne unmittelbare Anknüpfung an solch ein eigentliches Beziehen, in einem „uneigentlichen“ Beziehen, in einem verworrenen Bewusstsein ohne synthetische Produktivität, die Bezie25 hung erfassen, auf sie gerichtet sein. Es ist nicht ein originäres, sondern s e k u nd ä r e s Be w us s t s e i n de r Re l a t i on; ebenso bei jedem synthetischen Gegenstand (Gegenstand höherer Stufe). Dabei ist aber wohl zu beachten, dass dies verworrene, sekundäre Bewusstseinvon, obschon im weitesten Sinne ein Erfassen, Setzen, keineswegs ein 30 vergegenständlichendes im besonderen Sinne (ein nominales) sein muss. Ich kann in einem Blick eine Gruppe erfassen, und zwar auf die

1 Das hat nur Sinn, wenn wir darunter eben die beziehende Synthese verstehen, die den Sachverhalt „G hat T“ konstituiert.

170

5

10

15

20

25

30

35

explikative und prädikative synthesen

Gruppenglieder gerichtet sein in einem Zusammennehmen, ohne erst synthetisch aufgebaut zu haben und ohne Interesse für die Gruppe als Gruppeneinheit zu haben, und ebenso überall. Dabei kann im Voraus auch die begriffliche Fassung da sein; beim Aussprechen und Lesen freilich habe ich ein Nacheinander. Aber selbst da kann und ist sehr oft der Sachverhalt ohne Artikulation konstituiert. Die Setzung ist einfach, andererseits enthält sie oft mehrfache Setzungsstrahlen, mehr oder minder deutliche, die nicht den Charakter von wirklichen Setzungen haben, also in verworrener Weise. Es sind Modifikationen von Setzungen. 2) Was soll demgegenüber die Rede von „s i nn li c he n E i nh e it e n“ und s in nl i c h en E in hei t s fo rm e n (Gestaltqualitäten)? Wenn ich ohne artikulierte und wirklich vollzogene Synthese in einem Blick einen „Flecken auf dem Papier“ erfasse, so ist, was hier erfasst ist, keine sinnliche Einheit und keine Gestaltqualität, sondern eine einfache Setzung und Richtung auf die synthetische Gegenständlichkeit, ebenso wenn ich eine Menschengruppe in „einem Blick“ erfasse und auf die Menschen darin gerichtet bin. Andererseits finde ich in einer sinnlich erscheinenden Mehrheit, einer Menschenmenge, einer Allee „erscheinungsmäßig“ einen Gesamtcharakter und eine Einheit, die zu unterscheiden ist von der synthetischen und „uneigentlich vorstelligen“ Einheit. Fällt der Blick auf die Allee, so habe ich zweifellos nicht so viele intentionale Strahlen als Baumerscheinungen. Die Allee in ihrer gesamten Darstellung, als „Phänomen“, hat eine Einheit, in der sich die einzelnen Baumdarstellungen unterscheiden lassen (mehr oder minder deutlich). Von diesem Einheitscharakter, der der sinnlichen Einheit eben ihren Charakter gibt, meinte ich, dass er Anhalt der Assoziation sei bzw. die Ermöglichung der Auffassung als synthetischer (nicht bloß der Wortassoziation: eine Menge etc.). Für die Erforschung des Wesens der Erfassung von synthetischen Gegenständlichkeiten kommt das alles natürlich in Frage. Wo es sich aber darum handelt, das Wesen der originären Erfassung, der „eigentlich erfassenden“, aufzuklären, da spielt beides keine Rolle. Da können wir nur sagen: So geartet ist der Zusammenhang der betreffenden Erlebnisse und so geartet ist ihre Materie, dass im Übergang sich notwendig Relationsprädikate herausstellen und zunächst gewisse Formen der Synthesis. Sagt man, es muss eine Einheit da

text nr. 9

5

10

15

20

25

30

171

sein, so stellt der Übergang vermöge des Wesens der übergehenden Erlebnisse Einheit her, und auf die kommt es an. Was Schwierigkeiten macht: Wi e sic h das Rel at io n sb ew us stsein in Hi nsi c h t a uf sei n f u n da me nt um- Be wu ss t se in a u f k lärt. Es ist doch nicht in beliebiger Weise da, „vorhanden“. Genügt es zu sagen: Es ist eine Einheit von α und β bewusst, und eine inhaltlich eigenartige für jede Relationsart; sie kann komplex sein und mehrere Einheiten von α und β enthalten, und dann kann der erfassende Blick im Übergang beim zweiten Durchlaufungspunkt (dem α) entweder das komplexe Beziehungsmerkmal erfassen oder nur eins der komponierenden?1 Zum Beispiel, zwei qualitativ gleiche Töne, aber einer intensiver als der andere. Ich kann beim Ton α das „intensiver“ erfassen oder das „qualitativ gleich“. Wie ist es aber mit dem Fundamentbewusstsein, wenn sich die Relation synthetisch erzeugt? Ob ich darauf achte oder nicht, die Einheit ist vorhanden, und die Beziehungsprädikate sind „vorhanden“: in demselben Sinn? Sie sind verborgen, aber „da“. Was gehört aber dazu, damit das voll explizite Bewusstsein „α ρ β“, „α intensiver als β“ etc. zustande kommt? Muss erst ein Blick die Einheit treffen, die sich zunächst als Einheit aufgedrängt hat, als einheitlicher Komplex der Beziehungspunkte? Muss innerhalb dieser Einheit schon mindestens Abhebung, wenn nicht Sondererfassung statthaben? Bei sukzessiven Einheiten hieße das: Ein Blick muss die Sukzession als einheitliche abgrenzen und erfassen; habe ich auf die verschiedenen Töne und Geräusche nicht geachtet gehabt, so achte ich nachträglich auf sie und hebe eine Gruppe, hebe das Paar heraus in einem erfassenden Blick; habe ich geachtet, aber nicht festgehalten, dann muss die Umgrenzung und Zusammenfassung nachträglich noch erfolgen. Und dann das „Du r c h l a uf e n“. I s t da s w i r kl i c h n ö ti g? Genügt es nicht, den Blick auf das eine Glied der Einheit zu lenken, und es steht schon als „laut“ da. Im ersten Moment möchte man Ja sagen. Aber bald sieht man, dass es nicht geht, dass Durchlaufen nötig ist. Ich werfe ebenso bei simultanen Ganzen den Blick auf eine Häusergruppe, worunter eins besonders groß ist, und es steht im

1 Problem der komplexen Beziehungen und der Gegebenheit bloß einzelner Beziehungen aus diesem Komplex.

172

5

10

15

20

25

30

35

explikative und prädikative synthesen

besonderen Erfassen des letzteren Hauses dieses als groß, „sehr groß“ da. Nun, das ist sicher richtig. Andererseits aber haben wir damit noch kein Bewusstsein einer Relation (kein artikuliertes, deutliches und gar gebendes), kein primäres „Sachverhalts“-Bewusstsein „a ist größer als b“. Man muss K o nt ra st prä d ik a te unterscheiden von Relationsprädikaten. Es mag sein, dass Kontrastprädikate nur in Relationen objektive Gültigkeit haben können (wie alle sinnlichen Prädikate), aber sie sind nicht selbst Relationsprädikate (nicht kategoriale Prädikate). Ein großer Mensch ist groß (steht für mich als das da), auch wenn ich keinen kleinen daneben sehe. Sagt man nun, gegenüber den umgebenden Dingen tritt seine ungewöhnliche Größe, die eine andere ist als die der normalen Menschen, hervor, so mag das allenfalls sein, aber wir vergleichen nicht, „setzen nicht wirklich in Beziehung“; wir „vollziehen“ kein Relationsbewusstsein. Und so ist Gold „schwer“; wir haben den „a b so lu te n E i nd ruc k“ von Schwere, ebenso bei einer Gänsefeder das absolut erfasste Merkmal „leicht“, und so auch bei dem großen Baum innerhalb der Baumgruppe, dessen Größe im Kontrast sich aufdrängen mag, aber nicht im „in Bezug zu“ zu erfassen ist. Die sinnlichen Einheitsformen, die durch die sinnlichen „Gegenstände“ fundiert sind, sind keine Relationen. Und die sinnlichen Charaktere, die die Gegenstände „vermöge“ der Einheiten, vermöge ihrer Umgebung erhalten (was ein phänomenologisch Aufweisbares ist), sind keine relativen Bestimmungen. Zum Erfassen und Gegebenhaben von Relationen und Relationsprädikaten gehört es, in Hinblick auf eine vorhandene Einheit, das a zu erfassen, beziehend hinübersehen, beziehend übergehen zum b-Erfassen usw. Aber nun gilt es, tiefer dringend zu beschreiben. Wir sagen mitunter: A ist groß neben B, auch „im Vergleich mit B“. A ist klein gegenüber C. A ist laut „im Vergleich mit B“; leise im Vergleich mit C. Aber andererseits sagen wir: A ist größer als B, A ist kleiner als C. Wir sagen auch nicht: A ist gleich im Vergleich mit B, neben B. A ist ähnlich im Vergleich mit B. A ist Teil im Vergleich mit B. Wie klären sich diese Unterschiede auf? „Groß und klein“ können K on t r a st p rä d ik a t e sein. Wo A und B, das Große und Kleine in einem Bewusstsein gegeben sind, schon in einem schlichten Zusammenhaltungsbewusstsein, zeigt A das Merkmal „groß“, das ein

text nr. 9

5

10

15

20

25

30

35

173

inneres Merkmal fasst, und das B das Merkmal „klein“. Es bedarf nicht der eigentlichen „Vergleichung“, nicht der „Beziehung“ des A auf B oder des B auf A und der damit eintretenden „Überschiebung“, „Deckung“. Ja, es bedarf nicht einmal des Zusammenerfassens in Form der Zusammenhaltung. Kommt B auch nur im Hintergrund zur Abhebung, ohne dass es gegenständlich wird, so zeigt das A das Kontrastprädikat; es erscheint als groß. Ein „großer“ Mensch inmitten von kleinen Leuten, auf die ich gar nicht achte, und schließlich ein großer Mensch steht als groß da, ohne dass überhaupt in meinem Gesichtskreis kleine Leute sind; er kontrastiert mit dem normalen Menschen, von dem Exemplare dunkel „erregt“ sein mögen. Es ist weiter zu bemerken, dass zwei oder mehrere Objekte von gleicher oder verschiedener Größe durch die Größe eine „Gestaltqualität“ fundieren, dass Größe ein Einheit bildendes Moment ist, auf das geachtet werden kann. Das gilt auch von „sinnfälliger Gleichheit“, von Abständen, von verschiedenen Einheitsformen. Diese Einheitsformen sind noch keine Relationen. Eine Relation ist gegeben in einem „beziehenden“ Bewusstsein, einem A-Erfassen und beziehend Hinübersehen, beziehend Übergehen zu einem B-Erfassen. Bei den Ve r g l e i c hun g s re l a t io ne n bekommen die beiden vergegenständlichenden Akte Einheit durch eine „ü ber sch i ebe nd e D e ck u ng“, und in dieser Einheit, in der Erzeugung dieser Synthesis wächst dem A ein Merkmal zu: A ist in B, A ist gleich B, ähnlich B. Hier ist das Merkmal so geartet, dass es in der Tat das B einschließt, wofern es zu wirklich expliziter Gegebenheit kommt. Ebenso bei den A b s t a n ds r e l a t io n en un d Or dn un gsr ela t i o n en, wo das Einheitsmoment des Abstandes A und B „v er k nüp f t“, aber nicht ein Ganzes zur objektivierenden Setzung kommt, sondern das „A und B hat Verbindung“. Die Verbindung erscheint also als etwas, als eine Art Merkmal an der Gruppe (nicht, wie es zunächst scheinen möchte, an dem „A und B“, das hier gar kein Gegenstand ist). „An der Gruppe“ ist ein Ganzes, das diese Form einschließt. Und während die Gruppe erscheint, wird A zum Objekt für sich gemacht, und im Hinblick auf das zweite Objekt hat nun A das Merkmal: abstehend von B. Sowie ich das Verknüpfungsganze vom „Standpunkt des einen Gliedes“ auffasse, d. i. von der Totalerfassung zur „vergegenständlichenden“ Erfassung (Partialerfassung) des einen „Fundaments“ (Träger der Form) übergehe,

174

explikative und prädikative synthesen

zeigt es ein Merkmal, das sich wirklich konstituiert, wenn ich auf B vergegenständlichend hinsehe. Ich erfasse es wie ein Merkmal, als ein von A gehabtes, gehabt von A „in Bezug auf B“. Ebenso A rechts von B, über B etc.

Nr. 10 D ie We is en d er E rf as sun g und ih r er S yn th es i s1

§ 1. Die Konstitution einer gegenständlichen Einheit vor ihrer Erfassung. Das Verhältnis zwischen der Gesamterfassung eines Gegenstandes und der Sondererfassung seiner Teile und Momente. Die Hinwendung zum Gegenstand mit und ohne Explikation

5

10

15

20

25

Damit etwas, ein Gegenständliches „erfasst“, Gegenstand der Aufmerksamkeit sein kann oder des bloßen Bemerkens, muss es schon „konstituiert“ sein. Das Merken wendet sich ihm zu: Seinerseits „fällt es auf“.2 Ein starker Ton fällt auf und wird bemerkt. Ich wende mich ihm zu. Er steht als Einheit da, dauernd etc. Aber was heißt da „konstituiert vor dem Bemerken“? Wie trägt der Ton vorher seine Einheit in sich, bzw. wie konstituiert sich bewusstseinsmäßig Einheit des Tones vor dem Bemerken? Nun, in gewisser Weise trägt die Tonempfindung ihre Einheit in sich, in der Art, wie sich an das Moment des „Jetzt“ die Retentionen anschließen etc. Wir konstatieren das in Hinblick auf die Weise, wie sich das Bemerken und gar Aufmerken aus dem Tonbewusstsein „herauszieht“ und umgekehrt, wie es als ein Blickstrahl hineingeht und den „Gegenstand“ heranbringt und dabei zum aufgemerkten macht. Freilich sind das schwierige Sachen. Wie steht es mit transeunten Einheiten, z. B. die okkulomotorische Einheit eines Farbenflecks? Ist sie Einheit dank eines einheitgebenden, umgrenzenden Blicks? Aber wie soll der Blick einigen, wenn er nicht schon auf das Eine gerichtet ist? Die unter gleichen „Umständen“ immer wieder auftretenden Empfindungsinhalte organisieren sich nicht zu bloßen Folgen von Empfindungsinhalten,

1

19. 9. 1911. Über die Unterschiede der Aufdringlichkeit zwei Blätter in PPP zu Anfang = Husserliana XLIII/2, Beilage VII: Das Sich-Aufdrängen eines Objekts als Reiz zur Zuwendung (S. 188). 2

176

5

10

15

20

25

30

35

explikative und prädikative synthesen

sondern es konstituiert sich eine Einheit, und ihr wendet sich der Blick zu. In diesen Beziehungen bedarf es ausführlicher Erörterungen. Wic ht ig e Un t ersch ie de sind folgende: 1) E s kan n ei n E i nh ei t lic he s e rf as st w e rd e n, e i n Ge g e nst an d , so d as s k ei ne Te il e ode r Mo m e nt e a n i hm d u rch S on d er erf as sen a usg ez ei c h ne t si nd. Das Letztere wird zwar häufig der Fall sein, muss aber nicht der Fall sein. Zum Beispiel, ich erfasse im indirekten Sehen einen visuellen Gegenstand, der so „verworren“, so undeutlich erscheint, dass ich bei bestem Willen in ihm kaum etwas Besonderes unterscheiden könnte. Ich bin ihm dauernd zugewandt, ich verändere die Blickrichtung stetig, und stetig erscheint er mir als einer. Halten wir uns jetzt aber in der Sphäre des „deutlichen“ Sehens, in der Sphäre, wo das Erscheinende im Allgemeinen Möglichkeiten gibt, um vielerlei „Einzelheiten“ abzuscheiden und sonderzubeachten. Zum Beispiel dieser Aschenbecher hier: Ich bewege mich hin und her, nähere mich oder entferne mich und kann dabei o hn e S on d erb eac ht u n g v on E i nz el he i t en a uf d i e Ei n he i t de s Ga n ze n ger ic ht et s ein. Im Allgemeinen werden dabei Ei n z e l h e i t e n g e g e be n s ei n, sich schon entgegendrängen, aber doch nicht durch eigenes Für-sich-Erfassen herausgenommen. Ich kann also den Gegenstand überblicken und als Einheit in einer Kontinuität von Erscheinungen erfassen, aber ohne jede Verdeutlichung, mindestens zunächst, ein „Weilchen“. 2) Demgegenüber haben wir das a n a l ys i er e nd e B e t r ach te n d e s G eg ens t a nd e s, das Du r c h l a uf en seines Inhalts in immer neuen Heraushebungen und Für-sich-Erfassungen, aber auf dem Grund der Einheit der Gesamterscheinung und Gesamterfassung. Dabei haben aber sowohl die G es a m t e r fa s s un g wie die So nde rer fas s u ng ihre Eigentümlichkeiten. Man möchte hier fragen: Was ist denn dabei wirklich „gegenständlich“ erfasst, etwa zweierlei, der ganze Gegenstand und daneben der Teil, das Moment etc.? Ich betrachte den Gegenstand, diese Kupferschale. Mein Blick „durchläuft sie“; ich bleibe mit ihm jetzt einen Moment an der Umrandung hängen und an ihr wieder bei einer glänzenden Stelle, einer Abweichung von der gleichmäßigen Richtung. Dann springt der Blick über auf eine breite Glanzstelle und geht dann ein Stück weiter, dem wechselnden Glanz, der Glätte nach. Dann fallen die Buckel auf, und die Gruppe der Buckel ist gehoben; ich durchlaufe sie usw.

text nr. 10

5

10

15

20

25

30

35

177

Es scheint mir nun, dass man sagen muss, dass dabei immerfort nur ein ab gez i elt e r „Geg ens t an d“ ist, korrelativ: eine Einheit der Apprehension, eine Einheit der Erscheinung liegt zugrunde, in der eben Eines, ein Gegenstand, erscheint, und dieses Eine ist das Zielobjekt der Zuwendung1. Innerhalb dieses einen Gemeinten, nicht nur Gesehenen, sondern Abgesehenen, kommt nun bald dieses, bald jenes zu besonderer Heraushebung, zu besonderer Klarheit und Deutlichkeit. Aus dem Gesamtinhalt hebt sich etwas heraus. Manchmal hebt es sich bloß heraus; manchmal wird aus dem Inhalt des Erscheinenden und als Ziel Fungierenden, des eigentlichen Objekts der Aufmerksamkeit, ein Moment nicht nur herausgehoben, sondern auch „näher“ gebracht, wobei sich der Inhalt in dieser Hinsicht näher bestimmt und klärt, eventuell bereichert (ohne Bereicherung: wenn ich abwechselnd bei ruhendem Blick bald auf Umrandung, bald auf den Glanz „achte“, aber dem Gegenstand und nicht diesen Einzelheiten zugewandt bin). Wenn ich mich in diese Sachen so recht vertiefe, scheint es mir, dass nicht zweierlei und mehrerlei „Gegenstände“ zu unterscheiden sind, sondern, solange nichts weiter vorliegt wie dieses durchlaufende Betrachten der Kupferschale, nur ein „G eg en s ta nd“2. Aber was heißt hier Gegenstand? „Eigentlicher“ Gegenstand der Betrachtung, des Aufmerkens in einem ausgezeichneten Sinn, sollen wir etwa sagen S u bs t r a t? „Gegenstand“ ist die Schale, und sie ist es in den mannigfaltigen Erscheinungen, und sie kommt zur Gegebenheit nur in solchem „Durchlaufen“ und solchen in einheitlicher „Betrachtung“ geeinigten Erscheinungen. Dieser Gegenstand hat Gruppen von Eigenschaften, und er kommt nur zur Gegebenheit, wenn die betreffenden Eigenschaften in dieser Weise zur „Einzelerfassung“ kommen innerhalb der kontinuierlichen Einheit des Die-Schale-Betrachtens. Das „Gegebenheitsbewusstsein“ ist ein gewisses Erfassen des Gegebenen, und zwar sein Erfassen in kontinuierlicher Einzelbetrachtung, Näherbestimmung. Andererseits, die Erscheinungen könnten ebenso ablaufen, ohne dass der „Gegenstand“ wirklich „unser Gegenstand“ wäre und ohne dass er als Objekt der Betrachtung, der Erfassung, des Mit-ihm-sich-Befassens-und-ihn-Erfassens, zur Ge1 2

Zielobjekt = Substrat. = Zielgegenstand, Substrat.

178

5

10

15

20

25

30

explikative und prädikative synthesen

gebenheit gebracht wäre. Ich blicke etwa genau ebenso über die Schale hin, bin aber mit meinen Gedanken ganz woanders: Ic h b in a uf den G e gen st an d „ n ic ht a uf m er k sa m “. Es fehlt den Erscheinungen oft Zusammenhang und Einheit. Aber sie enthalten, aber uns „verborgen“, den Gegenstand. Er wird uns offenbar, es wird ein aktueller Gegenstand erst gegeben in der Hinwendung der Aufmerksamkeit und im Spiel dieser Aufmerksamkeitsmodi. Und diese Hinwendung gibt sich als Ich-Hinwendung, und das Ich wendet sich im eigentlichen Sinne „dem Substrat“ zu. Im Durchlaufen bin ich immer dem Gegenstand, dem Substrat, und nur ihm zugewandt. Und doch kommt von ihm das und jenes zu besonderer Beachtung? A l s o bi n i c h n i c h t d o c h de n E ig ens cha f ten , de n T e il e n z ug e w a n d t u nd si nd  s ie e ben fa ll s m e ine G eg en st änd e?1 Aber da ist die Sachlage eigenartig und schwer zu beschreiben. Die Teile sind nicht der „eigentliche Zielgegenstand“, nicht um ihretwillen, um ihrer selbst willen gegenständlich, die Farbe, der Glanz kein letztlich abgesehener Gegenstand. Wenn ich im durchlaufenden Blick am Glanz haften bleibe, ihn fixiere (eventuell im doppelten Sinn), so ist nicht der Glanz in letztem Grund mein Gegenstand, sondern die Schale, aber nach ihrem Glanz.2 Ist der Glanz wirklich mein „letztlich abgesehener“ Gegenstand, so ist es ganz irrelevant, ob er der Schale zugehört oder dem Samt. Dem Glanz als letztlich abgesehenem Gegenstand zugewandt zu sein, ist darin nicht der Schale zugewandt zu sein, sondern eben einzig und allein dem Glanz. Demgegenüber bin ich aber jetzt in der Hinwendung zum Glanz dem glänzenden Gegenstand, nämlich ihm, sofern er in diesem Glanz sozusagen sein Leben hat, zugewandt. Und so durchlaufend, durchlaufe ich eben ohne „eigene“ Vergegenständlichung der Teile und Momente immer den Gegenstand. Ich sehe ihn, indem ich mir ihn nach dem und jenem ansehe. Eine besondere Beachtung erfordert die Sonderung dieses Verhältnisses gegenüber der Synthesis, die das Relationsurteil voraussetzt. Und zwar handelt es sich um Synthesis hier von Ganzen und Teilen. 1

Gegenstände in gewissem Sinn ja, aber nicht Gegenstände der Betrachtung, nicht Substrate im prägnanten Sinn. 2 Ist das nicht eine Analogie mit dem Um-willen in der Gemütssphäre?

text nr. 10

5

10

15

20

25

30

179

Der Unterschied zwischen Explikand, Subjekt, Hauptsubjekt etc. fällt weg, wenn wir bloße schlichte Zuwendung haben. Aber von vornherein kann schon der Gegenstand als „Objekt des Interesses“, als thematischer, als nominales „Objekt“, gefasst sein, und das ist es bei Beginn jeder Explikation. Sollen wir sagen, ein Gegenstand sei Substrat auch da, wo sein Erfassen, die Hinwendung zu ihm, si c h n ic ht exp li z ier t, in keinem „Einzelbetrachten“ sich bietet? Gewiss, es ist ein Gemeinsames da: das dem Totalgegenstand Zugewandtsein, etwa während er sich nähert und entfernt, aber einmal ohne Explikation und das andere Mal mit Explikation. Im letzteren Fall haben wir aber das Eigentümliche der „Totalperzeption“ und, auf ihrem Grund, von ihr gleichsam umspannt und sich mit ihr deckend, die Partialperzeption. Herrschend-dienende Hinwendung waltet aber in beiden; andererseits eine Funktion der „Synthesis“ in einem gewissen Sinne. Dabei hat der stetig einheitliche Gegenstand der Totalzuwendung eine Auszeichnung: Er allein kann als Substrat bezeichnet werden (was hier beschrieben ist, ist die Nominalform, die des „Bestimmbares überhaupt“ gegenüber dem Subjekt). Doch die Terminologie macht Schwierigkeit. Wir sagen doch alle: Wir seien Gegenständen, sinnlichen Gegenständen, Zahlen, Sachverhalten aufmerksam zugewandt. Und mit mehr oder minder konzentrierter Aufmerksamkeit seien wir diesen Gegenständen zugewandt. Und was da Konzentration besagt, ist wohl im Allgemeinen etwas ganz anderes, als wir oben im Auge hatten, nämlich jenes bevorzugte, besondere, in der Regel näherbringende und bestimmende Betrachten von Einzelheiten, durch welches hindurch sich das aufmerksame Betrachten eines Substratgegenstandes vollzieht.

§ 2. Thematisches Meinen und Interesse. Das Sich-Näherbringen einer Gruppe von selbständigen Objekten durch Einzelerfassung ihrer Glieder

Es ist auch zu überlegen, wie jenes Objektivieren, Zum-ObjektMachen und -Haben, M i t -e t w a s -a l s- Su bs t r a t g e g e ns ta n dB es ch ä f ti g t s ei n zu dem steht, was ich wiederholt als th em ati sc he s Me i n e n beschrieben habe. Wenn ich im Theater bin, sind die 35 Vorgänge des Schauspiels, alles, was sich auf der Bühne „abspielt“,

180

5

10

15

20

25

30

35

explikative und prädikative synthesen

mein Thema. Die „störenden“ Vorgänge im Zuschauerraum, die meine Aufmerksamkeit gelegentlich „vom Thema ablenken“, sind eben nicht zum Thema gehörig. Jetzt, im wissenschaftlichen Nachdenken über gewisse schwierige phänomenologische Themata, sind diese, wie schon der Ausdruck besagt, das Thema, nicht aber die Stimmen, die von der Straße her meine Aufmerksamkeit vorübergehend erzwingen. Da s Th ema t i sc he i st aus g eze i ch net. Wir sprechen auch von Z uw en d un g m i t I n t e re s s e. Was das auch immer mit Recht besagen mag, eine phänomenologische Auszeichnung hat die thematische Objektivation gegenüber der Objektivation schlechthin. Objektivation nämlich, wenn auch nicht im besonderen Sinne des Themas, so doch im Sinne des Zum-Gegenstand-Habens, Auf-ihnspeziell-Gerichtet-und-mit-ihm-Beschäftigtseins, ihn betrachtend, eventuell einzelerfassend, ist beides. Im Fall eines „herrschenden theoretischen und praktischen Interesses“ sind es im Allgemeinen viele Objektivationen, die ihre Auszeichnung und Zusammengehörigkeit haben. Es kann hier vorkommen, dass eine einzelne Objektivation sich einmal so einordnet und unterordnet der Gesamtobjektivation, dass mit ihr das thematische Interesse im Ganzen sich auswirkt und in der Einzelbetrachtung die Intention auf das Ganze lebt und sich befriedigt (das Ganze dadurch nähergebracht wird etc.), und ein andermal kann sich die Einzelbetrachtung verselbständigen, den Faden zur Gesamtbetrachtung verlieren, ihr Objekt wird nun zum Objekt für sich, das nachträglich erst der Einordnung in das Ganze, der Erweiterung der betrachtenden Umspannung bedarf. Ich betrachte mit Interesse die Einheit eines vielgestaltigen Vorgangs, etwa einen Menschenauflauf. Einzelne Objekte sind da Objekte der Zuwendung und Betrachtung, und doch betrachte ich mit Interesse den ganzen Vorgang, den Menschenauflauf. Im einzelnen Betrachten übe ich zugleich Gesamtbetrachtung; auf das Gesamte bin ich gerichtet und durchlaufe seine gegenständlichen und für sich gegenständlich werdenden Einzelheiten. Aber doch sind sie nicht getrennte Gegenstände für sich, die etwa in Relation zur Gesamtheit gesetzt sind, sondern sie sind in der einheitlichen Gesamtbetrachtung einzeln betrachtete Glieder. Wir haben hier eine thematische Einheit, aber auch die Einheit einer Objektivation, eines Gegenstandhabens, Gegenstandbetrach-

text nr. 10

5

10

15

20

25

30

35

181

tens. In anderen Fällen thematischer Beschäftigung, wie in denen eines wissenschaftlichen Gedankengangs, ist es anders. Wir gehen etwa von Satz zu Satz über, und die Gedankenbewegung hat ein Ziel; wir zielen auf eine Schlussfolgerung. Wir durchlaufen hier nicht eine einheitliche Gegenständlichkeit, sie uns näher bringend und ihr beständig als Ganzem zugewendet als unserem Objekt. Im Beweisen bietet jeder Schritt ein Objekt, aber die vorangegangenen Schritte sind nicht von der Einheit einer umfassenden Objektivierung befasst, und jeder neue Schritt bringt nicht bloß das beständig bewusste Gesamtobjekt näher. Freilich, der gesamte Beweis ist eine Einheit. Das soeben Objekt Gewesene wird nicht außer Augen verloren, ich behalte es in gewisser Weise im Bewusstsein, es übt noch weiter seine gründenden Funktionen, ich muss eventuell darauf zurückgreifen, muss es daher noch behalten usw. Man könnte sagen: Ich habe da ein thematisches Ziel, das ich erreichen will und nur durch einen mehr oder minder unbestimmt aufgefassten Weg erreiche. Es ist wie bei einer Wanderung zu einem physischen Ziel; ich habe immer neue Wegstücke vor mir im reellen Blick. Alles gehört zu meinem Wanderungsthema. Im Voraus habe ich eine unbestimmte Vorstellung von einem gewissen Weg zum Ziel hin, die sich Schritt für Schritt bestimmt und in realisierender Anschauung in Aktualität und Realisierung verwandelt. Es kann sein, dass mich das Ziel gar nicht interessiert, dass ich den Weg nur gehe, um die Landschaft kennenzulernen (oder „ihn“ kennenzulernen). Nun, dann ist in der Tat der Weg selbst Thema und immerfort Objekt. Ebenso wenn ich einen theoretischen Weg als Thema habe: Ich will ein Buch studieren, und nun ist, was ich lese, immerfort mein Thema; jeder neue Gedanke ist zwar etwas für sich und doch aufgenommen als Glied des Gesamtthemas. Da spielen also überall W i ll e ns t e n d e nz e n ihre Rolle und Interessen wirklich als Gemütsphänomene. Thema ist alles, dem ich in Objektivation zugewandt sein soll bzw. was in den Kreis meiner Objektivation, meiner Gegenstandsbetrachtung und eventuell in den Kreis meines Urteilens, aber auch in den Kreis meines Fühlens und Wollens „hineingehört“. Das zu untersuchen (theoretische und praktische Themata, Objekte und Einheitszusammenhänge theoretischer, ästhetischer, praktischer etc. Interessen), ist eine Sache für sich (ein Thema für sich, ein Zusammenhang, der „ein eigenes Interesse fordert“).

182

5

10

15

20

25

30

35

explikative und prädikative synthesen

Schließen wir das aus, diese Fragen nach den durch eine Einheit des Interesses geeinigten und phänomenologisch ausgezeichneten Gegenständlichkeiten. Gehen wir nun auf das obige Beispiel zurück. Wir dachten uns ein einheitliches Interesse, gerichtet auf einen Menschenauflauf. Lassen wir das Interesse beiseite, und halten wir uns an die bloße „Objektivation“, d. h. an die bloße kontinuierliche Einheit der Gegenstandsbetrachtung, in welcher immerfort der Menschenauflauf gegenständlich ist und die Einzelbetrachtung nun selbständige Objekte, Menschen, betrifft. Hier ist es doch völlig klar, wird man sagen, dass es sich um Einzelerfassungen handelt, die selbst den Charakter von Objektivationen haben. Ich bin freilich nicht bloß den einzelnen Menschen zugewandt, sondern auch dem ganzen Auflauf; aber ich bin ihnen doch zugewandt, sie sind meine Objekte. Oder ich betrachte im Park eine B a u mg ru p pe. Ich betrachte sie, indem ich einzeln die einzelnen Bäume mir ansehe und sie wiederum betrachte. Ist unsere obige Beschreibung also richtig? Ich sagte dort doch, dass, wenn das Ganze und dann die Teile zu Gegenständen für sich gemacht würden, dass dann eine Synthese erforderlich sei, um sie zur Einheit zu bringen, wodurch sich in partialer Identifizierung ein Sachverhalt, ein Ineinander oder Aneinander konstituiere.1 Nun ist es doch klar, dass hier eine solche Synthese sich nicht vollzieht. Der uns interessierende Unterschied besteht offenbar auch hier. Die Baumgruppe in ihren Gliedern betrachten, den Menschenauflauf in Einzeldurchlaufung seiner Glieder betrachten, das ist nicht, ein Aktbewusstsein des Inhalts „eins im anderen“ vollziehen. Ich sehe aber doch, dass ich in meiner Darstellung ursprünglich nicht völlig korrekt gewesen bin (schon verbessert im Text). Man darf nicht sagen, dass die Einzelobjektivationen keine Objektivationen seien, sondern darauf muss man sich beschränken, einen bestimmten phänomenologischen Unterschied klarzustellen, der die Weise der Objektivation, die Weise des Zum-Gegenstand-Habens und des DenGegenstand-Erfassens-und-Betrachtens betrifft. In dem ursprünglichen Beispiel handelt es sich um ein einzelnes selbständiges Objekt, und seine Einzelbetrachtung führte auf dessen Glieder, dessen Formen, Farben und sonstigen „Eigenschaften“ oder Beschaffenheiten.

1

Cf. 5a = S. 124,33–126,21, es gehört mehr dazu.

text nr. 10

5

10

15

20

25

30

35

183

Im letzten Beispiel handelte es sich um eine Gruppe selbständiger Objekte, die aber als Gruppe ein Objekt der Erfassung und Betrachtung war.1 Selbs t änd igk ei t d es O b jek t s b es ag t ni c ht „ Se lb st ä nd ig k eit “ d er A u f f as su ng un d O b j ek ti va ti on. Ein selbständiges Objekt braucht überhaupt nicht eigenes abgesehenes Objekt einer Betrachtung zu sein, einer Zuwendung zu ihm und Beschäftigung mit ihm, einer Sondererfassung und Sonderbetrachtung. Es kann darum doch aufgefasst sein und kann z. B. aufgefasst sein als Einzelnes innerhalb einer Gesamtgruppe, die als Gruppe aufgefasst und erfasst, betrachtet ist. Es kann sich nun die Gruppe aufdrängen und eine Zuwendung zu ihr und ein Erfassen von ihr (als schlichtes Totalobjekt) statthaben, ein Erfassen, das die Gruppe in einem Schlage fasst, wobei das Einzelaufgefasste, nämlich das innerhalb der Gruppe als Glied fungierende Selbständige, in keiner auszeichnenden Erfassung erfasst ist. Nun gehört es aber zum Wesen eines solchen Objekts (bzw. korrelativ zum Wesen einer Gruppenerfassung), dass es „Näherbetrachtung“ zulässt, ein Näherbringen, ein Verdeutlichen und Klären, ein Erfüllen der „verworren-einheitlichen“ Auffassungsstrahlen und der durch diese Einheit hindurchgehenden Gegenstandserfassungen, und zwar ein solches Näherbringen, das sich durch die Einzelerfassung und -betrachtung der Glieder vollzieht. Die neuen Objektivationen, in denen sich dies vollzieht, d i e E i nz e le r fa s s u n g en u nd B e t r a c h t u ng e n de r G li e de r, s i nd i n g e w i ssem S i n n e un s e l bs t än d i g , s i e „ g e l te n n ic ht f ü r s ic h “. Sie machen zwar die Einzelgegenstände zu Gegenständen, aber nicht zu Gegenständen „an und für sich“ (um ihrer selbst willen); vielmehr in ihrer Einzelbetrachtung expliziert sich, verdeutlicht sich, bringt sich uns näher die ganze Gruppe, die beständig der Gegenstand an und für sich ist (eigentlich abgesehener). Eventuell kann das schlichte und verworren-einheitliche Gruppen-Auffassen und -Erfassen (wobei die Gesamtgruppe das Totalobjekt, das Substrat, ist) eine Gruppe betreffen, die selbst wieder in Gruppen sich gliedert, und dann fordert es das Wesen dieses Gegenstandes (bzw. das Wesen einer so gearteten Objektivation und Auffassung), dass zuerst die Untergruppen Erfassung

1

Cf. Z3 = S. 168,14–169,12.

184

explikative und prädikative synthesen

und Betrachtung erfahren und dann die Glieder dieser Gruppen.1 Dann sind die Erfassungen der letzten Glieder in höherem Grad, in höherer Stufe „unselbständig“; sie gelten nicht für sich, sondern zunächst als dienende Glieder der Objektivation der nächsthöheren 5 Stufe, und diese selbst wieder sind dienend mit Beziehung auf das einheitliche Gesamtobjekt. Immer haben wir zu unterscheiden s c hl ich t e u n d ex p liz ier en d e O bje k t i v at i o nen und innerhalb der explizierenden, die ihrem Wesen nach kompliziert sind, herrschende und dienende, wobei aber 10 die herrschenden in den dienenden herrschen und diese den herrschenden einverleibt sind. Eine dienende, einverleibte Objektivation objektiviert nicht als Objekt an und für sich, primär als Abgesehenes, sondern nur als Explikation eines selbständigen, herrschenden Objektivierens. Explikationen vollziehen, das ist nicht, „synthetische 15 Einheit“ vollziehen.

§ 3. Verdeutlichungsstellen als Residuen von vorherigen Partialerfassungen. Die Frage, ob sich Auffassungsartikulationen von Residuen unterscheiden lassen Wir können unterscheiden und haben oben schon unterschieden (p. 1 = S. 176): 1) Ein einheitliches Objekt, schlicht aufgefasst und zum eigenen Objekt gemacht, nichts von Gliederungen oder Hebungen in der Auffassung. 2) Tritt dann Einzelbetrachtung ein, wird das Objekt zum To25 talobjekt, auf dessen Grund Partialerfassungen statthaben, so ändert sich im Fortschreiten der Einzelerfassungen die Totalauffassung. Die Partialerfassungen sinken ab und neue werden aktuell: Ihre Objekte stehen „im Konzentrationspunkt der Aufmerksam30 keit“ (sind geistig fixiert). Aber das Totalobjekt steht nach den nicht

20

1

Wir könnten sagen: primäres, herrschendes Totalobjekt, sekundäres Objekt, erster oder zweiter etc. Stufe; Totalerfassung (Totalbetrachtung, Totalzuwendung), Partialbetrachtung in erster, zweiter Stufe.

text nr. 10

5

10

15

20

25

30

35

185

im Konzentrationspunkt stehenden Partien in anderer Weise da. Die „früheren Konzentrationen“ bzw. ihre Residuen haben noch ihre bevorzugten Objektpartien, und diese sind sozusagen auf das Totalobjekt aufgetragen, die Bevorzugungen in dasselbe eingetragen. Es hat nun „Bereicherungen“ und dabei Hebungen, Betonungen, und das Betonende sind die Ko n ze nt ra t io ns nac hl eb se l, d. i. die Überlebsel der Partialerfassungen auf dem Grund der damaligen Totalerfassung. Das Objekt ist verdeutlichtes Objekt, es hat Verd eut l ic hu ngs st el len, und eventuell immer neue. So wenn ich diesen Aschenbecher näher betrachte, jeden Buckel der Verzierungen, die Farbe, jede Glanzstelle etc. Im Einheitsbewusstsein „decken sich stetig“ die immer neuen Explikationsgestaltungen, sie decken sich, sofern immerfort die Totalerfassung Totalerfassung „desselben“ ist, desselben, das jetzt so und dann so expliziert, partial geklärt und verdeutlicht war und in eigenartiger modifizierter Weise es mit jedem Schritt ist, sofern das Vergangene eben seine Nachlebungen hat, die sich als Betonungen jetzt bekunden. (Das „Infolge“, das das Bekunden andeutet, ist etwas Phänomenologisches!) Vielleicht ist das noch feiner zu beschreiben. 3) Ist der ganze Prozess abgelaufen, und w en de i ch m i c h e i ne m a n d e r e n Ob j e kt zu, kehre nun aber wieder zu meiner Kupferschale zurück, s o t r ä g t di e j et z i g e A u f f as s un g n oc h di e Z üg e d e s w i e de r a uf l e be n de n P r oz es s e s: nämlich die Auffassung ist nicht einfach verworren-einheitliche Auffassung, sondern ich finde in der erscheinenden und zum Gegenstand der eigenen Zuwendung gemachten Einheit die verdeutlichten Stellen, Abhebungen einzelner Buckel, Abhebungen der vorhin in Partialerfassung bevorzugten Glanzstellen etc. Ob klar bewusste Erinnerung an das frühere Partialauffassen und Durchlaufen vorhanden ist oder nicht, sicher ist, da ss in ne r h al b d e s v e r w o rr en - ei n h e i t l i ch e r fa s s t e n O bj e k t s, da s k e i ne P a rt i a l e rf a s s u n g e n a k t ue l l t r ä g t, St e l l en de r G e h obe n h e it s i n d, un d z w a r g a n z ä hnl i c h w i e w äh r e nd e i ne s E x p l ik a t io n sp r o z e ss e s: abgesehen von der in aktueller Explikation hervorgehobenen Stelle. 4) Und so werden wir überhaupt im Allgemeinen, wenn auch nicht immer, bei der schlichten (nicht explikativen) Objekterfassung eine Anzahl Verdeutlichungsstellen haben, sozusagen kataleptische, die innerhalb der Gesamtauffassung Sonderauffassungen besagen,

186

5

10

15

20

25

30

explikative und prädikative synthesen

und nicht bloß Sonderauffassungen, sondern eigentümliche Modifikationen von Sondererfassungen, die nicht den Charakter von bloßen Erinnerungsvergegenwärtigungen haben: Sie gehören zu dem lebendigen Bestand derjenigen Objektauffassung, die der Totalerfassung zugrunde liegt. Das Objekt steht nicht nur überhaupt da, sondern als das dieses und jenes habende: obschon in verworrener Weise, nicht in explizierter, was besagen würde, in einer Explikationskette neu erzeugt. Das Objekt hat natürlich noch manches andere, was erst die Explikation herausstellt. Aber als dieses Habende ist es noch nicht besonders bewusst, während trotz der Ungeschiedenheit der Zuwendung (sie ist Totalerfassung ohne Explikation) in Bezug auf seine Buckel, Lichter etc. schon Sonderung statthat. Wir haben also D eut li c hk e it als: a) Abhebung, bessere oder minder gute Abhebung innerhalb der Auffassung, in modifizierten Aktcharakteren (Erfassungscharakteren) bestehend.1 b) Demgegenüber eine andere Deutlichkeit, eine originäre, die darin besteht, dass Partialerfassen Schritt für Schritt statthat, dass in jedem Schritt etwas partial erfasst ist, aber alles Übrige in lebendiger Nachwirkung als Deutlich-Gewordenes und in das Totalobjekt Eingetragenes. Das besagt aber nicht das Eigens-im-Griff-Behalten. In Wiederholung des Prozesses wird die Verdeutlichung immer vollkommener, die Abhebung immer lebendiger und schärfer, die Verfügung darüber in der vergegenwärtigenden Rückwendung immer freier. Der „schlichte“ Blick auf das Objekt, in verteilter Aufmerksamkeit, nicht am Einzelnen haftend und sich darin konzentrierend, enthält eine Reihe scharf markierter Hebungen im Objekt, schärfer als vordem. 5) Wir werden sagen dürfen: W a nn i m m e r e in s c hl i cht er f as s te s T ot a l o bj e k t i n de r s ch l i ch t e n E r f a s s ung g e gl i ed er t da s te h t o de r g a r a l s e i ne Gr u p pe , Me n g e d a st e ht , da i s t d ie G l i ed er u n g ko n s t it ui e r t d u r c h e in e g e g l i e de r t e Au ff a ss un g , d i e ih r e rs e i t s i n Mo ti v a t i on e n v on P a r ti a l e r f a s s ungen i h re Q u e l l e h a t. Es liegt gewissermaßen da s a bg ek ür z t e E r geb n is e in e s P r oz e ss e s v o n E i n z e l a uf fa s s un g e n i n Tot al e rf as s u ng e n, in beständiger Einheitsdeckung des totum und der

1 Der erscheinende und schlicht erfasste Gegenstand (als solcher) hat kataleptische Momente.

text nr. 10

5

10

15

20

25

30

35

187

Teile in den sich modifizierenden Einzelauffassungen vor. Es liegt eine „Au f f a ssu ng sin t en t ion“ vor, die sich erfüllt in der Reaktivierung eines solchen Prozesses. Zum Beispiel, ich erfasse eine Allee in einem Blick als Allee. Jeder Baum hat seine Auffassung darin, das totum ist in der Auffassung artikuliert, obschon nur eine Totalzuwendung da ist. Freilich ist die Frage, wie weit man darin gehen darf. Wenn ich den Teil der Allee nehme, der ins deutliche Sehen fällt, und die Bäume, die scharf dabei auseinandertreten, so mag das gehen. Aber der Teil der Allee, der indirekt gesehen wird und deutliche Unterscheidung der einzelnen Bäume nicht gestattet? Nun, ich hätte da einzelne Hebungspunkte, in der Totalobjekterfassung einzelne Sonderauffassung; für das Übrige aber nur die vage Meinung gerichtet auf einen Prozess von Sonderauffassungen: so, wie ich bei dem wirklichen Durchlaufen der Baumreihe eine Reihe artikulierter Erfassungsresiduen habe, aber darunter liegend eine unbestimmte Intention, die ihrem Wesen nach wieder Aktualisierung findet durch eine Reihenexplikation. Ich meine aber, es ist ein Unterschied, ob ich ein vages Totalobjekt habe mit einer völlig unbestimmten Intention auf irgendwelche Einzelerfassungen, auf mögliche Partialbetrachtungen oder ob ich ein gegliedertes Totalobjekt habe, wo schon bestimmte Intentionen auf bestimmte Einzelerfassungen vorgezeichnet sind. Dabei ist es allerdings noch öfters zu überlegen, ob man wirklich sagen darf, dass sich die Nachlebungen, die „Residuen“ der Einzelerfassungen, in das Totalbild eintragen und es gliedern, ob also, wenn wir jetzt aufblicken und die Allee ansehen, die Auffassungsartikulationen mit solchen Residuen phänomenologisch zu charakterisieren sind, oder ob nicht vielmehr zu sagen ist: Im Explikationsprozess verbleiben natürlich von jeder Sonderzuwendung Residuen, aber das Ergebnis des fortschreitenden Explizierens bestehe in einer mit jedem Schritt geänderten Totalvorstellung, die in ihrer Materie Artikulationen hat, und schon diese seien zu unterscheiden von den Residuen der Partialerfassungen; und erst recht, wenn wir einen ersten Blick auf eine Gruppe werfen oder auf ein gegliedertes Ganzes, so haben wir in der Materie der Zuwendung eine Artikulation, aber keine Residuen. Wenigstens spielten die nicht die wesentliche Rolle, wenn sie überhaupt da seien. Zum Wesen einer solchen Vorstellung gehört es natürlich, dass sie Explikation zulässt und dass die sich

188

explikative und prädikative synthesen

in Ketten von Einzelerfassungen selbständiger Objekte vollzieht etc. Das alles ist also zu überlegen.

5

10

15

20

25

30

35

§ 4. Die Einheit der Zusammennehmung gegenüber der Einheit des Bewusstseins von kontinuierlicher Totalerfassung und schrittweisen Partialerfassungen bei der Explikation Es kann sein, dass ich eine Gruppe in einer ungegliederten Zuwendung (aufgrund gegliederter Auffassung) erfasse. Es ist aber etwas anderes, dies zu tun (und eventuell auch die Gruppe zu durchlaufen und so die ursprüngliche Gruppenvorstellung zu explizieren), demgegenüber aber ein Kolligieren zu üben, eine Zusammennehmung zu vollziehen. Willkürlich fasse ich dieses Buch und jenes andere Buch zusammen, greife sie aus dem Bücherhaufen heraus und nehme sie zusammen, oder dieses Buch und diesen Aschenbecher usw. Ich vollziehe da eine Zuwendung (Eigenerfassung) des einen und die eines anderen, aber nicht bloß das. In einer Zusammenfassung tue ich beides und betrachte ich jedes dieser Dinge. Das eine jetzt „vorwiegend“ in Betracht ziehend, halte ich das andere fest, dann das andere betrachtend, halte ich jenes fest. Ich halte fest, das ist, ich halte sie erfasst: Die erfassende Zuwendung als Einsatz, als Aktivum ist eins, das Im-Fassen-Halten ist das Dauernde, und dieses geht dann eventuell über in spontane Akte der Explikation. Das in die zweite Linie Gedrängte verbleibt aber in der Erfassung, und das ist das Festhalten. So ist in einem Akt beides erfasst, der eine Akt hat zwei Gegenstände, beide eigens erfasst und beide als Totalobjekte in Partialerfassungen Explikation erfahrend, wenn auch nacheinander. Kann ich sagen, diese Einheit der Zusammennehmung, der Kollektion, hat einen Gegenstand, das Paar, die Kollekte der beiden Gegenstände? Ich denke, eigentlich kann ich das nicht sagen. In einem abgegrenzten Bewusstsein bin ich eigens dem einen und eigens dem anderen Objekt zugewandt und nichts weiter. Ich kann dann, während ich die Erfassung festhalte, abermals, und zwar eine neue Zusammennehmung üben, jetzt die des Tintenfasses und eines Geräusches, das ich gerade höre; oder ich halte die beiden ersten Objekte

text nr. 10

5

10

15

20

25

30

189

in der Erfassung und blicke auf ein drittes Objekt hin als Objekt für sich. Die Verbindung der beiden ist damit nicht gelöst. Es ist etwas anderes, das dritte Objekt in die Verbindung aufzunehmen oder neben den sonderverbundenen beiden Objekten ein neues Objekt in Betracht zu ziehen. Und nun habe ich eine Einheit der Erfassung in der Form ((A, B), C), ebenso ((A, B), (C, D)) usw. Wieder ist da zu sagen: Jede solche komplex gestaltete Erfassung hat zu Objekten A, B, C, … und nicht etwa (A, B) als ein Objekt und dgl. Andererseits kann ich doch auch den Blick der Zuwendung und Erfassung richten auf das Paar, auf das eine und das andere Paar, wo dies die Objekte sind. Und tue ich das, dann fungiert die wiederholte einzelkonzentrierte Zuwendung, das konzentrierte Partialerfassen jetzt des A und dann des B, als Explikation, als Partialerfassen eben (Durchlaufen) des Totalobjekts A+B. Sehen wir näher zu, so hat das Vorstellen (A, B) den Vorrang vor dem kollektiven (A+B), in dem der Inbegriff Gegenstand ist. Nämlich, um den Inbegriff „gegeben“ zu haben, um ihn betrachtend in Selbstgegebenheit zu erfassen, muss ich das A und das B erfassen, und in der Einheit dieser Erfassung zweier Gegenstände konstituiert sich sozusagen als ihr Ergebnis der neue Gegenstand als etwas, was ich nun erfassen kann, und was ich nun in der Einzelerfassung der A, B explizieren kann. Man könnte einwenden: Das sei nicht so, Gegenbeispiel sei jede sinnlich erfasste Menge. Man würde antworten: Das seien komplexe Gegenstände, die zu kollektiven Zusammennehmungen Anlass geben und zur Bildung von rein kollektiven, aber das seien nicht selbst solche. Das reine Zusammen, der reine Inbegriff, die reine 2 setzten voraus ein Zusammennehmen, und erst als Ergebnis lässt sich herausfinden und in einem neuen Blick erfassen eben die „kategorial“ neuartige Gegenständlichkeit, die reine Inbegriffsgegenständlichkeit.1 Ich kann ferner A betrachten und in eins damit B betrachten, aber nicht bloß das: A erfassend und den Blick nun auf B richtend sind beide nicht nur zusammengenommen, sondern sie haben auch öfter eine „Relation“

„Kategorial“ darf man hier aber nicht sagen. Ein Beispiel bieten: Ich vollziehe drei Zusammennehmungen (A, B), (A’, B’) etc. und richte den Blick nun auf jedes Paar, vor allem Denken. 1

190

5

10

15

20

25

30

35

explikative und prädikative synthesen

zueinander. Die Zusammennehmung gerade des A und des B (die notwendig entweder als aufmerksame Erfassung die Form hat des Übergangs von A zu B oder umgekehrt) fundiert die gebende Erfassung eines „A in Relation zu B“ bzw. des B in Relation zu A, wenn die Einheitsform der Verbindung beider in Betracht gezogen wird. (Die Einheitsform ist nicht Gegenstand, aber sie tritt in den „Kreis der Beachtung“, und Gegenstand ist A und B, nicht jedes für sich, sondern A in Bezug auf B: das Gegenständliche des Übergangs von A zu B in der Einheit.) In welcher Weise aber? Nun, ein Ganzes, das ist ein Gegenstand, der Teile zu unterscheiden, der Partialerfassungen zulässt. Das soll jetzt keine Definition sein. Jedenfalls, damit Ganzes und Teil gegeben sein sollen, müssen Total- und Partialerfassungen vollzogen sein. In der Explikation fortschreitend, wird eine Partialerfassung nach der anderen vollzogen, aber auf dem stetigen Grund „derselben“ Totalerfassung, die durchgehend ein Einheitsbewusstsein ausmacht. So ist die kontinuierliche Totalerfassung und sind die schrittweisen Partialerfassungen alle miteinander einig. Und wir können korrelativ auch sagen, das Ganze selbst, der Totalgegenstand, sei einer und umschließe in seiner Einheit die Partialgegenstände, er erfahre in seiner stetigen Einheit immer neue Artikulationen. Di e s e E in h ei t de s B ew us s ts ei ns, die hier waltet, is t ni c ht z u v e r we c h s el n m i t d e r E i nh ei t e in er Z u s a mm e nn e h mu ng , Z us a m m en f a s s u ng. Denn im Für-sichErfassen und Explizieren eines Gegenstandes G habe ich eben nur einen „Gegenstand für sich“, nicht mehrere. Das Zusammengenommene ist jedes Gegenstand für sich. Nun kann aber a priori eine Zusammennehmung zwischen G und irgendeinem auf seinem Grund einzeln erfassten T etabliert werden. Nun ist das T auch Gegenstand für sich. Es bestehen für die Zusammennehmung natürlich verschiedene Möglichkeiten. Ich kann die Eigenvorstellung T zuerst haben und dann die Eigenvorstellung G bilden oder die Eigenvorstellung G zuerst und dann die Eigenvorstellung T. Der Übergang von der einen zur anderen ist noch kein Zusammennehmen. Der Übergang von G zu T und ebenso ihre Zusammennehmung werden, eben weil es sich um Ganzes und Teil handelt, einen phänomenologischen Charakter haben: Es decken sich in gewisser Weise die Gegenstände; die Gegenstandsauffassungen haben eine gewisse Gemeinsamkeit.

text nr. 10

5

10

15

20

25

30

191

Offenbar ist aber das Erlebnis darum doch ein anderes, wenn ich auf G explizierend gerichtet bin und die Partialerfassung des T, aber nicht Eigenvorstellung des T vollziehe. Durch die Partialerfassung erfasse ich hier das G eben nach diesem Bestandstück T. Damit verdeutliche ich das G.1 Habe ich aber die beiden Gegenstände G und T für sich in eins genommen und weiter nichts, so haben sie zunächst miteinander nichts zu tun in der Erfassung, obschon die Auffassungen von G und T im Verborgenen sozusagen sich decken. Es ist, wenn es mir noch gar nicht einfällt, G und T in Bezug zu setzen, auch nur zusammenzunehmen, und ich nur von einem zum anderen übergehe, auch schon ein inhaltliches Verhältnis da: Der Substratgegenstand verengt sich bzw. erweitert sich, und das gibt natürlich dem Übergangsphänomenen seinen Charakter. Bei der Betrachtung des G und der Explikation verengt sich, wenn ich von der Gesamtauffassung zur Partialerfassung übergehe, nicht der „Gegenstand“, vielmehr das Licht der Partialbetrachtung fällt auf den Teil und sondert ihn, während das Substrat verbleibt, aus diesem in dem Sonderakt aus. In anderem Sinne kann man aber auch sagen, dass eine Gegenstandsverengerung statthat: Denn hier decken sich zwei Akte, deren einer einen engeren Gegenstand hat als der andere (nur ist es nicht beiderseits Gegenstand für sich). Dagegen beim bloßen Übergang von der Betrachtung des A zu der des B sind sich die erfassenden Akte fremd, obschon sie den Objekten ihrer Auffassungen nach sich überschieben. Bei der Verengerung lasse ich das Weitere in seiner umgrenzten Einheit fallen, bei der Erweiterung die Grenzen des Engeren. Explizierend, von der schlichten Auffassung des G übergehend zu Partialauffassungen und eventuell dann wieder von den Einzelerfassungen rückkehrend zu einer schlichten Gesamtauffassung, treten die Akte als Erfassungen (und ihre Fortlebnisse) in eine innere Erfassungseinheit, das heißt, die Erfassungen als solche durchdringen sich: In der Partialerfassung expliziere ich ja die G-Erfassung; und immerfort in der Kette der

1

Bloßer Übergang von G und T (jeder Gegenstand für sich) und Zusammennehmung, verglichen mit Fällen der Synthese, der inneren Erfassungseinheit, zunächst mit dem Fall der Explikation.

192

5

10

15

20

25

30

35

explikative und prädikative synthesen

Partialerfassungen bewege ich mich „innerhalb“ der G-Erfassung, habe ihren neuen artikulierten Inhalt usw. Demgegenüber bleiben die Erfassungen trotz der im Übergang sich bekundenden gegenständlichen Gemeinschaft in der „Zusammennehmung“ einander äußerlich. Dasselbe gilt erst recht, wenn ich Teil und Teil in Eigenerfassungen erfasse und zusammennehme. Das Ganze mag erscheinen, mag auffassungsmäßig bewusst sein, aber es ist gar nicht erfasst und so auch nicht dies, dass das eine und andere Teil ist, und dass sie koordinierte, sozusagen verbündete Teile sind: obschon der Umstand, dass sie es sind, den Charakter der Selbst- und Eigenerfassungen der Teile und den Charakter der Übergänge bestimmt. Der Akt der Zusammennehmung hat davon nichts in sich aufgenommen: als Zusammennehmung. Was ist nun zu leisten, dass die Relation „G hat T“, und zwar in dieser, mit dem Satz angedeuteten Form und vor allem Begreifen, zum Bewusstsein kommt? Ich muss G zum Gegenstand für sich machen und T zum Gegenstand für sich: Das ist gewiß. Muss ich Zusammennehmung üben? Das ist zunächst zweifelhaft. Sicher ist aber vorerst, dass ich T in G erfassen muss. Ist es nun so: Ich vollziehe die Für-sich-Erfassung des G und die Partialauffassung (wie bei der Explikation) des T, erfasse dann T für sich, halte aber die Für-sich-Erfassung des G aufrecht? Das würde aber eine bloße Zusammennehmung werden, wenn die Innerlichkeit der Partialerfassung innerhalb der G-Erfassung verlorenginge. Auch sie halte ich also aufrecht? Das kann nur so verstanden werden: I ch h a lt e da s R es ul tat d e r Ex p l i k a t i o n f e s t; das G als das nach T Explizierte tritt zusammen (und wird eins in einer Synthese der Deckung der Für-sich-Erfassungen) mit der Für-sich-Erfassung des T. Das letztere Für-sich-Erfassen grenzt ab als ein Für-Sich, was in G partial Erfasstes und es Explizierendes war und in dieser Hinsicht noch im Griff ist, und deckt sich inhaltlich in dieser Beziehung mit dem G hinsichtlich seines ausgezeichnet erfassten Teils. Allerdings scheint es mir, dass zuerst G sich hinsichtlich des T expliziert, T selbst erfasst wird und dass dann noch einmal Selbsterfassung des G statthat und nun Übergang zur Selbsterfassung des T, aber nicht als bloße Zusammennehmung, sondern als Sy n t he s i s de r pa r ti al e n De c k un g: die dadurch statthat, dass das selbsterfasste

text nr. 10

5

10

15

20

25

193

T als Partialerfasstes1 in seinem Selbst zugleich als etwas vom G Erfassendes bewusst ist. Fragt man nun, ob man wirklich sagen kann, dass hier eine Zusammennehmung eine wesentliche Rolle spielt. Man kann ja schließlich jedes synthetische Bewusstsein, in dem Für-sich-Erfassungen zur Einheit kommen, als Zusammennehmungen bezeichnen. Aber es sind eben nicht bloße Zusammennehmungen. Überall, wo Synthesis statthat, kann auch erst bloße Zusammennehmung statthaben: wie auch in unserem Fall des Verhältnisses von Ganzem und Teil. Ich kann erst bloße Zusammennehmung üben. Aber das ist doch nicht nötig. Man kann wohl nur sagen, dass in jeder Synthesis eine Zusammennehmung „liegt“, es ist darin beides schon für sich vorstellig, aber doch noch nicht in eigentlicher Zusammennehmung, die eben bloß darin besteht, leer „zusammenzuhalten“, ohne Synthesis. Synthesis scheiden wir also von Zusammenfassung, das Eigene der Synthesis ist das „Innerlich-sich-Einigen“ der Für-sich-Erfassungen gegenüber dem bloß einheitlichen Für-sich-Erfassen von mehrerem in einem Bewusstsein, und zwar ein Innerlich-sich-Einigen, das zugleich auseinanderhält und verbindet und dabei einen verbundenen Gegenstand konstituiert: T in G etc. Gehen wir vom Teil zum Ganzen über, so haben wir das Relationsbewusstsein T in G (statt G hat T). T ist Teil von G. Hier ist es klar, dass ich, T festhaltend als für sich, den Blick erweitern und zum Erfassen und Selbsterfassen des G erweitern muss. Das für sich gesetzte T deckt sich mit dem in G verdeutlicht-abgehobenen T. Man darf nicht verwechseln: explizierender Übergang von G zum (T) und dann eventuell Verselbständigung des T mit der synthetischen

1 „Zugleich als Partialerfasstes“? Die Partialerfassung ist vorüber, aber sie hat ein „Ergebnis“: das hinsichtlich T verdeutlichte G, und fortdauernd bleibt das Ineinander der entsprechenden Akte im Griff. Indem aber erneut Für-sich-Erfassung des G, das nun verdeutlichtes G ist, und dazu Für-sich-Erfassung des T vollzogen wird, analysiert sich die Ursynthese, und dabei werden G und T nicht zusammengenommen, sondern der Blick richtet sich auf „G hat T“ oder „T in G“. Das neu, aktuell erfasste, verdeutlichte G mit dem ihm aufliegenden verdeutlichten Teil und das neu objektivierte T haben eine neue, originär sich konstituierende Einheit, und der Blick geht in dieser synthetischen Setzung von G aus auf das darin verdeutlichte T und geht auf das „habe“, das ein Erfassen desselben und darin ein neues Setzen des T erfordert. Vgl. 5a = S. 124,33–126,21.

194

explikative und prädikative synthesen

Erfassung des „G hat T“. Dies setzt das Resultat der Explikation voraus, und genau dasselbe Resultat setzt die synthetische Relationserfassung „T in G“ voraus. Das Ergebnis der Explikation ist oder liefert das fundamentum relationis im alten Sinne? Jedenfalls, 5 es liegt zugrunde, und was sich darauf konstituiert, ist beiderseits im Verhältnis der Umkehrung. Also, die Relation T  G ist eine „Umkehrung“ der ursprünglicheren Sachlage „G hat T“. Ob ich G als T habend oder T als von G gehabt erfasse: Immer muss zunächst eine Einheit des Totalbewusstseins 10 vorliegen, in dem sich Partialbewusstsein etabliert (das Explikationsbewusstsein). Weiter bedarf es, wie wir sehen, neuer Selbsterfassung, nämlich der des T. Es bedarf einer erneuten Originär-Erfassung des G und einer neuen, aber geänderten Originär-Erfassung des T. Aber einmal geht der originär selbsterfassende und mit der Selbsterfassung 15 Synthesis übende Blick von G zu T, das andere Mal von T zu G: eine Synthese, die ihre Richtung hat von T zu G, während im anderen Fall die Richtung geht von G zu T.

20

§ 5. Die schöpferische Konstitution des Inbegriffs im Zusammennehmen und seine ihn zum Gegenstand machende Objektivation

In der Zusammennehmung A und B haben wir zwei Gegenstände im prägnanten Sinn. Aber wir können eine eigene Objektivation bilden: das Zusammenkommen, der Inbegriff von A und B. In der Beziehung (dem Beziehen) haben wir mindestens zwei Gegenstände (die 25 Beziehungspunkte), aber es ist nicht etwa das Korrelat des Beziehens, die Beziehung, gegenständlich. Es ist „bewusst“, ist „konstituiert“ und doch nicht „vorgestellt“ in einem besonderen Sinn, nicht zum Objekt gemacht, „objektiviert“. Das Zusammennehmen und das Beziehen objektivieren inso30 fern, als sie schöpferisch Gegenstände konstituieren. Wir sagen daher lieber, sie sind gegenstandskonstituierend, und sie heißen so, weil ihrem Wesen nach aus ihnen d u rc h O bj e k t i v a t i o n Ge g e ns tä nde z u en t n eh m e n, Gegenstände als ihnen eigentümliche, durch sie geschaffene, zu Gegenständen für sich zu machen sind. Das Objekti35 vieren ist ein „den ‚Blick‘ auf das richten, was in ihnen ‚vorhanden‘ “

beilage xvi

195

ist. Es ist vor-handen; es ist aber nicht in Händen, ist nicht ergriffen, und das Ergreifen ist das Objektivieren. Demnach ist Wah rn ehm u n g ein gegenstandserfassender, ein objektivierender Akt, wofern wir unter Wahrnehmung nicht das bloße 5 Bewusstsein eines leibhaftig und wirklich erscheinenden Dinges verstehen (oder sonst einer Sache, die wir lieben, als wahrgenommen zu bezeichnen), sondern ein das so Erscheinende für sich Zum-ObjektMachen. Die Erscheinung konstituiert den Gegenstand, die Objektivation macht ihn zum Gegenstand, das heißt, in der Erscheinung, 10 durch die nicht der fassende Griff der Objektivation geht, ist ein Gegenstand „vorhanden“, aber Gegenstand-Sein im prägnanten Sinn ist nicht Vor h a nde n-, sondern Zuhanden- oder vielmehr I n- Hä nd en S e i n. Das weist auf meinen Begriff der nominalen Vorstellung hin. In jeder nominalen Setzung ist ein Gegenstand objektiviert, mag sie auch 15 mehr sein als Objektivierung. Und jeder objektivierte Gegenstand ist nominaler, sofern er zugleich begriffen und dann nominal begriffen werden kann in einer nominalen Setzung.

Beilage XVI Unterschiede der Aufmerksamkeit. Die Artikulationen der Erfassung1

20

Auf m e r ks a m ke i t: 1) D as s c h lich t e E rf as s en u nd jed e r lei Er f as s e n (eventuell vorher schon das Abgehobene, aber noch nicht Erfasste); 2) d as Er f a ss e n e in e s Z i el ob j e k ts, des thematischen Objekts, Substrats (alles dasselbe); 25 3) vorher da s t h e ma t is c h e E rf as s e n ü b er ha u p t: Zielobjekt, aber auch „in Betracht gezogenes“ Objekt usw. Jedes theoretisch Objektive: Aufgemerktes; danach auch v e r s ch i ed e n e r S in n vo n U n ter s c h ie d en d er A u f me r ks am k e it. Wir haben zu unterscheiden: 30 1) A r t ik ul a tio n en i nn e rh alb d e r Au ff as su n g, die nicht Artikulationen der Zuwendung, der Erfassung sind oder sein müssen. Die Artikulation besteht eventuell darin, dass in der Einheit eines Aufgefassten mehrere Objekte „mehr oder minder stark“ abgehoben sind.

1

Wohl September 1911. – Anm. der Hrsg.

196

explikative und prädikative synthesen

2) A rt ik ula t io n en de r Z uw en d u ng, der Erfassung. a) Ist die Zuwendung eine thematische, so haben wir in der Einheit des thematischen Aktes verschiedene Glieder, und zwar fürs Erste ein oder mehrere Hauptsubstrate. Noch allgemeiner könnten wir, wenn wir schon hinein5 ziehen die thematischen Zuwendungen höherer Stufen, nämlich die Zuwendungen zu den konstituierten Sachverhalten, die thematischen Sachverhalte Hauptglieder nennen, während die Rede von Substraten auf schlichte Explikationen oder auf konstituierte Sachverhalte schlichter Art zurückweist. (Ich habe da im Auge den Bau von zusammengesetzten Sachverhalten aus 10 Sachverhalten; im einfachen Sachverhalt singuläre und plurale Subjekte.) Gliederung ist aber nicht bloß Abgliederung von Substraten, sondern b) es gibt auch Glieder, die nicht Hauptsubstrate sind oder eigentliche Substrate: das „in Bezug auf“. c) Darin wieder Unterschiede zwischen dem, was nominal aufgefasst ist in 15 der Form eines möglichen Bestimmungssubjekts, aber nicht gerade wirklich als Subjekt etc.; Form des Bestimmbaren und was nicht so aufgefasst ist.

Beilage XVII Rezeptive Zuwendung und Zuwendung zu einer synthetischen Einheit in und mit ihrer Erzeugung1 Nach diesen Ausführungen gibt es Erfassungen in sehr verschiedenen Modi. Die Erfassung der schlichten Zuwendung überhaupt, und zwar der Zuwendung auf ein passiv Vorgegebenes; die thematische Erfassung in schlichter Zuwendung auf ein passiv Vorgegebenes, und die Passivität immer vorausgesetzt, die thematische Erfassung des Explikanden innerhalb einer Ex25 plikation, die Erfassung des Explikats in der Explikation. Die synthetisch artikulierte Erfassung eines Sachverhalts, die produktive Erfassung. Die reflektive Erfassung des Sachverhalts, der zugleich originär konstituiert ist: Der Sachverhalt ist dabei in ähnlichem Sinn „Objekt“ möglicher Explikation wie ein passiv aufgenommener Gegenstand. Ein Sachverhalt kann aber auch in verworrener Weise aus dem Dunkel 30 auftauchen. Ich wende mich ihm zu; es kann sich um eine Erinnerung handeln: „Ich komme zurück“ auf eine Prämisse, die ich vorhin festgestellt habe, und sage etwa, mit Rücksicht darauf ist diese Möglichkeit ausgeschlossen etc.; dabei bin ich dem Sachverhalt von neuem zugewandt, aber um ihn zu

20

1

Wohl September 1911. – Anm. der Hrsg.

beilage xvii

5

10

15

20

25

30

35

197

explizieren, muss ich ihn mir zu „artikuliertem Bewusstsein“ bringen, zu originärer Erfassung, die zunächst keine „objektivierende“ ist. Es kann aber auch sein, dass auch sonst in Wiedererinnerung und außer Zusammenhang eines kontinuierlichen theoretischen Gedankenzusammenhangs (thematische Einheit) ein Sachverhalt „auftaucht“, ein dunkles Sachverhaltsbewusstsein, und dass ich mich dem Sachverhalt zuwenden kann.1 Welche Terminologie soll ich wählen? Wir wollen vielleicht unterscheiden: rezeptive Zuwendung, Zuwendung zu einem Vorgegebenen (Rezipierten), produktive Zuwendung, Zuwendung zu einem Produzierten in und mit der Produktion. Ich erfasse, was jemand aussagt (auch, wenn ich keine Anschauung habe). Ich erfasse einen dunkel auftauchenden Sachverhalt einer dunklen Sachverhaltsvorgegebenheit (dunkles Vorhandensein): Ich wende ihm meine Aufmerksamkeit zu, ich erfasse in diesem Sinne. Erfassung als theoretischer Akt niederer und höherer Stufe, als objektivierender Akt im bestimmten Sinn. Gibt es noch andere Akte? Und das Nicht? Das Vermutlich, Fraglich. Ablehnung, Vermutung, Frage, Wunsch. Neue Spontaneitäten, Zuwendungen in einem neuen Sinn: Nicht-Erfassungen. Die Rezeption kann eine gebende (oder quasi-gebende) und eine nicht gebende, eine aus Synthesis herstammende oder nicht herstammende sein. Ist die Rezeption eine gebende (oder quasi-gebende), so lässt sie Explikation zu. Ist die Rezeption aus Synthesis herstammend, so kann sie Reflexion auf eine artikulierte Synthesis oder auf eine unartikuliert bewusste, „unlebendige“ Synthesis sein. Reflexion auf artikulierte Synthesis verschafft eine Zuwendung, die explikabel ist. Doch fragt es sich, inwiefern artikulierte Synthese und anschauliche sich unterscheide. Und das Gebiet der Begrifflichkeit haben wir noch nicht betreten. Erfassen, sagte ich immer. Es wird auch gesagt, Zuwendung, Gerichtetsein auf ein „Gegenständliches“. Es ist nicht zu verwechseln mit Wahrnehmung, es handelt sich um Modi der Aufmerksamkeit. „Erfassende“ Aufmerksamkeit ist nicht Erfassen im Sinne des Wahrnehmens, aber ein „Setzen“, theoretische Setzung. Zuwendung ist ein allgemeines Den-Blick-auf-etwasgerichtet-Haben. Hauptsächliche Besonderungen sind Zuwenden zu einem Gegenstand im besonderen Sinne des Gegenständlich-Habens, d. i. Zuwendung zu einem einheitlich Vorgegebenen (rezeptive Zuwendung; Erfassen

1 Dabei Sich-Hinwenden als Sich-Hinwenden zu einer „Nebensache“, Sich-Hinwenden als Sich-Hinwenden zu einer Hauptsache, zu einem Thema, und Hinwenden im Thema ist nicht immer Hinwenden schlechthin, Hinwenden als zu einem Substrat, Explikat etc.

198

explikative und prädikative synthesen

als spontane Tätigkeit und noch bleibendes Im-Griff-Behalten). Diese Spontaneität kann aber Glied weiterer Spontaneitäten werden, die immerfort Zuwendungen sind, und mit denen sich eventuell Zuwendungen auf synthetische Einheiten herstellen in ihrem synthetisch-sukzessiven Aufbau, zu der 5 sich Reflexion gesellt: Das synthetisch Erzeugte gibt etwas vor, was sich in „neuer“ Zuwendung erfassen lässt, in der Weise rezeptiver Zuwendung.

Nr. 11 D ie K on st i t u t io n von S a ch ve rh al t e n u nd i h r en F orm en i n Ex pl i ka t io n en u nd dar au f grü n den de n p rä d ik ati ve n D en k sy n t h es en un d D en kf or mu n ge n1

5

§ 1. Die bestimmende Prädikation als eigenschaftliche und als relative. Das absolut Adjektivische gegenüber dem relativ Adjektivischen

10

15

20

25

30

Man spricht von beziehendem Denken, man nennt alles bestimmende Prädizieren auch ein „Beziehen“. Inwiefern findet also in aller bestimmenden Prädikation in der Tat ein „Beziehen“ statt oder liegt ein solches zugrunde? Andererseits darf doch der Unterschied zwischen relativierenden Prädikationen (solchen, die relative Sachverhalte als Korrelate haben) und nicht-relativierenden (irrelative Sachverhalte) nicht verwischt werden. Es wird sich hier darum handeln, die verschiedenartigen „Synthesen“, die beiderseits zum Ausdruck kommen, zu klarer Gegebenheit zu bringen, beiderseits zurückzugehen auf die Übergangsgestaltungen, die vor der schöpferischen Gestaltung durch das eigentlich synthetische „Denken“ (und sonach auch vor dem Ausdrücken) liegen, und nun das Gemeinsame zu markieren, das die Rede vom Beziehen berechtigt, und andererseits den Doppelsinn herauszustellen, der diesem Begriff anhaftet, sofern die spezifische Rede von Beziehung auf die Relation hinweist, die nur einen besonderen Fall von den im „beziehenden“ Denken sich konstituierenden Sachverhalten anzeigt. Es sind doch offenbar Unterschiede, ob ich sage „a ist weiß“ oder ob ich sage „a ist größer als b“. Sachlich stehen sich hier gleich das „weiß“ und das „größer als b“. Beides sind die Bestimmungen, die dem Subjekt im Sachverhalt zukommen. Im einen Fall ist innerhalb des Sachverhalts auf Seiten der Bestimmung ein „Gegenstand“ gesetzt, in Bezug auf den dem Subjekt das „größer“ zugesprochen wird,

1

Wohl September/Oktober 1911. – Anm. der Hrsg.

200

5

10

15

20

25

30

explikative und prädikative synthesen

welches nun wieder in besonderer Weise dem „weiß“ gleichgestellt ist. Einerseits wird parallelisiert das „weiß“ und das „größer b“, als Prädikate, als das, was das Subjekt ist, als seine „Bestimmung“; andererseits wird parallelisiert das „weiß“ und das „größer“, und es wird gesagt, das „weiß“ kommt dem Subjekt schlechthin, absolut zu, als innere Bestimmung, das „größer“ kommt dem Subjekt zu als relative Bestimmung, nicht absolute; sie hat eine Unselbständigkeit, abgesehen davon, dass sie als Bestimmung ein Subjekt fordert; sie kommt dem Subjekt nicht schlechthin, sondern in Bezug auf ein Objekt zu. Einmal heißt relative Bestimmung das bloße „Relat“, das aber in der synthetischen Setzung eine Unselbständigkeit hat, die das „in Bezug auf b“ mitzusetzen fordert, während die innere Bestimmung, die absolute Adjektivität, diese Art Unselbständigkeit nicht hat. Im anderen Fall heißt relative Bestimmung das Relat mit seiner notwendigen Ergänzung.1 Es ist die Frage, welche Analogie tiefer reicht, das heißt, es ist die Frage, ob im primären und ursprünglichen Sinn der Begriff die Bestimmung „weiß“ und „größer …“ umfasst oder „weiß“ und „größer als b“. Es ist dabei aber vor allem auch die Frage, wohin eigentlich das „als b“ gehört. Einerseits wird man sagen, natürlich primär zu b: „größer als b“ ist ein Prädikat, wir bilden ja nominal das Größer-b-Sein und sagen, es komme dem a, dem a’, es komme eventuell allgemein vielen Subjekten zu. Andererseits könnte man aber auch sagen: a, in Bezug auf b betrachtet, ist größer; im Vergleich von a und b ist a größer, b kleiner. Gegenüber b ist a größer, gegenüber c kleiner. Aber das sind nicht so einfache Gedanken wie „a ist größer b“. Aber sie deuten vielleicht auf etwas hin. Jedenfalls ist es wichtig, sich darüber klar zu werden, was für eine Stellung das „als b“ hat. a ist (größer im Vergleich mit b), oder a ist größer (im Vergleich mit b). Wir sagen auch: a in sich selbst ist weiß, rund etc.; es hat Eigenschaften; a in Bezug auf andere Gegenstände hat äußere Beschaffenheiten. Müsste ich, um „weiß“ zu prädizieren, vervollständigen: „a in sich selbst ist weiß“ oder „a ist weiß an und

1

Relative Bestimmung als Prädikat – relative Bestimmung als Relat. Das absolute Adjektivische: weiß. Das relativ Adjektivische: gleich, ähnlich, größer, lauter; unter b, tiefer als b, neben b, benachbart mit b.

text nr. 11

5

10

15

20

25

30

201

für sich betrachtet“; ebenso wie ich sage „a ist größer in Bezug auf b“? Man könnte in Bezug auf all das auch fragen: Ist vielleicht zu scheiden das Pr ädi ka t und das A d je k t ivi s ch e? Versteht man unter Bestimmung Prädikat, das, was von dem Subjekt ausgesagt, auf die Subjektsetzung hin gesetzt ist, so ist „größer als b“ Prädikat oder Bestimmung. Andererseits, das Adjektivische, könnte man sagen, ist nicht immer das Prädikat. Weiß als Prädikat, das ist eine als Prädikat gesetzte Adjektivität. Aber in den relativen Prädikaten haben wir eine Adjektivität, die mit etwas verbunden ist, was nicht Adjektivität ist. Das „größer als b“ wird dem Subjekt zugesprochen, das steht fest. Andererseits aber wird es nicht dem Subjekt adjiziert oder ist nicht als bloßes Adjektiv erfasst. Das Adjektivische ist das „an“ dem Subjekt Erfassbare bzw. Erfasste; so das „weiß“ aufgrund der eigenschaftlichen Explikation, aber auch aufgrund des Relativierens das „größer“, „gleich“ etc. Aber das „als b“ ist nichts an dem Subjekt, auch nicht „größer als b“ vollgenommen. Damit wird allem Wesentlichen genügt sein. Das „als b“ gehört ins Prädikat und ist im Prädikat eins mit dem adjektivischen Kern, den es als Relatives fordert. Das schließt nicht aus, im Gegenteil, das fordert, vermöge der total verschiedenen „Form“ des Adjektivischen und des bezüglichen Objekts, dass sich das eine und andere in sehr verschiedener Weise auf das Subjekt bezieht. Das Adjektiv ist am Subjekt; was aber das bezügliche Objekt anlangt, so geht ein beziehender Blick von Subjekt zu Objekt etc., und auch im Sachverhalt bzw. der Sachlage gehen besondere Linien von Subjekt zu Objekt. Und das drückt sich in den obigen Redewendungen aus, welche das adjektivisch Gesetzte vom bezüglichen Objekt getrennt zum Ausdruck bringen. Es ist da noch genauer phänomenologisch zu forschen. Es scheint doch, dass das Adjektivische für sich sozusagen erfasst, eben dem Subjekt adjiziert wird auf dem Grund der beziehenden Ineinssetzung. Aber wie kommt die Einheit des Prädikats „größer als b“ zustande?

202

explikative und prädikative synthesen § 2. Die Frage nach den kategorialen Grundformen von Prädikaten. Ist die Bestimmung durch Teile eine Sonderform des eigenschaftlichen Bestimmens?

5

10

15

20

25

30

35

Absolute und relative Beschaffenheiten. Eine Prädikation, eine bestimmende Prädikation, bestimmt, was ein Gegenstand ist. Sie kann 1) einen Gegenstand, ein Subjekt, bestimmen nach dem, was er an und für sich ist, nach seinem Eigensein, nach seinen Eigenschaften, nach dem, was ihm nicht in Bezug auf „anderes“, sondern eben „an und für sich“ zukommt. 2) Eine bestimmende Prädikation kann eine relative sein, sie kann vom Subjekt aussagen, was es in Bezug auf irgendwelche andere Gegenstände ist, bestimmen, was ihm in Bezug auf diesen anderen zukommt. Nun besteht hier eine Zweideutigkeit. Wohin sollen wir die Bestimmung durch Teile rechnen? Wenn wir aussagen „S hat T“, sagen wir damit aus, was der Gegenstand „an und für sich“ ist oder was er in Bezug auf „anderes“ ist? a) Dieser Gegensatz kann so verstanden werden, dass das Prädikat „rein dem Gegenstand selbst entnommen“ sein soll bei der Bestimmung des ihm „an und für sich“ Zukommenden und nicht durch ein beziehendes Hinübergehen zu „anderen“, d. h. dem Subjekt nicht als Teile einwohnenden Gegenständen und ihren eventuellen Teilen und Momenten. Dann würden alle absoluten adjektivischen Prädikate wie „weiß“, ebenso aber auch alle Bestimmungen durch Teile auf der einen Seite stehen, auf der anderen Seite die relativen Prädikate, die nichts von Teilen enthalten. (Man würde dann auch dazwischen die Relationen finden, die zwischen Gegenständen bestehen, die sich kreuzen etc. Die würden natürlich ins zweite Glied gehören.) Man kann nun selbstverständlich in dieser Art objektiv vorgehen, also von der Erwägung aus, dass ein Gegenstand in sich selbst seine Teile hat, die ihm eigen sind, und seine „unselbständigen Momente“, die für ihn adjektivische Eigenschaftsprädikationen ermöglichen; weiter, dass der Fall möglich ist, dass für die Prädikation das in Betracht gezogen wird, was sich ergibt, wenn wir beziehend zu Gegenständen übergehen, die nicht Teile des Subjekts, des zu bestimmenden Gegenstandes, sind (Stücke, Glieder, innere Momente). b) Aber sehr viel wesentlicher ist ein anderer Gesichtspunkt. Wir fragen nicht, was sich objektiv von einem Gegenstand durch Heran-

text nr. 11

5

10

15

20

25

30

203

ziehen seines eigenen Inhalts oder auch fremden Inhalts aussagen lässt, sondern wir fragen nach den k ate gor i a le n Gr un d fo rm en vo n Präd ik at en. α) Lässt sich etwa sagen, dass das Bestimmen eines Gegenstandes aus ihm selbst,1 ein „eigenschaftliches“ Bestimmen, eine Grundform der Bestimmung ausmacht, der inneren, irrelativen Bestimmung, dass „Eigenschaft“ etwas ist, was sich aus phänomenologischen Gründen in grundverschiedener Weise konstituiert gegenüber der relativen Bestimmung, dass demnach das Bestimmen in Bezug auf „andere“ Gegenstände eine zweite Grundform des Bestimmens ist (und korrelativ der Bestimmung)? β) Und ist es vielleicht so, dass das eigenschaftliche Bestimmen eine allgemeine Form ist, die zwei Sonderformen enthält, die adjektivische Eigenbestimmung (Korrelat: die adjektivische Eigenschaft) und die substantivische Eigenbestimmung (Korrelat: die Teile), oder ist das nicht der Fall, womit gesagt wäre, dass das „S hat P“ zu den relativen Bestimmungen gehört? Ferner, wenn das Erstere statthat, dass der substantivischen Eigenbestimmung mit der Form „A hat T“ a priori entspricht eine relative Bestimmung als ihr Äquivalent und dass das Wesen der relativen Bestimmung mit dem Sich-Beziehen auf „andere“ Gegenstände mit dieser „Andersheit“ auf eine Form hinweist, die ebenso gut etwas erfahren kann, was als Teil in dem Subjekt ist, als was außer ihm ist?2 Wir hätten dann, der eigenschaftlichen Form der Teilprädikation (dem eigenschaftlichen Sachverhalt, den wir den teilschaftlichen im Gegensatz zu dem im engeren Sinne eigenschaftlichen, nämlich adjektivischen, nennen könnten), ausgedrückt als „A hat B“, entsprechend eine relationelle Form „A enthält B als Teil“, „A ist Ganzes von B“, wie umgekehrt „B ist Teil von A“.3 Der teilschaftliche Sachverhalt, würde man dann sagen, lässt sich nicht umkehren, der relationelle aber, wie jeder relationelle, lässt sich umkehren. 1 1) „Bestimmen aus sich selbst“, das kann eben entweder heißen, das Subjekt ist der einzige „Gegenstand“ dabei, die einzige logische Substanz, oder es ist mehr als eine substantivische Gegenständlichkeit dabei. 2) „Aus ihm selbst“ kann aber auch heißen, man geht in identifizierender Deckung, und zwar totaler oder partialer Deckung, nicht über den Gegenstand hinaus. 2 Das habe ich gemeint, es ist aber nicht richtig. 3 Nein.

204

5

10

15

20

25

30

explikative und prädikative synthesen

Nun ist aber zu bemerken, dass, was die relationellen Bestimmungen anlangt, wir auch bei ihnen den Unterschied des Adjektivischen und Substantivischen haben: A ist ähnlich B, A hat Ähnlichkeit mit B. Wir müssten dann sagen: Jede Bestimmung, ob sie relativ oder irrelativ ist, hat entweder die Form adjektivischer Bestimmung oder die Form des Gehabten, die nominalisierte Adjektivität. (Das nominalisierte Adjektiv Weiß ist nicht zu verwechseln mit der Farbe Weiß.) 1 Sie hat entweder die Ist-Form oder die Hat-Form, also auch für Teilrelationen: A ist Ganzes von B, A hat Ganzes von B-Sein. Nun finden wir aber bei den Teilen das Eigentümliche, dass sie, wenn sie „unselbständig“ sind, als „Fundamente“ für eine Adjektivität dienen sollen, dass sie vermöge ihrer Unselbständigkeit als Momente prädestiniert sind zu Bestimmungen irrelativer Art, und dass, wenn sie selbständige Teile sind, sie ungeeignet sind als Bestimmungsfundamente; sie sollen vielmehr nur als Gehabtes fungieren können, aber Gehabtes, das nicht aus einer Substantivierung eines Adjektivs entstanden sein soll. Das alles ist phänomenologisch tiefer zu überlegen. Jedenfalls ist zu beachten, dass die Unterscheidung der Bestimmungen in innere (irrelative, eigenschaftliche) und relative eine kategoriale, die logische Form angehende ist, während es eine ganz andere Einteilung ist, wenn wir gegenüberstellen konstitutive und nicht-konstitutive. Die konstitutiven sagen von einem Gegenstand aus, was aus ihm selbst geschöpft ist, die nicht-konstitutiven, was nicht. Das ist keine Einteilung aus der logischen Form. Um nun die Verhältnisse, die phänomenologisch bei relativen und irrelativen Bestimmungen vorliegen und bei Bestimmungen überhaupt, allseitig zu klären, beginnen wir mit den inneren Bestimmungen, und da werden wir phänomenologisch zurückgewiesen auf die Explikation (die innere Auseinanderlegung, innere Explikation), diese merkwürdige Kontinuität verdeutlichender und „kenntnisgebender“ bzw. „kenntnisnehmender“ Betrachtung eines Gegenstandes.2 Wir fassen einen Gegenstand für sich ins Auge und b l i c ke n i n i hn h i n ei n; wir durchlaufen in einem kontinuierlichen Einheits-

1 2

Vgl. Blatt I–III = S. 285,23–290,3. Gut.

text nr. 11

205

bewusstsein, was uns dabei zu einem besonderen Erfassen kommt. Die erfasste Einzelheit, die insofern nicht für sich gilt, als sich in ihr der Explikand verdeutlicht bzw. in ihr zu erweiternder Kenntnis kommt, kann selbst wieder Explikation erfahren und wird dabei in 5 Relation zu den daraus gezogenen Explikaten zum relativ für sich Geltenden, aber nur relativ; wie denn auch das Explizierte mittelbar den Hauptexplikanden expliziert, der sich in ihm in seiner Besonderheit zeigt.1 Auch Gruppen von Einzelheiten können in gleicher Stufe als relativ für sich geltende Gegenstandseinheiten erfasst und 10 in einer Gesamtform erfasst werden. (Es ist auch zu bemerken, dass selbst Beziehungen solcher untereinander und dass eigenschaftliche Prädikationen vollzogen werden können und dass dabei solche voll ausgearbeiteten Prädikationen explikativ fungieren können, kenntnisgebend, während dabei die auf den Hauptexplikanden bezogenen 15 Prädikationen unterbleiben.)2

§ 3. Einstufige Explikation. Die schon in der bloßen Explikation auftretenden Formen gegenüber den spezifisch prädikativen Denkformungen Wir beschränken uns auf Explikate erster Stufe (bzw. Explikationen) und wollen studieren, wie sich aufgrund solcher Explikationen Denksynthesen bilden, Sachverhalte einfacher Art konstituieren, Subjekte als Träger von Bestimmungen, und zwar Prädikationen der Art wie „G ist α“ und „G hat A“. Es ist von vornherein klar, dass das Mit-Heranziehen von Explikationen höherer Stufe komplexere 25 Formen ergeben würde, mit reicher gebauten logischen Formen wie „S hat A, welches m ist“, „S hat A, welches ρ B ist“ und dgl. Dabei treten in zweiter Stufe auch die Relationsformen auf, welche wir in erster Stufe erst studieren müssen, aber wie sich bald zeigt, nicht in der inneren Explikation, sondern aufgrund der äußeren relativierenden 30 Explikation.

20

1 Dieses absolute und relative Für-sich-Gelten macht den Unterschied zwischen Subjekt und dem bloß zur Bestimmung dienenden Objekt (dann immer Relation); das Gemeinsame ist dabei die Substantivität. 2 Das ergibt dann die attributiven Bestimmungen.

206

5

10

15

20

25

30

35

explikative und prädikative synthesen

Was die erste Stufe der Denksynthesen anlangt, die auf schlichter einstufiger Explikation beruhen, so nehmen wir auch da den einfachsten Fall, nämlich den, dass nicht „Ergebnisse“ von Explikationen hineingezogen werden in Denkfassung in neuen Explikationen bzw. in die Denksynthesen; wir schließen, deutlicher gesprochen, jederlei Attributionen aus. Also, etwa von G ausgehend als Explikand, vollziehen wir einen ersten und einzigen Schritt der Explikation gegen a hin, wobei a die herausgehobene Einzelheit ist, in der sich G „expliziert“, sei es, dass es sich bloß verdeutlicht, sofern das G schon das a in seinem „Sinn“ enthält, sei es, dass es sich in dem a bereichert, in kenntniserweiternder Weise bekundet. Statt dass nun die Explikation weiterginge zu neuen Einzelheiten, in denen das G sich immer von neuen Seiten zeigt, vollziehen wir eine dem Wesen nach hier immer mögliche Einstellung. Im explizierenden Übergang hat das G etwas erfahren, es ist nach ihm das explizite G, das verdeutlichte, das nach dieser Seite a zur Kenntnis gekommene, und wenden wir uns von neuem ihm zu, so steht es in offenbar neuer Weise da. Und es steht als das da, sofern wir es nicht bloß von neuem ins Auge fassen, sondern in Bezug auf das noch im Griff verbleibende Explikat a ins Auge fassen, und wir können nun in einer neuen Form den Übergang von G zu a vollziehen; es kommt uns (weiter lässt sich wohl hier nichts sagen) der Sachverhalt „G ist a“ zum Bewusstsein, wobei G die Form des Subjekts, des Untergesetzten, hat, a die des Daraufhin-Gesetzten: Auf dem Grund der Subjektsetzung vollzieht sich die Prädikatsetzung derart, dass sie nicht bloß zwei aufeinandergelegte Setzungen sind, sondern eine Einheit der Setzung, indem sich eben das „G ist a“ oder „Das ist das“ konstituiert. G wie a haben dabei ihre Formen im Sachverhalt und werden im Allgemeinen irgendwie begriffen sein, etwa als „Dies ist weiß“ (wofern wir keine attributiven Bestimmungen heranziehen wollen und damit zusammenhängend Erkenntnis unter Begriffen). So viel muss man sich von vornherein klarmachen: dass es ein wesentlicher Unterschied ist, bloß explikativ von G zu a und dann eventuell in kontinuierlicher „Betrachtung“ immer wieder zu neuen Explikaten überzugehen und andererseits Denksynthese zu vollziehen, in welcher allererst das G zum Gegenstand-worüber wird, zum

text nr. 11

5

10

15

20

25

30

35

207

Gegenstand einer Untersetzung, der als solcher eine korrelative syntaktische Form hat innerhalb einer einem Sachverhalt eigentümlichen Gesamtsyntax. Und in dieser hat auch das a seine syntaktische Form, wie dann auch das „ist“ hervortritt als ein unselbständiges, die Art der Einheit des Sachverhalts mit ihren beiden Gliedern kennzeichnendes Moment. Was für Formen sind das nun, die in diesem einfachsten Fall auftreten können? Wir fragen wohlgemerkt nicht nach den Erlebnissen und auch nicht nach den Themata, sondern nach den gegenständlichen Formen, und speziell nach denen auf Seiten des Prädikats. Das Prädikat ist eine allgemeine Form des hier sich konstituierenden Sachverhalts. Aber wie steht es mit dem Explikat a, kann es nur auf eine Art in die Prädikatform eintreten oder auf mehrere Arten, und hängt es vom Inhalt des a nicht ab, in welche Formen es überhaupt eintreten kann bzw. in welche es zunächst eintreten muss? Es macht nun offenbar einen wesentlichen Unterschied für die Form des in der Denksynthese erfassten Sachverhalts aus, ob das Explikat die Form eines „eigenen Gegenstandes“, sagen wir geradezu eines nominalen Gegenstandes, annimmt (oder die Form der Su b s t a n t i v i t ä t, wie wir in Erweiterung und bei einiger Änderung des grammatischen Ausdrucks auch sagen können) oder die der Adjektivität, der adjektivischen Bestimmung. Ist schon innerhalb der bloßen Explikation nicht von Substantivität und Adjektivität die Rede und auch von der Form des „Subjekts“ und „Prädikats“? Eine heikle Frage! Ob nicht schon da Unterschiede in der Weise des gegenständlichen Habens bestehen, neben den wesentlich zur Explikation gehörigen Formen, die das Explikat als solches und den Explikanden als solchen auszeichnen und wieder das Explikat als Explikanden von Explikaten zweiter Stufe und dgl. Es möchte nämlich scheinen, und mir selbst hat es so geschienen, dass z. B. ein selbständiges Glied eines kollektiven Gegenstandes, wie einer Allee, in der Explikation ganz anders charakterisiert sei als ein Eigenschaftsmoment, wie eine explizierte Farbe oder Form, ein Glanz und dgl. (Der Glanz darf dabei nicht als Lichtflecken, ebenso eine dunkle Färbung nicht als ein darauf geworfener Schatten aufgefasst sein: Das sind dann wieder eigene Gegenstände!) Für das eine Glied des Gegensatzes können natürlich auch zusammengesetzte Gegenstände Beispiele abgeben, z. B. die Klinge

208

5

10

15

20

25

30

explikative und prädikative synthesen

am Messer, der Griff, der Stöpsel, der in der Flasche steckt, die als verstöpselte einheitlich aufgefasst ist und dgl. Man möchte nämlich sagen, dass die Formung als Explikand schon voraussetzt oder mit sich führt eine Gegenstandsformung, nämlich ein Erfassen als eigenen Gegenstand, und zwar als den auch, auf den es „abgesehen“ ist. Und weiter möchte man sagen, dass unselbständige Gegenstandsmomente in der Explikation zunächst nicht als eigene Gegenstände, sondern in einem anderen Modus (dem die Adjektivität in der ausdrücklich prädikativen Synthesis entsprechen würde), in dem der unselbständigen Geltung, erfasst werden (der Nicht-Eigengeltung, also hier: nicht als substantivische, nicht hätten sie die Form des „Prädikats“, des „an“ und des bestimmenden „an“); und wenn sie, wie z. B. die räumliche Form, eine Explikation erfahren sollen, erhalten sie die Eigengeltung (= substantivische Form). Selbständige Teile aber, Glieder des Gegenstandes, Stücke, erhalten notwendig gleich die Auffassung der Eigengeltung und können keine andere überhaupt erfahren. (Die Substantivität, aber nicht die Subjekt-ivität: Tritt Explikation zweiter Stufe ein, so erhalten sie die Form der dienenden Subjektivität, des Trägers einer Attribution.) In diesem Fall, wenn also diese Auffassung richtig ist, so würde sich innerhalb der Synthese die nominale und adjektivische (ebenso subjektivische und prädikativische) Fassung finden, weil sie eigentlich schon vorher in der Explikation da war. Die Synthesis bringt neue Formungen hinein, die spezifisch prädikativen Denkformungen, die prädikative Subjektformung, die Form der Untersetzung, die die Form des Explikanden annimmt (und dann auch die zum Explikanden wesentlich gehörige Form der eigenen und tragenden Objektivität, die nominale und subjektivische in unterer Formung), und andererseits die prädikative Prädikatformung als DaraufhinSetzung, und Subjekt wie Prädikate einig in der Sachverhaltsform, wobei das Prädikat zukommende Bestimmung des Subjekts ist. (Die Hauptsache ist, dass, indem Prädikatsetzung auf Subjektsetzung sich gründet, das Bewusstsein, dass eines das andere ist, erwächst.)

text nr. 11

209

§ 4. Die Frage nach dem Unterschied und Verhältnis zwischen den beiden Sachverhaltsformen „S ist p“ und „S hat P“

5

10

15

20

25

30

Sicher ist das aber, dass in der Synthese jedem unselbständigen Explikat zweierlei entsprechen kann: Wir haben die beiden Sachverhaltsformen „S ist p“ und „S hat P“, während jedem selbständigen Explikat ausschließlich die Form „S hat P“ entsprechen kann.1 Jede „einfache“ Explikation2 muss offenbar eine dieser beiden Formen haben, welche Formen und wesentlich verschiedene Formen des geurteilten Sachverhalts andeuten. Jedes Subjekt (jeder prädikativ zu bestimmende Gegenstand) hat Eigenschaften, hat konstituierende, innere Bestimmtheiten, die auf dem Grund einer Explikation zur synthetischen Konstitution kommen im Sachverhalt konstituierenden Bewusstsein. In diesem haben wir überhaupt erst Prädikate im eigentlichen Sinn und hier eigenschaftliche Prädikate, Bestimmungen; Bestimmungen, die, was dem Gegenstand eigen ist, von ihm als Bestimmung zur „Aussage“, zur schöpferischen Setzung bringen („geschaffen“ wird das „S ist p“). Jeder adjektivischen Eigenschaft entspricht ein gehabter „Teil“; gehabt ist dann in der Habens-Synthese die nominalisierte (im besonderen Sinne „vergegenständlichte Eigenschaft“). Im Ganzen bin ich nach wie vor geneigt und muss es sein, die Eigenfassung schon ins Explikat zu legen; so glaube ich, das phänomenologisch Gegebene ansehen zu müssen. Es ist nun eine wichtige Frage, die mir viel Beschwerden gemacht hat, zu entscheiden, ob dieser so entsprossene Sachverhalt „S hat P“ als ein Relationssachverhalt, als ein relativer, gelten kann.3 Also die Frage ist: Ist derjenige Sachverhalt, der sich in der prädikativen Synthese „S hat P“ konstituiert, und zwar in derjenigen, die aus der Explikation entspringt, der Relationsverhalt zwischen Ganzem und Teil, und zwar „S hat P als Teil“? Bedingt der Unterschied

1

Sicher vor allem ist, dass das Subjekt der Synthese Nominalform haben muss. Einfache Explikation = eine solche, wo eben das Explikat nicht wieder Explikand wird. Andererseits ist sie nicht immer ganz schlicht, denn die substantivische Fassung des unselbständigen Explikats ist eine Komplikation im Bewusstsein. 3 Ja, das muss er. 2

210

5

10

15

20

25

30

35

explikative und prädikative synthesen

innerhalb der Explikation, darin bestehend, dass das Explikat einmal vergegenständlicht ist als substantivisches Eigengegenständliches, das andere Mal adjektivische Form hat, auch schon ohne weiteres den Unterschied zwischen der adjizierenden eigenschaftlichen Prädikation und der relativierenden Teilrelation?1 Oder ist es nicht so? Müssen wir sagen, dass auf dem Grund der Explikation mit eigenvergegenständlichtem Explikat eine ursprüngliche Sachverhaltsform „S hat P“ erwächst, die wesentlich zu unterscheiden ist von der Relationsform „S umfasst P als Teil“, sofern diese nicht in der bloßen Explikation, sondern in einer anderen Betrachtungsform, in einem relativierenden Betrachten (einem Beziehen in neuem Sinne) ihre Quelle hat?2 Natürlich so, dass Äquivalenz besteht. Das ist sicher, dass jede Prädikation ein gewisses Beziehen voraussetzt, wofern sie in voller „Eigentlichkeit“ vollzogen sein soll. Im inneren Explizieren, im Betrachten des Gegenstandes in sich selbst, erleben wir ein kontinuierliches Einheitsbewusstsein, und zwar ein „beziehendes“ Übergehen von S zu p in einem Sich-einig-sein-undBleiben. Zur Synthesis der Prädikation bedarf es vorher des Erfassens von S und des Hinübersehens zu p, also doch eines „Beziehens“, aber reiht sich diesem Beziehen ein neuartiges an, wenn wir Relationen vollziehen und speziell Teilrelationen? Festhalten müssen wir dabei Folgendes: Das „S hat P“, das sich uns aus der Explikation ergab, konstituierte sich, eben weil es und so wie es sich aus ihr ergab, genau so wie das „S ist p“. Wir finden da schlechthin keinen anderen Unterschied als den, dass einmal die adjektivische, das andere Mal die nominale Form vollzogen ist, und das sagt, Eigenvergegenständlichung oder Nicht-Eigenvergegenständlichung, weiter nichts. Haben wir ein unselbständiges Moment des Gegenstandes expliziert, so stellt sich alsbald die Hat-Form ein, sowie uns an ihm etwas auffällt, wir es also selbst wieder explizieren, aber darin fortgesetzt das S zur Explikation bringen; wofern wir eben die Explikation in Bestimmung, in prädikative Form verwandeln wollen. Eines neuartigen Prozesses bedarf es weiter nicht. Man möchte versuchen zu sagen: Dieses „hat“ ist im Grunde nur ein anderes „ist“, der Gegenstand bestimmt sich durch das in 1 2

Ja. Das wäre Konstruktion.

text nr. 11

211

ihm selbst Liegende. Er enthüllt sein Sein, was er in sich ist, und das tut er in der Explikation. Es ist außerwesentlich, ob das Explikat verselbständigt wird oder nicht; für die Art der synthetischen Fassung bedeutet es nicht sehr viel; eben nur dies, dass die Form der Selb5 ständigkeit oder Unselbständigkeit der Gegenstandsfassung auftritt. Aber das ist verkehrt. Warum heißt es dann nicht „Der Gegenstand ist Weiße“, „Der Gegenstand ist das Gold, der Teil; das Tintenfass ist der Deckel“? Eben das „ist“ fordert ein adjektivisches Prädikat, ein solches, das 10 sich im „Übergang“ als „an“ dem Träger konstituiert. Das „hat“ aber ist kein „ist“, seine Ergänzung ist ein Substantivisches, etwas, das als kein „an“ konstituiert ist. Aber im „hat“ steckt ein „ist“.

15

§ 5. Das der Erfassung des relationellen Sachverhalts zugrunde liegende Übergehen. Die dem Gegenstand durch den beziehenden Übergang erwachsende Bestimmung bedarf zu ihrer Erfassung keiner Explikation mehr

Bei Relationen, unter Ausschluss der zwischen Ganzem und Teil etc. waltenden Relationen, beruht die Konstitution der relationellen Sachverhalte und Bestimmungen nicht auf innerer Explikation.1 Wir 20 könnten sagen, anstelle der Explikation (immer = innere Explikation) fungiere hier Applikation (und applikative Explikation = äußere) als das implicite die relationellen Sachverhalte „Konstituierende“. Wir können jedenfalls von links zu rechts, von laut zu leise übergehen und zurückgehen und dabei auf das eine und andere Objekt gerichtet sein, 25 ohne dass wir darauf „hinsehen“ (in einem spontanen Sehen), dass A größer B, A intensiver wie B etc. ist, also ohne den Sachverhalt zu fassen. Eventuell fordert es die Konstitution der Relation, dass neben dem Übergehen von A zu B und umgekehrt auch der eine oder der andere Schritt der inneren Explikation vollzogen wird, so 30 zum Beispiel wenn wir Gleichheit oder Verschiedenheit in Hinsicht auf Farbe des Gegenstandes und dgl. konstatieren sollen. Anders,

1 Hier wird also nur die Frage behandelt, ob eine beliebige Relation etwa nach dem beziehenden Übergang noch Explikation fordert oder nicht.

212

5

10

15

20

25

explikative und prädikative synthesen

wenn wir totale Gleichheit erfassen oder totale Verschiedenheit, in dem Sinn etwa, in dem wir bei zwei gleichen Exemplaren einer Art von Bäumen, die vollen Konkreta zusammenhaltend, Gleichheit konstatieren und bestimmend aussagen. Im Übergang vom einen zum anderen, A erfassend, B erfassend und zugleich A festhaltend, vollziehen wir ein Hinüberbringen des A auf B, ein Überschieben und eine Synthese der Deckung. Erfassen wir A aufs Neue, so hat sich gegenüber vorhin sein Bewusstsein geändert; e s ha t du rch d en D e c k un g süb erg an g s oz us ag en et wa s e rfa h ren (ganz ähnlich wie bei der inneren Explikation oder wie nach ihr das G ein modifiziert Bewusstes ist, als ein solches, das Verdeutlichung etc. erfahren hat).1 Es ist ihm implicite schon die Bestimmung zugewachsen. Aber das zeigt sich eben im erneuten Übergang zu B im Hinblick auf das „A ist B“. Nur hier ist die Weise der Synthese eine ganz andere, nicht eine Synthese der Explikation (die auch so etwas wie „Deckung“ heißen kann), sondern eine Synthesis der Gleichheit. Es ist nun evident, scheint es, dass die Weise der Erfassung des Sachverhalts mit seiner artikulierten Bestimmung genau die gleiche ist wie bei den in der Explikation entspringenden Sachverhalten. Es war also eine Verirrung, wenn ich zeitweise von dieser nächstliegenden Anschauung abgegangen bin und gemeint habe, es wachse dem A durch den Übergang eine Bestimmung zu, die dann allererst expliziert werden müsste. Das war grundverkehrt. Die Bereicherung ist ja ganz analog wie diejenige, die der Explikand in einer explikativen Synthese erfährt.

1 Sagt man, im einen Fall hat G die Eigenschaften „von vornherein“, im anderen hat es relative Bestimmungen erst im beziehenden Hinübersehen auf „andere“ Gegenstände (oder es hat seine inneren Beschaffenheiten, auch wenn es mit keinem anderen Gegenstand verbunden ist, auf keinen anderen bezogen), so ist das schief. Aber es ändert nichts daran, dass auch Eigenschaften nur bewusstseinsmäßig „gehabt“, erfasst, gesetzt sind in einem explizierenden Beziehen und dass Teilerfassungen dann mit den Eigenschaften zusammenstehen als inneres Beziehen des Gegenstandes auf „sich selbst“ gegenüber dem äußeren Beziehen.

text nr. 11 § 6. Die Erfassung innerer und relativer Merkmale. Die Vorhandenheit und Erfassbarkeit relativer Merkmale setzt ein beziehendes Übergehen voraus. Die Erfassung der Merkmale ist noch keine Erfassung des Sachverhalts. Merkmal und Teil

5

10

15

20

25

30

213

Umkehr (natürlich falsch); These: Es ist nicht wahr, dass innere Bestimmung und relative Bestimmung einander im Wesen und in der Erfassung ganz gleich stehen. Es ist nicht wahr, dass eigenschaftliche Bestimmung und entsprechende Teilbestimmung (als relative) sich bloß unterscheiden durch die gegenständliche Fassung des Explikats. Es ist nicht wahr, dass das Hin- und Hergehen beim eigenschaftlichen Bestimmen (beim Explikativen überhaupt) ein Beziehen ist im selben Sinn wie das echte Beziehen der Relationen.1 Habe ich mich vorhin fast gewundert, wie ich zwischen Explikation und Relation einen Schnitt annehmen konnte, so wundere ich mich jetzt, wie dieser Schnitt übersehen werden kann, da er doch offenkundig ist. Wir wollen einmal eine Vergleichung vollziehen:2 Mir erscheint jetzt etwa (während ich nachdenke und, wie ich dabei gewohnt bin, nicht fixiere) das Doppelbildpaar dieser Füllfeder. Ich vergleiche und stelle mich zunächst nicht auf den Standpunkt eines oder des anderen Gliedes (Bildes). Hinüber- und herübergehend sehe ich nun an dem einen Bild das „dunkler“, am anderen das „heller“, am einen Federbild das „länger“, am anderen das „kürzer“. Dabei sehe ich das „an“ jedem Bild, so wie ich, oder analog wie ich, an ihm die Farbe oder Form sehe, das ist, sie expliziere. Ich merke allerdings hier eine gewisse Mittelbarkeit. Das „heller“ und „dunkler“ ist heller etc. bezüglich der Färbung. Ich kann offenbar in Versenkung in das Phänomen (ich lebe durchaus in Intuition!) sagen, dass in sich dem Gegenstand die Färbung zukommt und diese explikativ hervortritt und an der Färbung der Charakter einmal des „heller“, das andere Mal des „dunkler“, einmal satter, das andere Mal minder satt.

1

Das natürlich. An den Rand des folgenden Textes hat Husserl geschrieben: „Richtig und brauchbar. Nota bene“. – Anm. der Hrsg. 2

214

5

10

15

20

25

30

35

explikative und prädikative synthesen

Andererseits mache ich hier nicht die Färbung zum eigenen Gegenstand und eine Mittelbarkeit der Explikation tritt nicht hervor.1 Vielmehr, die Heller-Färbung tritt hervor einheitlich, und der Gegenstand steht als heller gefärbt da, und ich muss sagen, so wie ohne vergleichenden Übergang der Gegenstand explikativ als gefärbt erfasst ist, so nach dem vergleichenden Übergang explikativ als heller gefärbt, und weiter explizierend in abgesetzten Schritten kann ich dann finden: Der Gegenstand ist gefärbt, und diese Färbung ist eine hellere. Aber heller in Bezug auf B. Das „heller“ finde ich an A, aber „sofern“ es Endpunkt des Übergangs von A aus ist, oder jedes der A und B hat sein Beziehungsmerkmal, sofern es im Übergangsbewusstsein, das zwischen A und B sich etabliert, bewusst ist. Aber das A und B enthält selbst nichts von einem „Bewusstsein“, aber es haftet dem „heller“ und „dunkler“ das „in Bezug auf“ (was keine Rede vom Akt des Beziehens ist) an. Ich finde das „heller“ an A, aber über dieses Moment der Explikation erstreckt sich etwas hinaus, der Fangarm gegen B hin. Vollziehe ich keine innere Explikation und blicke vom ganzen unexplizierten A zu dem B, so hat dieses den Charakter des „gleich“ (ebenso den des „ähnlich“) und ebenso, wenn ich, Farbe explizierend, vom einen zum anderen übergehe: gleich hinsichtlich der Farbe, ähnlich hinsichtlich der Farbe. Und ist es nicht ebenso bei anderen Relationen? So bei den Lagerelationen: Von A gehe ich zu B über, dabei hebt sich die Lage ab, die beiden Bilder sind durch eine Einheit der Lage verbunden, und diese ist verschieden, je nachdem ich die Feder halte. Diese Einheit lässt sich durchlaufen, und der Übergang ist immer wieder je nach der besonderen Form der Einheit ein verschiedener, und im Übergang hat jedes einen Charakter und jedes einen anderen. Also, an dem A erfasse ich aufgrund des Übergangs und seiner Synthese die relativen Charaktere, so wie ich an ihm die inneren Charaktere aufgrund der explikativen Übergangssynthese explikativ erfasse; nur das ist eigentümlich, dass die inneren Charaktere rein aus dem A selbst durch bloß explikative Synthese geholt sind, an ihm

1

Doch das ist mittelbar.

text nr. 11

5

10

15

20

25

30

215

sind, ohne dass es eines Übergehens bedürfte zu einem „anderen“, sondern nur zum eigenen, während die relativen erst im Übergang zu anderem erwachsen und einen Fangarm zum korrelaten Objekt haben. Ferner: Es scheiden sich uns relative Charaktere, die dem A, sofern es als α expliziert ist, zuwachsen (und speziell an dem α dann haften und erst dadurch am A), andererseits relative Charaktere, die ihm unabhängig von solcher Explikation zuwachsen, als relative Charaktere des Gesamtgegenstandes schlechthin (Lagencharakter, Gleichheits-, Ähnlichkeitscharakter etc.). Beiderseits haben die relativen Charaktere etwas Sekundäres. Der innere Charakter des Ganzen, und zwar der unmittelbare, tritt hervor in schlichter Explikation, der äußere Charakter des Ganzen durch Applikation, durch erfassende Hinzunahme eines anderen, und wechselt mit diesem anderen.1 Was ist damit gewonnen? Unser Ergebnis ist: An de m A e rfa ss e i c h w i e i n ne r e , s o r elat ive M er k m ale. Innere Merkmale kommen zur Erfassung schlicht durch E igens ch af t- E x pl ik a ti on: Ich erfasse A und dann, auf dem Grund der A-Erfassung, an dem A das „weiß“. Ich erfasse es nicht als Gegenstand für sich, ich erfasse es in ganz eigenartiger Weise: Die Intuition lehrt uns das kennen, dieses schlicht vom Gegenstand und seiner Erfassung ausgehende, an ihm den erfassenden Blick auf das „weiß“ richten. Und sie lehrt uns, dass das so Erfasste, wir sagen, das innere Merkmal (die innere Beschaffenheit oder „Eigenschaft“), noch nicht der Sachverhalt bzw. dass die Merkmalserfassung noch nicht S a ch v e r ha l t s erf a s su ng ist. Es bedarf der geänderten Einstellung des Blickes und der synthetischen Konstitution des „A ist weiß“. Nicht so schlicht geht es bei Relationen zu. Gewiss. Ich muss erst das beziehende Verhalten, den Übergang von A zu einem anderen Gegenstand üben, zu B. Aber zunächst nur, damit wieder ein Merkmal, hier das äußere, vorhanden und erfassbar sein kann. Erst muss es konstituiert sein, damit ich es erfassen kann. (Auch das innere Merkmal muss erst konstituiert sein.) 2

1 Das ist doch schief. Es kann doch auch A und B ein Stück gemein haben. Ich müsste also unterscheiden: 1) Synthesen der Identifikation, 2) Synthesen der Vergleichung, 3) Synthesen der Verbindung, 4) Synthesen der eigenschaftlichen Bestimmung. 2 Da steckt der Fehler. – Das Konstituieren des inneren Merkmals besteht eben in

216

5

10

15

20

25

30

explikative und prädikative synthesen

Durch den Übergang zu B hat die „Vorstellung“ des A, der dem Erfassen des A zugrunde liegende Sinn der gegenständlichen Auffassung, einen Sinneszuwachs erfahren. Das Erfassen des äußeren Merkmals aber ist nachher phänomenologisch im Wesentlichen gleichartig mit dem des inneren. Dem Allgemeinen nach, können wir sagen, sind Merkmale, ob innere oder äußere, eben Merkmale, in gleicher Weise am Gegenstand vorfindlich (abgesehen von dem Ursprung durch beziehenden Übergang von Nominalien zu Nominalien oder schlicht ohne solchen Übergang). Und gebrauchen wir das Wort „Explikation“, um das Vorfinden des „an einem A“ aufgrund der A-Erfassung zu bezeichnen, dann werden äußere Merkmale wie alle Merkmale in der Explikation vorgefunden, erfasst.1 Es würde bei diesem Wortgebrauch „explizieren“ soviel heißen wie „Merkmale,“ „Bestimmungen“, an einem Gegenstand erfassen, erfassen, was der Gegenstand ist. Und es würde sich überall in gleicher Weise unterscheiden das bloße Explizieren als Erfassen der Merkmale am Gegenstand (des Sinnesinhalts des Gegenstandes, Merkmalsbestands desselben) und das Erfassen des Sachverhalts „A ist a“, „A ist ς B“. Dass dies alles richtig ist, kann nicht dem mindesten Zweifel unterliegen.2 Alles habe ich in dieser Überlegung auf genaueste Intuition gegründet. Es versteht sich jetzt auch, warum das „ς“ nicht zum „ist“, sondern zum B gehört. Es versteht sich die adjektivische Form und die Gleichartigkeit in der Sachverhaltsfunktion für das innere wie das äußere Prädikat, und zwar in letzter Hinsicht das „Relat“. A ist weiß; A ist gleich – mit B; A ist groß – in Bezug auf B, oder größer – als B; A ist weit weg – von B usw. Die Ergänzung des Relatbestandes (des relativen Prädikats nach dem Bestand, der wirklich an dem A sich findet) entspricht dem „Fangarm“, dem Zeiger auf das KorrelatObjekt.

der Explikation selbst. Wenn ich von G zu a übergegangen bin, habe ich eben das Bewusstsein des a an G oder des G als Subjekt des a. 1 Explikation wäre dann der Name für die konstituierende Übergangssynthese. 2 Ganz gewiss, aber nur das ist nicht gezeigt (und konnte nicht gezeigt werden), dass allererst eine Explikation das relative „an“ heraussondern würde und könnte. Das „an“ ist zwar ein „an“, aber prinzipiell nicht als ein „in“ zu fassen.

text nr. 11

217

Es bleiben nun die Schwierigkeiten des Teilverhältnisses, der zugehörigen Merkmale und Sachverhalte.1 Me r km a l i st n i ch t T e i l. Der Teil ist in A, das Merkmal ist an A. Die Merkmalserfassung ist eine ganz bestimmte Erfassungsweise (in einer ganz bestimmten 5 synthetischen Materie fundiert); die Teilerfassung ist etwas anderes, ist Relationserfassung, und dem Teil läuft parallel das Merkmal, das äußere Merkmal „ist Ganzes von B“, „umfasst B“ etc. Teile sind relativ zu dem, was sie hat, selbständig, Merkmale sind unselbständig. Freilich kann die Selbständigkeit wie bei Weiße als Gegenstand 10 bloß in der Verselbständigung liegen, die in der „Nominalisierung“ liegt. Aber das bedarf immer wieder der Überlegung, ob die „Nominalisierung“, die das innere Merkmal (aber auch jedes äußere) erfahren kann, das Merkmal in einen Teil verwandelt und zwischen Subjekt und Merkmal eine Relation zwischen Ganzem und Teil herstellt.2 15 Also, A hat Ähnlichkeit mit B: Liegt darin, dass A in Bezug auf diesen neuen Gegenstand „Ähnlichkeit mit B“ ein relatives Merkmal erhält, das also etwas Neues „an“ ihm ist, dasselbe, das in jedem „hat“ liegen soll: also „hat“ = „ist habend“?3

1

Das ist nun eine Sache für sich. Ja, das tut es. 3 Synthesen der Identifikation. Synthesen der Vergleichung, der Verbindung, der eigenschaftlichen Bestimmung. Nicht behandelt habe ich aber die Synthese der Einordnung, z. B.: „Dies ist ein Mensch“. 2

Nr. 12 D i e sc h ö pf eris c h e E rz e ugu n g vo n Sa c h ve r h alt en , i hr e O b je kt iv i e ru ng un d i hr e Exp li kat io n 1

§ 1. Auffassung, Sich-Aufdrängen und Richtung-auf im Erfassen

5

10

15

20

25

30

Das Sich-Hinwenden auf „vorgegebene“, „im Gemüt bereitliegende“, „vorliegende“ Gegenstände, das Sie-erfassen-und-gegenständlich-Machen. Die sinnlich-anschaulichen und anschaubaren Gegenstände, Dinge, Vorgänge, Gruppen von Dingen, Konfigurationen von Dingen – aber auch Momente in Dingen, Eigenschaften: die Farbe, die Gestalt, die Dauer, aber auch „die Dingseite (Seite dieses Buches), so wie sie da erscheint“, wieder die sinnliche Darstellung dieser Seite. Auf „unselbständige“ Gegenstände kann geachtet werden: Dabei muss aber vorgegeben, „vorliegend“ sein, wenn auch nicht eigenes Objekt der Erfassung sein, der zugehörige selbständige Gegenstand, der ganze. Es kann sein ein Gegenstand, der in der Zeit dauert, sich verändert oder unverändert bleibt, sich bewegt oder unbeweglich bleibt, oder es kann ein Vorgang sein. Ich kann auf die Bewegung, auf die Veränderung gerichtet sein, ich kann aber auch gerichtet sein auf das sich bewegende Ding. Nun ist da e i n un d d a s s e l be „ B e r e it l i e g e n de “, u nd e s si n d ver s ch i e d e ne Ge g e n s t ä n de d ar au s zu „ e n tn e h m en “; es können aus dem Bereitliegenden durch Hinwendung und Erfassung verschiedene Gegenstände erfasst, zu Gegenständen im besonderen Sinn, zu Objekten, werden. Doch das ist eine Änderung in der Redeweise: „Bereitliegend“ nannte ich oben die Gegenstände und wir sprachen davon, dass Gegenstände, ehe sie Objekte sind, zu Objekten werden. Man ist aber da gezwungen, sich genauer zu überlegen, was erlebnismäßig vorhanden ist. Ich bin dieser Kupferschale zuge-

1

23. 9. 1911. – Wichtig.

text nr. 12

5

10

15

20

25

30

35

219

wendet, und in der Umgebung, im erfüllten Gesichtsfeld heben sich allerlei „Gegenstände“ ab, denen ich nicht zugewendet bin, die ich nicht erfasse, auch nicht im Griff habe. Nun wende ich mich dem einen oder anderen zu. Wir finden in einer eigentümlichen Reflexion, dass vor der Zuwendung die betreffenden Gegenstände schon „bewusst“ waren, dass sie sich „aufdrängten“; dem Erfassen geht ein Sich-Zuwenden zu einem „Sich-Aufdrängenden“ öfters merklich (nachträglich merklich) vorher. Was sich da aufdrängte, war etwa das Ding. Es könnte sich aber auch die Farbe oder Form des Dinges aufdrängen: desselben Dinges. Hier in dem vor der Erfassung Liegenden ein Gemeinsames: Die Form des Aufdrängens und das „Ding“, das die betreffende Farbe oder Form hat, das in gewisser Weise „bewusst“ ist, aber in verschiedener Form, sofern eben einmal das Ding selbst und einmal seine Farbe, seine Form sich aufdrängte. Dabei ist es nicht ganz sicher, ob, wenn sich die Farbe aufdrängt, sich nicht vorher das Ding aufdrängen und wohl gar zur Erfassung kommen muss, wonach dann erst als zweiter Schritt das unselbständige Moment oder der Teil, das Glied sich aufdrängt. Ob immer diese Unterscheidung zu machen ist, ob immer die erfassende Zuwendung ein Aufdrängen voraussetzt? (Zum Beispiel auch, wenn ich etwas höre; jemand spricht mich an, während ich in meinen Sachen lebe: Die Worte drängen sich auf, werden bemerkt, alsbald drängen sich die Gedanken auf, und ich richte den erfassenden Blick und den synthetischen in das Gesagte.) Ein Aufdrängen, das vorhergeht, das ist schwer zu entscheiden. Jedenfalls, dass, wo eine Erfassung wirklich stattfindet, „anders gerichtete“ Erfassungen möglich sind und möglich waren (auf Grund eventuell verschieden gerichteter Aufdrängungen) und was die Möglichkeit dazu hergibt, das ist ein phänomenologisch eventuell Gemeinsames. Versucht man zu sagen, es liege Auffassung zugrunde vor der Erfassung, so tritt uns hier die merkwürdige Schwierigkeit entgegen, welche in dem Phänomen liegt: Auffassung ist Auffassung als etwas, also Auffassung als Ding, Auffassung als Vorgang, Auffassung als Dingeigenschaft etc. Ist die hier in Rede stehende Auffassung vor der Erfassung Auffassung als das eine oder andere oder als alles das zusammen? Darauf wird man antworten: Es sei zu unterscheiden zwischen A u f f as s u n g, hier auch wohl zu sagen: phansische Er-

220

5

10

15

20

25

30

35

explikative und prädikative synthesen

scheinung bzw. Erscheinungskontinuität, und „Ri c ht ung - a u f“. Die Richtung-auf kommt herein schon durch das Si ch -Au fd rä n ge n und durch das spontane Erfassen und explizierende Betrachten. Die b loß e A uf f as sun g, die bloße Erscheinungskontinuität, ist n i c ht R ic h t u n g auf das Ding, das dauert und sich dabei ruhend hält, verändert etc., oder gar Richtung auf Dingseiten, auf Merkmale, auf Momente der Erscheinung selbst, auf den Vorgang etc. Das alles „liegt“ in der Auffassung, und sie selbst ist nichts anderes als eine gewisse Kontinuität von Erscheinungen, von der wir sagen, dass sich dabei die Erscheinungen „decken“, dass sie Bewusstsein, obschon nicht Erfassung von Einheit sind. Aber dieses „von“ sagt nicht Richtung-auf. Man kann vielleicht sagen, dass diese Auffassung „in erster Linie“ Auffassung des dauernden Dinges sei, sofern dieses – wenn überhaupt „auf Grund dieser Auffassung“ ein Sich-Aufdrängen statthat und Erfassen – sich notwendig zuerst aufdränge, in zweiter Linie Farben, sonstige Eigenschaften; wieder die Dauer, der Vorgang; wieder, immer in anderer „Richtung“, die Erscheinungen selbst. Aber hat nicht auch schon vor dem Erfassen eine Allee ihre Einheit, und drängt sie sich nicht als Einheit auf, ehe sich noch die einzelnen Glieder aufdrängen? Es ist schwer, in der Auffassungsreflexion die Erlebnisse (die „Phänomene“) zu befragen, und nur dadurch können wir ja Kenntnis hier gewinnen. E s bl e i b t a l s o p r ob l ema t i sc h, in w ie f er n g ew is se R i cht un g e n d es S i c h - A uf dr ä n g e n s vo n G e ge ns tä n den un d d e s E rfa s s e ns de r s e l be n d u r c h di e p ur e Auf f a ss un g p rä des tin i e rt si n d, ob hier Gesetzmäßigkeiten der Stufenfolge bestehen. Aber sicher ist, dass die zu erfassenden Gegenstände, die sich in der Erfassung offenbarenden, schon verborgen „vorliegen“ in Auffassungen, und in Auffassungen, die im Allgemeinen nicht nur diese, sondern so manch andere Gegenstände in sich geborgen oder verborgen haben. Wie weit die Wesenszusammenhänge hier reichen und wie sie zu beschreiben sind, ist ein Problem. In der „Auffassung“ haben wir also potenzielle Gegenständlichkeiten, in der Erfassung haben wir aktuelle, nur in ihr ist wirklich etwas gegenständlich: Es ist eben erfasst und noch in Fassung, ergriffen oder noch im Griff.

text nr. 12

5

10

15

20

25

30

221

§ 2. Blinde und von Erfassung durchleuchtete Gegenstandsphänomene. Affektives Zuhandensein gegenüber dem Zuhandensein aus schöpferischer Spontaneität. Das Ergreifen und Explizieren der durch Synthesis konstituierten Gegenstände „Auffassung“ ist offenbar ein wenig gutes Wort.1 Ich sagte auch in der bevorzugten, aber noch unklar begrenzten Sphäre unserer Überlegung „Erscheinung“. Sagen können wir auch „Gegenstandsphänomen“ oder „Gegenstandsphansis“. Und es handelte sich im Kreise unserer Betrachtung um solche Gegenstandsphänomene, die vor der Erfassung in sich „dunkel“ sind, nicht etwa selbst schon Erfassungen einschließen. Man wird hier sofort an den Le i bn i z’schen Gegensatz zwischen bloßen Perzeptionen und Apperzeption denken, obwohl man leicht sieht, dass er sich mit dem, was hier in Frage steht, nicht völlig deckt. Wenigstens gehen unsere Intentionen viel weiter. Wir haben also zunächst blinde Gegenstandsphänomene, in denen nichts von Erfassung lebt, gegenübergestellt solchen, in denen Erfassung statthat, und zwar in dem Sinn, dass aus den blinden das Erfassen einen Gegenstand erfasst, etwas g eg en s t änd li ch m ac ht. Hierbei ist zu untersuchen, wie sich das Gesamtphänomen des Erfassens zu dem blinden Gegenstandsphänomen verhält, inwieweit das Erfasste gegenüber dem allgemeinen Charakter des Erfassens einen Gehalt hat, der wesentliche Gemeinsamkeit besitzt mit dem blinden Phänomen, wie sich ja auch darin anzudeuten scheint, dass das erfassende Phänomen Modifikationen zulässt, wodurch es auf Grund desselben ihm einwohnenden Gehalts andere Gegenstände entnehmen lässt und dieselben, von denen es heißt, dass sie aus dem blinden zu entnehmen sind. Wir haben aber noch einen anderen Gegensatz mit angedeutet: vo n Er f ass u n g n i c h t d ur c h l e u c ht e t e Ge g e n st a n ds p hä nom e n e u nd v o m Er f as s e n d ur c h l e uc hte t e. Das Letztere umfasst nicht nur die Phänomene, in denen aus einem blinden Phänomen ein in ihm verborgener Gegenstand entnommen wird, sondern auch

1 Eben nicht bloße Auffassung, sondern Gegenstandsbewusstsein vor der Zuwendung.

222

5

10

15

20

25

30

explikative und prädikative synthesen

die Fälle, wo Erfassen mit Erfassen sich zu einer Synthesis einigt und eine Gegenständlichkeit dadurch produktiv konstituiert wird, die doch nicht erfasst ist. Von vornherein ist hier zu beachten, dass, wenn sich Akte der Erfassung synthetisch aufeinander bauen, eben das die Synthesis charakterisiert, dass sie ein Aktganzes erzeugt, das als Ganzes nicht Erfassung ist, aber ein Bewusstsein-von, ein Blick auf: nämlich das Thema. Es kann sein, dass Gegenstände „vorgegeben“, „vorliegend“, „vorhanden“ sind, und zwar bewusstseinsmäßig (erlebnismäßig), während nichts von Erfassen aktuell ist, das sich auf sie bezieht, genauer auf das gesamte Gegenstandsphänomen, dem sie zu entnehmen sind, sich gründet. Und es kann sein, d a ss G e gen s tän d e z um „ Vo r ha n d en “ - S ei n kom m en a u f s c h öpf e ri sc he We i se, nämlich dadurch, dass Gegenstandserfassungen auf Gegenstandserfassungen sich synthetisch bauen, und das Wort „synthetisch“ sagt, dass als Ergebnis dieses Sichbauens ein „vorhandenes Gegenständliches“, ein Gegenstandsphänomen, Erlebnis ist, das eben v or h and e n i s t f ür e i n m ög l i ch e s n e u e s E r fa ss en un d  nic ht in der S y nt h e s e s e l b s t e rf a s st i s t , s o n de rn z u s ei ne r E rf as s un g e i ne n ne u e n a c t us b e n öt i g t.1 Vielleicht sagen wir besser „zuhanden“. Also, Gegenstände sind zuhanden, das sagt, gewisse Erlebnisse sind im Zusammenhang eines Erlebens (eines erlebenden Subjekts: was immer das phänomenologisch besagen mag), aus denen ergreifende Akte die betreffenden Gegenstände ergreifen können. Das Zuhandensein kann ein af f e k t i v es sein: Wir sind affiziert, rein rezeptiv, passiv. Keine Spontaneität ist an dem Zuhandensein beteiligt, wobei dahingestellt bleiben mag, ob die Affektion auf frühere Spontaneität zurückweist oder nicht. Das Zuhandensein kann ein spontanes sein (das bloß Zuhanden- und nicht Ergriffensein); es ist eine schöpferische Spontaneität, welche das Gegenstandsphänomen, das Vorhandensein des Gegenstandes erzeugt.2 (Würden wir das Wort Konstitution hier anwenden wollen, so würden wir von affektiver und schöpferischer Konstitution zu sprechen haben.)

1

Gut. Hier ist Erfassen also Gerichtetsein-auf. Man kann ad Spontaneität aber fragen: Gibt es nicht Freiheit des Durchlaufens im Hintergrund? Ist unter Spontaneität hier nicht eine Ich-Aktivität, eine besondere Spontaneität gemeint? 2

text nr. 12

5

10

15

20

25

30

223

Nun bleibt aber noch Folgendes zu erwägen. Ist uns ein Gegenstand durch Affektion vorgegeben und ist er im sehenden Akt ergriffen, so kann er expliziert werden. Das Ergreifen setzt sich fort im Analysieren, im Explizieren des gegenständlichen „Inhalts“. Wir haben also das Gegenstandsphänomen als bloßes Zuhandensein, das modifizierte Gegenstandsphänomen als Ergriffensein und als Prozess der Explikation, dazu das „noch im Griff sein“ gegenüber dem aktiven Ergreifen und Ergriffen-Haben. Gehen wir nun über zu den syn th eti sch en Akte n, den Synthesen von Akten des Ergreifens und Im-Griff-Habens, so erzeugen diese neues Vorhandensein mit neuen Gegenständlichkeiten, die nicht beschlossen sind in den Gegenstandsphänomenen der Fundierung. Wenn nun ein Ergreifen auf diese Gegenstände geht, und zwar auf den gesamten durch die Synthesis konstituierten Gegenstand, so kann auch der expliziert werden; zum Beispiel, A enthält B – nun werfe ich einen erfassenden Griff auf diesen Sachverhalt und kann nun sagen: Er enthält „A“, „B“, die Form „enthält“ etc. Dann also dient die erneute Erfassung des A als explizierender Akt, ebenso die von B. Was die Form anlangt, so wird sie nun explikativ erfasst. Aber sie wird, obschon sie vorher nicht erfasst war, doch nicht aus dem Dunkel hervorgezogen. Überhaupt ist es das Eigentümliche dieser Zuhandenheiten, dass man einerseits sagen muss: Im „A hat B“ sei A und B erfasst und nichts anderes, und dass ein eigener erfassender Griff auf das Ganze als Ganzes möglich ist, andererseits aber, dass man doch sagen muss, der „Blick“ ruhe auf A nicht nur und auf B, sondern auch auf dem „Haben“, und der Sachverhalt sei in dieser originären Form durchaus „gesehen“, im hellen Bewusstsein bewusst, und das viel besser, möchte man sagen, als in dem zurückblickenden einheitlichen Ergreifen, wie wenn wir anknüpfen: „Dieser Sachverhalt …“.

224

explikative und prädikative synthesen § 3. Schlichtes Ergreifen und sich daran anschließende schrittweise Explikation eines Dinges bzw. eines Vorgangs gegenüber der schrittweisen Erzeugung des Sachverhalts im Urteil

5

10

15

20

25

30

Die Hauptfrage ist hier vor allem: Ist es durch genaueste phänomenologische Analyse wirklich zu bestätigen, dass das objektivierende „Ergreifen“, wie wir es bei Zuwendungen der Gewahrung (Wahrnehmung) finden, auf eine Stufe zu stellen sei mit dem zurückgewendeten „Nominalisieren“, das auf ein aktuelles Urteilen „S ist P!“ folgend sich anschließt als „diese Tatsache, dass …“, und nicht vielmehr schon mit dem aktuellen Urteilen selbst? Jemand möchte sagen:1 Ich sehe das Ding, betrachte es. Ebenso in der Erinnerung: Dem Erinnerten wende ich mich zu, erfasse es. Ebenso in der Phantasie. Nun ebenso, warum sollte das so wesentlich verschieden sein, „sehe“ ich, dass dieses Papier weiß ist. Urteile ich „Dieses Papier ist weiß!“, so bin ich doch all dem zugewendet, nicht bloß wie im ersten Schritt „dieses Papier“ dem Papier und dann dem „weiß“, sondern diesem Ganzen „Dieses Papier ist weiß!“. Es ist dabei gleich, ob ich aufgrund der Wahrnehmung oder Erinnerung oder Phantasie urteile. Freilich, dem Ding mich zuwendend vollziehe ich ein schlichtes Ergreifen, in einem Griff fassend, und daran schließt sich Explikation, Schritt für Schritt. Andererseits, wenn ich den Sachverhalt „sehe“, ich ihn im anschaulichen Urteilen „erfasse“, so ist das eben kein schlichtes Ergreifen eines zuhanden Seienden, nichts dem ich mich „einfach“ zuwenden könnte. Es ist vielmehr e i n s ch ri ttw ei s es E r g re i f e n, wobei sich schrittweise das Ergriffene allererst konstituiert, und das macht den allerbedeutsamen Unterschied. Die Sachlage ist dabei freilich2 auch wieder ganz anders als in den Fällen eines oft so abwechslungsreichen Vorgangs, der auch immer Neues hereinbringt, das im Erfassen des Vorgangs immer neu zum Erfassen

1

Dass dieses falsch ist, wird nachher erwiesen, zunächst „Begründung“ der Ansicht. In gleicher Art kann hier herangezogen werden das Sich-Konstituieren des Gegenstandes äußerer Wahrnehmung in der Kontinuität der Erscheinungen, wenn ich über den Gegenstand hinblicke und immer Neues von ihm sehe. 2

text nr. 12

5

10

15

20

25

30

35

225

kommt. (Nicht alles schlichte Ergreifen ist ja Zuwendung zu einem schon im Voraus zuhanden Seienden, schon längere Zeit Bewussten, ehe es ergriffen wäre. Beim Ergreifen eines Vorgangs streckt das Ergreifen dem stetig Neuen und Neuen die offene Hand entgegen. Sowie es „auftritt“, wird es ergriffen.) Der Vorgang spielt sich allmählich ab und tut es im einheitlichen Erfassen, das ihn erfasst, aber nicht erzeugt; es tritt auf, ich erfasse es. Hingegen der Sachverhalt wird zwar auch schrittweise ergriffen, aber auch durch das Ergreifen allererst erzeugt. Die Gegebenheit des Vorgangs ist eine rezeptive Gegebenheit, die des Sachverhalts eine produktive. A ber das a ll es d a rf u ns n ic ht ir re m ac he n, und zudem ist das Letztgesagte unklar. Was soll das sagen, der Sachverhalt wird erzeugt? Erzeugt sich nicht auch der Vorgang? Und inwiefern soll einmal das Ergreifen nicht erzeugen und das andere Mal erzeugen? Wir sehen freilich wesentliche Unterschiede: Einmal verhalte ich mich schlicht ergreifend, und obschon ich eventuell Schritte habe, sofern der Vorgang zum Beispiel einer Melodie diskrete Teile hat, so ist das Ergreifen der Einheit des Vorgangs außerwesentlich. Auch wenn ich ihm nicht zugewendet wäre, auch wenn er sich bewusstseinsmäßig abspielte, während ich anderem zugewendet bin, konstituierte er sich als einheitlicher Vorgang, nur als unerfasster. Aber damit der Sachverhalt überhaupt konstituiert ist (in Gegebenheitsweise), bedarf ich der Schritte der Zuwendung und produktiver Setzung; durch sie erst gewinnt das Bewusstsein die Bewusstseinsformen des konstituierten Sachverhalts. Vor allem aber heißt es, sich nicht verwirren lassen. Ich erfasse einen Ton, der anfängt und aufhört, ich erfasse einen Vorgang, der seine bald gleichen, bald wechselnden Phasen und Glieder hat. Das Erfassen ist ein zeitlich kontinuierliches, und in jeder Phase des Erfassens erfasse ich schlicht etwas von der Sache, etwas vom Vorgang (es tritt auf, ich nehme es), und das Vorher-erfasst-Gewesene ist, da ich nicht einer punktuellen Phase, sondern einem konkreten Gegenstand, und nicht einem Glied des Vorgangs, sondern einem Vorgang zugewendet bin, in der Retention festgehalten. Eben das ist schlichtes Erfassen eines Gegenstandes, sich so verhalten. Ganz anders steht die Sache, wenn wir das Urteil vollziehen „S ist p!“, „Dieses Papier ist weiß!“ Hier erfassen wir eben nicht, es ist nicht etwas da, dem wir uns zuwenden, nach dem wir fassen,

226

5

10

15

20

25

30

explikative und prädikative synthesen

greifen, sondern wir stellen etwas hin, setzen es in formend erzeugender Weise, bzw. ein anderweitig Gegebenes, in einem anderweitigen echten Erfassen Gegebenes setzen wir als „dieses“, subsumieren es unter Papier und stellen hin „dieses Papier“ usw. In gewisser Weise handelt es sich um Produktionen, und in ihnen sind die Produkte freilich „im Blick“ des Bewusstseins. Aber dieser Blick ist nicht ein wahrnehmender, nicht ein erfassender im prägnanten Sinn. Wir werden sagen können und müssen: Der Prozess vollzieht sich in Schritten, und jeder Schritt hat allerdings ein Gemeinsames mit dem schlichten Erfassen. In jedem Erfassen sind wir auf das Erfasste hi n g e r ic ht et. So sind wir auch im „dies“ und so in jedem Schritt a uf e t w as ge ri c h t e t, das eventuell in einem unterliegenden schlichten Erfassen Erfasstes ist. Also die Gemeinsamkeit liegt in dieser Richtung-auf. Andererseits aber ist es falsch zu sagen: Es liege nicht nur ein schrittweises Gerichtetsein, Zugewendetsein (und gleichsam Erfassen im weiteren Sinn) vor, sondern durch diese „erfassenden“ Akte konstituiere sich allmählich ein Ganzes, dem wir in gleicher Weise zugewendet sind oder das im ganzen Prozess das „Ergriffene“ sei. Mitnichten. Will man schon das Sich-Richten jedes Schrittes ein produktives Ergreifen oder Erfassen nennen, sofern ja das, was da Zielpunkt der Richtung ist, im Blick ist oder im Griff ist, so ist doch evident, das in diesem Sinn der ganze Sachverhalt eben nicht „ergriffen“ ist (nicht Zielpunkt der Richtung-auf). Es ist zwar analog wie beim Vorgang jeder Schritt „noch bewusst“ und festgehalten, aber es ist nicht der Sachverhalt so bewusst wie ein Vorgang, nicht „Objekt“ der Richtung-auf. Um den Sachverhalt als Objekt, als Richtungsziel zu haben, müssen wir vielmehr reflektieren, nominalisieren. (Und auch dann ist zu unterscheiden zwischen dem ganzen Gebilde in der nominalen Form, das „bewusst“ ist, und dem, was Zielpunkt der Richtung ist. Doch das führt genauer besehen in eine andere Linie.)

text nr. 12

5

10

15

20

25

30

227

§ 4. Der Unterschied beim Sachverhaltsbewusstsein zwischen der Zuwendung zum Thema und der Richtung auf den Gegenstand. Die Zuwendung zum Sachverhalt im Wie gegenüber der nominalisierenden Reflexion als Richtung auf den Sachverhalt schlechthin Damit sind unsere Fragen beantwortet: Im schrittweisen Sachverhaltsbewusstsein, das wir Urteilen nennen, „konstituiert sich“ originär eine neuartige Gegenständlichkeit, aber sie ist nicht gegenständlich in dem prägnanten Sinn der Richtung-auf. Sie kann es werden, und dazu bedarf es eines Erfassens, Sich-Richtens-auf. Also nur gewisse eigenartige Akte, die das Eigentümliche haben, schon „konstituierte“ Gegenständlichkeit vorauszusetzen, sind erfassende; und derart erfassende Akte, sich aufeinander bauend, konstituieren Neues, das aber, indem es sich so konstituiert, dadurch erst fähig wird, in einem neuen Erfassen eben erfasst zu werden. Andererseits ist bei der offenbaren Gemeinsamkeit des Begriffs Erfassen sorgsam zu scheiden: Dasjenige Erfassen, das wir im schlichten Anschauen finden, und dasjenige, das wir als Untersetzung im Urteil finden. Das schlichte und eigentliche Erfassen (im klaren Anschauen oder im dunklen, schlichten Vorstellen) kann dem Untersetzen zugrunde liegen und mit ihm einig sein: wie dann das ganze Urteilen auf Anschauen gegründet und mit ihm eins sein kann (genauer gesprochen: eins mit dem schlicht erfassenden Akt, dem schlichten Zuwenden). In der Oberschicht hat dann das Zuwenden des Untersetzens „Richtung-auf“, die auch ohne Anschauung bestehen kann und dann eine Denkzuwendung und ein Sich-richten des Denkens ist. Aber ist wirklich alles schon aufgeklärt? Es ist doch noch Folgendes zu bedenken.1 Erfassen im eigentlichen Sinn ist Nehmen eines Sich-Gebenden. Darin liegt ein Zugewendetsein zum Sich-Gebenden, ein Darauf-Gerichtetsein. Zwischen Zugewendetsein und Gerichtetsein ist hier nicht zu scheiden. Was das Gerichtetsein anlangt, so ist es im Fall eines vielgestaltigen Vorgangs und im Fall einer durchlaufenden Erfassung, bei welcher eine Erscheinungsreihe abläuft, während das Erscheinende eines und 1 Zuwendung und Richtung-auf bei den synthetischen Akten ist nicht ein und dasselbe.

228

explikative und prädikative synthesen

dasselbe ist, worauf wir gerichtet sind, eigentlich etwas Komplexes und sich stetig Wandelndes. Ein dauerndes Objekt, über das wir hinblicken, bietet, vermöge der immer neuen Erscheinungen innerhalb einer Erscheinungskontinuität, immer Neues vom Objekt bzw. auch 5 immer näher sich Bestimmendes, in immer neuer Weise Gegebenes von dem schon weniger klar Gegebenen usw. Der lebendige Strahl richtet sich immer auf Neues vom Objekt; aber das soeben im Strahl Gelegene ist zugleich festgehalten (mag es auch „zurücksinken“, an Klarheit einbüßen, wiedererfasst neue Klarheit gewinnen und 10 im Wiedererfassen den Charakter des „wieder“ erhalten usw.). Im Zeitbewusstsein expandiert sich der kontinuierliche Strahl, sofern er immer neue Lebendigkeit ist, und zeichnen können wir das nur so:

Die Zuwendung oder Richtung-auf ist die auf das Objekt, und sie konstituiert sich dadurch, dass ein lebendiger Strahl des SichRichtens auf immer neue Phasen (zumindest Zeitphasen) geht und zugleich durch Retention das Erfasste in seiner Einheit erfasst bleibt. Das Sich-Richten ist dabei ein Modus der verlaufenden und in ihrer Art in Retention verbleibenden Erscheinungen. 20 G a n z a nd e rs ist die Sachlage für sy n t het is ch s ic h kons t it ui e re n de G e g e n stä n d l i ch k e i te n, also etwa im kategorischen Urteil. Hier finden wir in den „Schritten“, in denen sich der Sachverhalt bewusstseinsmäßig konstituiert auch je eine Richtung-auf. Aber es ist nicht e i n lebendiger Richtungsstrahl, der durch schlichte Erschei25 nungen hindurchgeht in der beschriebenen Weise. Der Erscheinung (Apparenz) entspricht hier das bestimmte logische Gebilde, etwa das nominale Subjekt usw. Jedes solche Glied wird, wenigstens im Allgemeinen, in mehreren Strahlen sich konstituieren, aber so, dass nicht etwa die Retention das in den früheren Strahlen „Erfasste“, 30 sagen wir Erstrahlte, in die Gegenständlichkeit hineinnimmt, die die Gesamtrichtung-auf, die dem abgeschlossenen Nominale zugehört, erstrahlt. Die Richtungen der Glieder des Nominale richten sich nicht (es sei denn ausnahmsweise) auf dasjenige, worauf sich das ganze Nominale richtet. 15

text nr. 12

5

10

15

20

25

30

35

229

Es ist ferner aber auch zu sagen: In gewisser Weise, das lehrt die phänomenologische Evidenz, wird doch in jedem Schritt nicht nur Neues getroffen, worauf die Richtung-auf geht, sondern es wird, was einmal getroffen war, auch festgehalten: obschon es im Allgemeinen aufhört, zu dem zu rechnen, worauf die Richtung-auf des Gesamtkonstituierten, des Gliedes des Sachverhalts, geht. Jedes „Glied“ hat wohl eine Richtung-auf (nur so ist es Syntagma), und wir scheiden für jedes das „Gegenständliche“, das, worauf wir urteilend in diesem Glied gerichtet sind (diesem Glied als vollständig konstituierten), und was im Blick ist als Festgehaltenes der diese Richtung konstituierenden und doch außer ihr liegenden Richtungen. Das Gegenständliche hat sein Wie, das im Blick ist, „der Kaiser, welcher den Reichstag eröffnet hat“: Auf das alles haben wir nicht nur hingesehen, der Blick ruht, wenn wir zu Ende sind, fortgesetzt darauf. Nur auf den Gegenstand Kaiser sind wir aber mit dem ganzen Nominale gerichtet. Das, was der Apparenz im Fall der schlichten Erfassung einigermaßen analog ist, nämlich das Nominale, ist in eigentümlicher Weise im Blick und doch nicht in Richtung-auf. A ls o t rete n h ie r a us e in a nde r : Zu we n d u ng z u d e m „ T he m a “, zu dem ganzen Gehalt des Nominale, und R i ch t un g a uf de n Ge g e nst and. Und zugleich ist es klar, dass, wenn wir Kategorialien auf Kategorialien bauen und ein eventuell sehr komplexer Sachverhalt in der jeweiligen kategorialen Form sich konstituiert, dass dann de r S a c h v e rh al t ni ch t Z i el p unk t e in e r Ri c h t u ng - au f i s t, wä h r e nd e r d oc h G eg en g li e d ei ne r Z u w e nd u n g i s t. Aber wir dürfen noch immer nicht zufrieden sein. „Zugewendet“ (thematisch) sind wir dem Sachverhalt im Wie, all dem, was schrittweise Zielpunkt von Richtungen war und in gewisser modifizierter Weise auch bleibt, und was das gesamte „Thema“, den ganzen Satz aufbaut. Und diese Zuwendung bezeichnen wir als Zuwendung zum Sachverhalt im Wie, denn, was da im Blick ist, das ist in seinen Bestandstücken eben das, was schrittweise in Richtung war. Vollziehen wir nominalisierende Reflexion, so ist der Sachverhalt, aber nicht der Sachverhalt in diesem „Wie“, sondern der Sachverhalt schlechthin Zielpunkt der Richtung-auf. Ganz ebenso wie im Nominale der Gegenstand schlechthin in Richtung-auf ist. Um den Sachverhalt im Wie gegenständlich, also als Zielpunkt zu haben, be-

230

explikative und prädikative synthesen

dürfen wir einer anderen Reflexion, die das, was vordem „im Blick der Zuwendung“ war, zum Zielpunkt einer „Richtung-auf“ macht. Kann man sagen, eine Analogie besteht hier darin: Ein sinnlicher Gegenstand ist Zielpunkt nur dadurch, dass der Strahl der Richtung 5 durch bestimmte Erscheinungen geht? Dadurch ist der Gegenstand nach bestimmten „Seiten“ dargestellt und steht in ihnen bewusstseinsmäßig da. Und viele Erfassungen, die alle denselben Gegenstand erfassen, also dieselbe Richtung haben, können sich dadurch unterscheiden, dass sie denselben Gegenstand in einem verschiedenen Wie 10 erfassen. Das „im Wie“ ist im Blick, aber nicht in der Richtung, nicht ihr Ziel.

15

20

25

30

35

§ 5. Explikation und Verdeutlichung des Sachverhalts durch Wiedererzeugung. Die doppelte Art des Sachverhaltsbewusstseins. Die beiden Arten von Originarität bei synthetischen Akten Nachdem wir im artikulierten Urteil einen Sachverhalt konstituiert haben, können wir den Blick auf den Sachverhalt als Einheit richten, und nun haben wir ihn gleichsam wie einen schlichten Gegenstand. Diesen können wir uns näher bringen, analog wie wir einen schlichten Gegenstand explizieren. Wir bringen ihn „näher“, indem wir nämlich in wiederholter synthetischer Konstitution aussagen „S ist p!“ und dabei das Ausgesagte im schlichten Blick festhalten. Wir sagen etwa so: S ist p! Das Wetter ist trüb geworden! Diese Tatsache ist landwirtschaftlich von großer Bedeutung, diese Tatsache: Das Wetter ist trüb geworden. Wir wiederholen etwa und das halten wir fest. Wiederholend, neu erzeugend expliziert sich gleichsam die Meinung von dieser Tatsache (das Gemeinte). Ist das nun wirklich Explikation? Es ist, wird man sagen, Erfüllung, Bekräftigung der „Meinung“. Aber liegt nicht das Erfassen des Sachverhalts (als kontinuierliches Ergriffen-Haben) zugrunde und deckt sich nicht damit schrittweise das „S ist p“? In der Erneuerung? Ganz wohl. Aber in der Dingexplikation betrachte ich das Ding, aber hier betrachte ich nicht den Sachverhalt. Doch warum könnte ich das nicht? Ich vollziehe „S ist p“ und sehe mir nun den Sachverhalt immer wieder an. Ich sehe mir ihn an: Ich wende meinen Blick auf ihn als

text nr. 12

5

10

15

20

25

30

35

231

einheitlichen Gegenstand und sehe mir seine Teile an. Ich durchlaufe explizierend seine Teile, natürlich in geänderter Einstellung, wobei ich aber immer wiederholen muss: Es ist ein Neu-Urteilen und doch in geänderter „Einstellung“. Das obige Beschriebene war etwas irreführend, insofern als ich nach Vollzug des Sachverhaltsbewusstseins und Rückwendung auf den Sachverhalt als Gegenstand neue Urteile anknüpfen will, wobei das Vorstellen des Sachverhalts inzwischen, während meiner Richtung auf neue Gedanken, leer oder unklar geworden ist, und nun habe ich das Bedürfnis, mir den Sachverhalt näher zu bringen, klarzumachen, mir ihn wieder vor Augen zu stellen, was nicht Explikation ist, nämlich nicht Analyse und Einzelerfassung von Teilen. Es tritt hervor, d ass N ä her b ri ng en , Kla r - und D e ut l ic hm ac he n be i d e n s i nn l ic he n un d k a t ego ria l en G eg e ns t än dl i ch k e i t e n Ve r s c hi e d e n es f o rde rt: Bei den sinnlichen, insbesondere den sosehr inhaltsreichen dinglichen, Analyse, bei den kategorialen Wiedererzeugung, die eo ipso deutlich ist, weil in ihr selbst schon Artikulation liegt. Aber ich kann auch hier sagen: Mit der Neuerzeugung und ihrer Artikulation findet zugleich hinsichtlich des „schlichten“ Sachverhaltsbewusstseins Verdeutlichung im Sinn der Explikation statt. Ein eigentümlicher Unterschied ist aber der, dass schlichte sinnliche Erfassung, wenn sie anschaulich, gebende oder quasi-gebende sein soll, nur ein Zuhandensein voraussetzt, das rein affektiv ist, während das schlichte Erfassen des Kategorialen nur in Hinblick auf artikulierte synthetische Erzeugung bzw. auf das in ihr Konstituierte möglich ist. Und ein weiterer Unterschied ist, dass nun doch das Zuhandenhaben des Sinnlichen blind ist und das des Kategorialen nicht: nota bene des anschaulichen Vorhandenseins. (Denn schon das Vorhandene kann anschaulich und unanschaulich sein: klar und dunkel.) Und da liegt wieder die Schwierigkeit. Ich habe mich ja dazu verstanden, das schlichte Erfassen, Zum-Gegenstand-Machen des Sinnlichen und das Zum-Gegenstand-Machen oder Erfassen des Kategorialen (in einer „Reflexion“, die Synthesis voraussetzt), auf gleiche Stufe zu stellen und unter denselben Begriff zu bringen. (Das ist vollkommen berechtigt nach dem Gemeinsamen der „Richtung-auf“.) Aber ist es vermeidlich, andererseits auch anzuerkennen, dass jedes solche

232

5

10

15

20

25

30

35

explikative und prädikative synthesen

Erfassen etwas gemeinsam hat mit dem Bewusstsein in der Synthesis selbst? Gewiss. Es ist etwas spezifisch Eigentümliches, das Zum-Gegenstand-Machen-und-Haben, das Objektivieren, wie es im einen und anderen Fall vorliegt, ob wir auf ein Ding hinsehen oder auf einen Inbegriff oder auf einen Sachverhalt. Andererseits, wenn wir urteilen, sind wir doch dessen „bewusst“, in einem anderen Sinn „zugewendet“ dem „S – ist p“. Aber diese Zuwendung ist eben keine Objektivierung, kein Gerichtetsein-auf. Umgekehrt werden wir aber sagen müssen, die Objektivierung ist a uc h Zuwendung? Ein Sachverhalt ist in doppelter Art bewusst (ein kategorialer, überhaupt synthetischer Gegenstand): 1) originär, synthetisch-schöpferisch, aber nicht objektivierend; 2) in einer objektivierenden „Reflexion“, schlicht. Jedes synthetisch-schöpferische Bewusstsein eines Sachverhalts (eines synthetischen Gegenstandes) ist in Objektivierungen fundiert und schließt sie in sich ein. In gewisser Weise gilt das zwar auch von dem „frischen“ objektivierenden Erfassen des Sachverhalts: Aber die Objektivierungen haben dann sämtlich den Charakter von Festhaltungen (es sei denn in der explizierenden Wiedererneuerung). Ich spreche von frischen objektivierenden Akten des Erfassens. Nämlich s y n t h e t i sc he A kt e s i nd i n ve r s ch iede ne m S in n o ri g i när u n d n i c ht o r i g i n är. 1) Sie sind ursprünglich synthetisch, wirklich schöpferisch vollzogen in Artikulation, oder sie sind nicht schöpferisch vollzogen, sie haben ihre Artikulation eingebüßt, sie sind verworren, z. B. verworrenes „Auffassen“ eines Satzes oder urteilendes Aussprechen. Diese Verworrenheit ändert nichts am allgemeinen Charakter des Aktes: Das Urteil ist verworrenes Urteil. Es ist diese Verworrenheit nicht zu verwechseln mit einem objektivierenden Vorstellen des Sachverhalts. 2) Die andere Art der Originarität ist die der Klarheit und Evidenz, die ihrerseits Artikulation fordert. Genau dasselbe gilt vom objektivierenden Erfassen von Sachverhalten: Es kann klar und deutlich sein, artikuliert, sofern es sich auf eine artikulierte Synthese zurückbezieht, nicht artikuliert, verworren, sofern es sich auf eine verworrene zurückbezieht. Wohl eine andere Verworrenheit ist die, wo keine soeben noch vollzogene deutliche oder verworrene Synthesis bewusst ist und ich

beilage xviii

233

etwa das Verständnisbewusstsein vollziehe „die Tatsache, dass Sp ist“ – so einfachhin.

5

10

15

20

25

30

Beilage XVIII Rezeptive und produktive Objektivation. Das schlichte Erfassen eines sinnlich-rezeptiv Vorgegebenen gegenüber dem Erfassen im Erzeugen einer neuen Materie in höheren Objektivationen1 Schlichtes Erfassen (schlichte Zuwendung), Sondererfassen in der Explikation, beziehendes Erfassen als das spezifisch thematische oder logische Erfassen in seinen verschiedenen logischen Formen: Das ist zunächst eine Reihe von sozusagen formalen Gestaltungen. Wir brauchen notwendig ein Wort, das sie alle umspannt, wie sie offenbar wesensmäßig zusammengehörig sind und verwandt sind. Es bleibt wohl kein besserer Name übrig als „O b je kt iv a t io n“, und zwar r ez ep t i ve O b jek t iv ati o n für das schlichte Erfassen, p r o d uk t ive Obj e kt iva ti on für das Gebiet der thetisch und synthetisch objektivierenden und dabei Themata produzierenden Akte. Das sind durchaus formale Bestimmungen, weil damit Erlebnisse nur nach einem formalen Aspekt, nur nach einer unselbständigen Seite bezeichnet sind. Eine rezeptive Objektivation ist ein Erlebnis, das so heißt, weil es ein Erfassen ist, aber ein Erfassen ist Erfassen von etwas. Bloßes Erfassen unter Abstraktion von dem Was ist ein Abstraktum. Also zur Konkretion gehört eine Ergänzung: der phänomenologische Stoff der Objektivation (ontisch heißt das, der Gegenstand wird in der und der Darstellungsweise etc. erfasst, phänomenologisch, das Erfassen hat einen Stoff, durch welchen der Gegenstand in bestimmtem Sinn „vorstellig“ ist). Bei den Urteilen bestimmt sich der Stoff durch die Termini und näher durch deren Kerne.2 Die Urteilsformen sind zum Wesen der Urteilsobjektivation als solcher gehörige Formen, doch heißt es hier vorsichtig sein. Es sind zw ei Au f fas s u n gen zu überlegen. 1) Sagt man, im Urteilen läge ein Zugewendetsein zum „Thema“, zum „S ist p“, „Ein A, welches b ist, ist c“ etc., dann kann man doch versuchen

1 Anfang Oktober 1911. – Die vier folgenden Blätter haben zur unmittelbaren Folge die Blätter Π = Husserliana XL, Text Nr. 14: Nominale Setzung im Verhältnis zu hypothetischen und kausalen Urteilen. Urteilsthema (S. 272). 2 Erfassen ist zweideutig. Erfasst ist der Gegenstand (Richtung) – erfasst ist das Thema.

234

5

10

15

20

25

30

35

explikative und prädikative synthesen

zu sagen: Diese Zuwendung ist wie jede Zuwendung (Erfassen ist Erfassen), und Zuwendung als solche (Erfassen als solches) ist nicht zu differenzieren. Sie scheidet sich nur nach dem Was. Im Fall eines sinnlich Vorgegebenen, dem ich mich zuwende, gibt dieses mir das Was, und eventuell baut es sich als ein Vorgang allmählich auf, und ich verfolge den Aufbau in der dauernden Zuwendung. Andererseits: Im Fall des kategorial Sich-Erzeugenden ist zu scheiden die Spontaneität der Subjektsetzung, die Daraufhinsetzung usw. und andererseits die Zuwendung, die Erfassung. In stetiger Zuwendung bin ich dem Sich-Erzeugenden zugewendet, nur dass beim sinnlichen Vorgang etwas sich zuwege bringt, das ich nicht spontan erzeugt habe, während hier das spontane Setzen, Daraufhinsetzen etc. es ist, das das Thema erzeugt.1 Ist diese Ansicht richtig, da n n g e h ö re n al le lo g is c he n F o r m en z u r T h es is u nd S yn t he s is und korrelativ die phansischen Formen zu den betreffenden Aktformen, ha be n a b e r m i t d e r Z uw e ndu n g n ic h t z u t u n . S ie s e lb s t h a t d a m it k e in e F o r m. 2) Die andere Ansicht ist die, dass Zuwendung und Thesis selbst wesentlich eins sind und dass nicht Zuwendung und Thesis zu trennen seien als zwei unterscheidbare Sachen innerhalb der konkreten Synthesis. Es ist hier aber Folgendes nicht zu übersehen. Zuwendung ist nicht bloß zu verstehen als das Übergangsphänomen des „Sich-Zuwendens“, sondern es kommt da an auf das Erfassen, das Erfassen von etwas ist. Und das Erfassen wird zum Betrachten, zum Explizieren in seinen verschiedenen Modi. Aktuell bin ich da dem erfassten Explikanden nach seinen explizierten Einzelheiten zugewendet. Könnte man nicht auch da sagen: Immerfort bin ich zugewendet und zu scheiden sei die Zuwendung und das Substrat der Zuwendung und die Einzelheit, in der ich das Substrat mir verdeutliche etc.? Nun hier ist es aber klar, dass in diesem Spiel der Erfassungen in ihrer aktuellen Einheit alles, was wir da unterschieden haben als Explikand und Explikat, als Explikat erster und höherer Stufe (herrschendes und dienendes), da s s d a s M od i d er „ Z uw e nd u n g “ , d er E r fa ss u n g si n d. Natürlich, überall verteilt sich eine gewisse „Materie“, aber als ein Ab s tr a k te s, das diesem Formalen, das wir in jeder anderen Explikation ebenso finden können, Gehalt gibt. Phänomenologisch habe ich nicht ein Zufassen und daneben etwas, wonach ich fasse, sondern ich habe Erfassungsphänomene mit verschiedener „Materie“ und mit verschiedenen formalen Abwandlungen. Und die vollen Konkretionen, die verschiedenen Erfassungsmodi mit ihrem Gehalt, sind es, die wir als Objektivationen bezeichnen.

1 Das ist aber falsch, weil nicht Rücksicht genommen ist auf den Unterschied zwischen Thema und Gegenstand (Zielpunkt der Richtung-auf).

beilage xviii

5

10

15

20

25

30

35

235

Sollen wir nun damit die synthetischen Erfassungen, das Erfassen eines „A ist b“, „A ist ρ B“, parallelisieren und sagen: Das synthetische Erfassen bestehe nicht etwa aus Synthesis und Erfassen des in ihr Erzeugten, sondern es handle sich um Modi des Erfassens mit einem gewissen Gehalt? Ich habe die Neigung zu dieser Auffassung. Ich kann nicht zweierlei finden, Subjektsetzung, Darauf-Setzung in Synthese und dann den Blick auf das Subjekt, den Blick auf die Synthese und den Blick auf das Daraufgesetzte als solches.1 Zwar im ersten Moment scheint es so: Ich habe ja zunächst die Explikation und dann, könnte man sagen, blicke ich auf die Explikanden, auf das Explikat und auf das „ist“: die synthetische Form. Aber auf den Explikanden blickte ich und blicke ich ohnehin und ebenso auf das Explikat. Und die Sachverhaltserfassung besteht nicht darin, dass ich nochmals diese Zuwendung wiederhole und nur noch auf eine Form der Verbindung oder Einheit beider hinsehe. Vielmehr habe ich jetzt erst das „A ist b“, und es ist da A in dieser jetzigen synthetischen Form nicht einfach der Explikand, sondern das A hat Subjektform, ebenso wie das b Prädikatform hat, und korrelativ das A-Bewusstsein, die Art der A-Erfassung ist eine verschiedene gegen früher. Es ist nicht wieder eine „schlichte“ Zuwendung und nur ein geänderter Inhalt, sondern es ist der Modus der Zuwendung geändert, der Modus der Erfassung. In diesem geänderten Erfassungsmodus erfasse ich etwas (in jedem Erfassen ist das Allgemeine des Erfassens natürlich da), aber das Etwas hat seine Form. Vielleicht kann man sagen: Jeder Modus des Erfassens hat sein Korrelat in einem Erfassten, das „in ei n em M o d us dast eh t“. Nicht ist jede Materie mit jedem Erfassungsmodus zu kombinieren, sondern mit der Änderung des Modus ändert sich auch etwas an der Materie: Sie erhält eine entsprechende modale Form (z. B. Explikat, Explikat zweiter Stufe etc.). Vielleicht ist am schädlichsten, verwirrendsten der Gebrauch des Wortes „Zuwendung“, aber auch bei „Erfassung“ liegen im Wortsinn Versuchungen. Es handelt sich immer um die vollen konkreten Phänomene, die nach einer Seite den allgemeinen Charakter des Im-Blick-Habens, des Erfassens haben (allerdings nach dieser Seite mit allgemeinen Modifikationen wie frisch im Blick haben, noch festhalten) und andererseits ein Was, das im Blick ist mit verschiedenen Formen. Das alles müsste auch ausgedehnt werden auf die eigentlichen Erkennungen, Prädikationen. Das Auf-Begriffe-Bringen, das ist nur ein weiterer, neuer Modus des erfassenden Objektivierens. Jeder neue Modus des Erfassens fasst in neuer Weise: Jeder ist Erfassen mit einem Was, aber mit jedem

1

Entscheidung für 2).

236

5

10

15

20

25

30

35

40

explikative und prädikative synthesen

erhält das Erfasste eine neue intellektive Gestalt, eine neue lo g is c h e F o r m. Das Eigentümliche ist, es sind Fassungen, Formerzeugungen und formende Erzeugungen von Gegenständlichem. Aber es sind auch Erfassungen, sie stehen im B l i ck, und sie sind nicht etwas neben dem Blick, als ob sie, als was sie sind, auch sein könnten, ohne erfasst zu sein. Immerfort steht in ihnen etwas vor Augen, aber in diesem schauenden oder fassenden Blicken, das kein leeres Blicken, sondern objektivierendes Tun ist, erzeugt sich auch etwas. Es ist nicht so wie beim Zusehen eines Erzeugens, beim Zusehen eines Werdens, wo das Werden eins ist und was es ist, ob man zusieht oder nicht, und das Zusehen ein anderes. Vom schlichten Erfassen, dem die Materie durch eine Rezeptivität zuwächst, durch eine Sinnlichkeit, die etwas leistet, ein Bewusstsein, das kein Erfassen, kein Objektivieren ist, das aber die eigentümliche Wandlung erfährt, die wir Zuwendung zu dem vor der Erfassung schon konstituierten Objekt nennen, geht eine Stufenfolge von spontanen Objektivationen empor, die immerfort ein Erfassen, ein spezifisches Bewussthaben oder Im-BlickHaben sind und dabei immer neue Materie mit neuen Formen sich prädikativ zueignen, eventuell in einzelnen Schritten neue „ungeformte“ Materie durch Rezeptivität sich heranziehend und dann „verwertend“. Dabei ist aber zu betonen, dass alle die Ausdrücke, die da gebraucht wurden wie „Zuwendung“, „Im-Blick-Haben“, „Erfassen“, „Objektivation“, ihre irrigen Versuchungen mit sich führen und nicht missdeutet werden dürfen, wenn der Sinn getroffen werden soll, den wir hier bestimmen müssen. Die unterste Stufe war das schlichte Erfassen und Haben eines „Vorgegebenen“, anderweitig schon „Objektivierten“. Im Fall der Sinnlichkeit haben wir hier die Möglichkeit, dass die Objektivation eine solche war, die nichts von „Erfassen“ in sich schloss. Das Wesen dieses sinnlichen Phänomens fundiert die Möglichkeit, es in ein objektivierendes zu verwandeln und so objektivierendes Bewusstsein von einem gewissen Gegenstand zu gewinnen. Und diese Objektivation birgt in sich wieder die Wesensmöglichkeit einer Art Objektivationen höherer Stufe von entsprechendem, durch jene bestimmten Gehalt, etwa eine nominale Objektivation „dies, welches A ist“, die innerhalb einer Urteilsobjektivation der oder jener Form fungiert usf. Das früher schlicht Erfasste ist jetzt nominal gesetzt, Subjekt oder Objekt des Urteils etc. Was auf der unteren Stufe schon in eventuell verschiedener Weise, etwa als selbständiger Explikand oder als bloßes Explikat erfasst war, ist jetzt Subjektgegenstand-worüber oder Objektgegenstand „in Bezug auf den“ und dgl. Das sind neue Weisen der Objektivation, und es wäre verkehrt, weil alle Objektivationen eben Objektivationen, Erfassungen und dgl. heißen, überall das Erfassen vorauszusetzen, das wir auf unterster Stufe oder irgendeiner Stufe finden.

beilage xviii

5

10

15

20

25

30

237

Im nominalen Objektivieren, im Objektivieren, das Voraussetzen heißt, oder im Objektivieren, das (vollständiges) Urteil heißt, wird nicht etwas betrachtet, ist nicht etwas objektiv in der Weise eines sinnlich-betrachtend Erfassten usw. Es ist so, als wollte man, weil immerfort etwas „im Blick“ ist, erfasst ist, überall von einer Wahrnehmung sprechen: Da wir doch gleichsam etwas sehen! Nun heißt es doch immer wieder: Im Erfassen ruhe der Blick auf dem Gegenständlichen, es wird ein Gegenständliches erfasst. Jede Objektivation hat ihr Was, das, was sie objektivierend erfasst, ein Gegenständliches. Und so denkt man unwillkürlich: Es sei etwas Gegenstand in einem besonderen Sinn, in dem ein Betrachtetes Gegenstand ist oder in dem ein Genanntes Gegenstand ist (und eventuell in dem ein Sachverhalt im Urteil Gegenstand ist). Demgegenüber sagen wir aber: Das allgemeine Im-Blick-Haben, Erfassen, Objektivierend-Haben ist nicht solch ein im besonderen Sinn Gegenständlich-Haben, das nur einen Sonderfall davon ausmacht. Hierher gehört insbesondere die fundamentale Tatsache, dass, während das unterste Objektivieren seine Materie aus einer „blinden“ Rezeptivität her hat, im höheren Objektivieren sich eine Materie neu erzeugt und damit eine Gegenständlichkeit „konstituiert“, eine Gegenständlichkeit, die einerseits durchaus objektivierte, also im Blick stehende ist (oder im Blick sich aufbauende), die andererseits aber in derselben Art zum Zielobjekt, Objekt des abzielenden Erfassens gemacht werden kann, wie es das Objekt einer sinnlichen Nennung ist oder auch das Objekt einer sinnlichen, vorlogischen Zuwendung. Der komplizierte kategoriale Gegenstand, der in seiner Weise objektiviert war in der artikulierten Urteilssynthesis, wird in einem spezifischen Sinn nachher zum Objekt, indem ein einheitlicher Richtungsstrahl auf ihn als Ganzes und Einheitliches geht, ihn schlicht erfasst, und darauf gründet sich nun eventuell eine Dies-Setzung, eine neue Urteilssetzung, welche von dem nominalen Objekt, dem Satz, der vermeinten Wahrheit aussagt, er habe die und jene Teile und Eigenschaften. Und in diesem Urteilen konstituiert sich abermals ein Gegenständliches, ein neuer Sachverhalt usw.

238

Beilage XIX Sinnliche Erscheinungen vor und in der Zuwendung. Die Spontaneität des Durchlaufens gegenüber der schöpferischen Spontaneität des Denkens. Gibt es analoge Unterschiede zwischen Zuwendung und synthetischer Erzeugung im Gemüt?1

5

10

15

20

25

30

35

explikative und prädikative synthesen

1) In gewissem Sinn konstituiert sich der empirische Gegenstand „ursprünglich“ nur in einer Spontaneität des Durchlaufens; im „freien“ Ablauf der „motivierenden Empfindungen“ müssen die motivierten Erscheinungen in ihrer Zugehörigkeit bzw. in ihrer Zusammengehörigkeit ablaufen und Einheit konstituieren. In gewisser Weise „erzeugt sich“ auch diese Einheit, der empirische Gegenstand, in einer „Freiheit“ der Spontaneität, als Einheit einer spontan verlaufenden Mannigfaltigkeit. Es genügt nicht überhaupt „Erscheinung“ und Ablauf von Erscheinungen, nicht das bloße Hinnehmen der Erscheinungen und eventuell ablaufenden Erscheinungen (etwa wenn der Gegenstand sich dreht), vielmehr neben dieser Passivität muss freie Aktivität da sein, eben das freie Durchlaufen, die freie Modifikation der „Augenstellung“, der freie Ablauf der „tastenden Bewegungen“ und dadurch die frei-abhängige Modifikation der Erscheinungsreihe, eine Freiheit funktioneller Modifikationen. Die schlichte Wahrnehmungserscheinung und der und der schlichte, rein passive Verlauf von Erscheinungen vollziehen also noch keine „eigentliche Konstitution“. Es muss das freie Umblicken, das freie Betrachten, das freie Durchlaufen (und dabei Regieren) der Erscheinungsverläufe statthaben. Nun ist hier einiges zu überlegen. Zunächst möchte ich fragen: Was ist das für eine Spontaneität, für eine „Freiheit“? Müssen wir nicht unter dem Titel „Freiheit“ sondern? Wenn ich nicht dem Gegenstand zugewendet bin und die Augen „unwillkürlich“ bewege: Wie ist es da mit den zugehörigen Erscheinungen? Gehen sie nicht zu Einheiten zusammen? Wenn ich irgendeinem Gegenstand zugewendet bin, ihn betrachtend und ihn nach verschiedenen Seiten durchlaufend, so durchlaufen auch die Erscheinungen der Umgebung ihre „Mannigfaltigkeiten“. Und kommen sie nicht zur Einheit, sofern, während mir der Gegenstand in der Zuwendung als der eine sich nach den oder jenen Seiten eigentlich konstituierende dasteht, auch ein stetes Einheitsbewusstsein der einen Umgebung statthat? Muss man nicht vorerst für die „mitaufgefasste“ Umgebung das zugestehen und ist nicht sicher eine Umgebung mitaufgefasst: Der Gegenstand 1

Wohl Oktober/November 1911. – Anm. der Hrsg.

beilage xix

5

10

15

20

25

30

35

40

239

erscheint im umfassenden Raum, in einer Umgebung anderer Dinge, obschon ich nur ihm selbst (und diesen Seiten) zugewendet bin? Wie sollen wir uns dann hinsichtlich des ferneren Quasi-Hintergrundes verhalten? Eventuell „empfinde ich plötzlich“ den Druck der Kleider. Ich habe ihn immerfort empfunden. Ist die Auffassung erst mit der Zuwendung da? Ist sie nicht schon im voraus da, und bei den unbeachteten Stellungsänderungen meines Leibes: Gehen die Kleidererscheinungen nicht immerfort zu Einheiten zusammen? Es ist schwer, hier etwa zu sagen, dass nur für die nähere Umgebung, für die Umgebung im aufweisbaren Bereich, von der wir doch sagen und sagen müssen, dass innerhalb ihrer das Objekt der ausgezeichneten Erscheinung erscheint, das Zusammengehen der Erscheinungen zur Einheit angenommen werden muss. Ist das nun eine wirkliche Spontaneität? Wenn wir uns gedrängt fühlen zuzugestehen, dass auch die unwillkürlichen Augenbewegungen, die „motivierend“ sind für das Zusammengehen der Erscheinungen der unbeachteten Gegenständlichkeiten, so etwas wie „Freiheit“ haben und dass auch diese Erscheinungen als in Freiheit modifizierte ihrem Ablauf nach ihre Freiheit haben, müssen wir dann nicht sagen, dass diese Freiheit etwa ganz anderes ist als Spontaneität in dem Sinn, in dem wir diese den Akten des Sachverhalt konstituierenden Meinens zuschreiben? Halte ich die Augenstellung fest (ein freies Fixieren), so ist die motivierte Erscheinung in ihrer Unveränderung oder in ihrem mannigfaltigen Wechsel als bloße Passivität gegeben. Verändert sich die Augenstellung im freien Durchlaufen der oder jener Richtungen, so ist mir zwar immer die motivierte Erscheinung passiv gegeben, aber ich bewege mich frei in einer festen, vorgegebenen Ordnung mannigfaltiger Erscheinungen. Im freien und allseitigen Durchlaufen der motivierenden „Umstände“ sind fest zugeordnete und in ihrer Ordnung vorbestimmte Motivate bewusst, die Erscheinungen in ihrer geordneten Mannigfaltigkeit laufen motiviert ab, und darin konstituiert sich ursprünglich-eigentlich die Einheit des Gegenstandes als Einheit seines bestimmten gegenständlichen Inhalts. Jede Erscheinung ist Erscheinung des Gegenstandes in einer bestimmten (mehr oder minder bestimmten) Orientierung, und die freie Änderung ist Änderung der Orientierung. Ich durchlaufe den Gegenstand, indem ich dem in einer Orientierung erfassten immer neue Orientierung gebe, wobei er eben als Identisches, das sich stetig in verschiedenen Orientierungen zeigt, und als in Stetigkeit Identisches bewusst ist. Der Gegenstand ist das Identische der Mannigfaltigkeit seiner Erscheinungen = er ist das Identische der Mannigfaltigkeit von Gegenstandsorientierungen, von Weisen der Orientierungsphänomene des Gegenstandes in Bezug auf das Ich. Die Erscheinungen sind nicht bloß überhaupt Erscheinungen, Darstellungen, Vorstellungen von

240

5

10

15

20

25

30

35

40

explikative und prädikative synthesen

dem Gegenstand. Sie sind immer Erscheinungen, die zugleich den Gegenstand als so und so orientierten bewusst haben. Insoweit konstituiert jede Erscheinung der Mannigfaltigkeit etwas Besonderes und Neues. Andererseits, jede ist Erscheinung des Gegenstandes hinsichtlich seines Inhalts, hinsichtlich seiner Farbe, Form etc.; und dieser selbe gegenständliche Inhalt ist Einheit der kontinuierlich ineinander übergehenden Erscheinungen, sich in diesen kontinuierlichen Übergängen in eigentlicher Weise „ursprünglich“ konstituierend. Die Orientierung ändert sich aber auch von Seiten des Gegenstandes, der erscheint in seiner „Bewegung“. Sie ändert sich nämlich entweder durch mein freies Durchlaufen, durch mein Sich-Bewegen (mein „Standpunkt“ ändert sich frei) oder durch das Sich-Bewegen des Gegenstandes. Dieselbe Erscheinungsveränderung konstituiert je nach der Weise der Motivation (Durchlaufen oder freies Festhalten des Standpunktes) den unbewegten Gegenstand, zu dem ich mich anders stelle und der mir „daher“ anders erscheint, oder den bewegten Gegenstand, der zu mir seinen Standpunkt verändert usw. Sagen wir nun, dass sich der Gegenstand „u r s p r ü n g l i c h“ im freien Durchlaufen konstituiert, dass er doch hier zur Gegebenheit kommt, so ist andererseits zu sagen, dass in gewisser, wenn auch unvollkommener Weise der Gegenstand sich schon in einer einzelnen Erscheinung (und jede Phase ist zu extendieren zeitlich zu einer konkreten Erscheinung) konstituiert. Jede ist schon Erscheinung des Gegenstandes und Anschauung von ihm, gebendes Bewusstsein von ihm, und Bestandstück einer möglichen vollkommeneren, den Gegenstand inhaltlich vollkommen konstituierenden Erscheinungsreihe. Jede Erscheinung konstituiert etwas vom Gegenstand ursprünglich, und darum ist jede nötig für die volle Konstitution des Gegenstandes, keine ist im Grunde zu entbehren. Und die Konstitution des gegenständlichen Inhalts vollzieht sich immerfort durch diese Erscheinungen, die Zuständlichkeiten sind und deren Folge nur einer spontanen Durchlaufung zugänglich ist. Der Gegenstand ist immerfort bewusst von Anfang bis Ende seines Erscheinens, immerfort erscheint er, er ist der Spontaneität vorgegeben. Dagegen ist der Sachverhalt, ist der sich im Denken konstituierende Gegenstand erst durch das spontane Denken gegeben, insofern nachgegeben. Verstehen wir allgemein (in einem erweiterten Sinn) unter Erscheinungen Gegenstände ursprünglich konstituierende Erlebnisse (gebende), so zerfallen die Erscheinungen: 1) in sinnliche Erscheinungen (rezeptive). Sie sind dadurch charakterisiert, dass durch sie der Gegenstand schlicht gegeben, im Erfassen immerfort vorgegeben ist, dass die Spontaneität des Erfassens selbst vom Gegenstand nichts konstituiert, sondern ihn nur durchläuft, und dass das Durchlaufen zwar eine Bedingung vollständiger, angemessener Gegebenheit ist, aber nicht sie selbst konstituiert den Gegenstand, sondern die mit dem

beilage xix

5

10

15

20

25

30

35

241

Durchlaufen ineinander übergehenden und sich durch sich selbst vereinheitlichenden Erscheinungen. Das Einheitsbewusstsein ist kein spontanes Tun, sondern es ist die Deckung der Erscheinungen, und allenfalls richtet sich ein Strahl der Zuwendung dieser Einheit zu. Er erfasst, er konstituiert und erzeugt aber nicht. 2) Die Verstandeserscheinungen, die Erscheinungen, die spontane Erzeugnisse sind; die spontanen Setzungen sind selbst konstitutiv für Gegenständlichkeit, so schon die Zusammenfassung etc. Wir haben also zu scheiden: 1) Die Spontaneität eines phänomenologisch-psychischen Geschehens, die Spontaneität der Hinwendung, der Durchlaufung, der Explikation und Prädikation usw. 2) Das Sich-Zuwenden, die Verlebendigung der toten Auffassung, das In-den-vorgegebenen-Gegenstand-Eindringen, ihn durchlaufen, das Explizieren, die Bereicherung des Explikanden, das Beziehen, das Begreifen und Urteilen: Das ist eine zusammenhängende Gruppe von spontanen Akten, die der im weitesten Sinn vorstellenden (objektivierenden, verstandesmäßigen) Akte. Darin scheiden wir gebende Akte, Ursprungsakte, und solche, die es nicht sind. Und wieder in den gebenden, die aus den Quellen der Passivität bloß nehmen, und die schöpferisch spontanen, die einen neuen Gehalt ursprünglich erzeugen. „Ur s p r ü n gli c he E rwe r b un g“. Es ist dann aber die Frage: Gibt es neben den schöpferischen Erzeugungen der Urteilssphäre, der Verstandessphäre im weitesten Sinn, nicht auch schöpferische Erzeugung des Gemüts, wodurch Gegenständlichkeiten konstituiert werden, die zwar vorgegeben sind für den erfassenden und denkenden Verstand, aber nicht passiv vorgegeben, sondern schöpferisch erzeugt? Und haben wir wie Unterschiede der vorstellenden Zuwendung und synthetischen Erzeugung im Verstandesgebiet auch Unterschiede zwischen Gemütszuwendung und synthetischer Gemütserzeugung als Analoges? Freilich, da sind die bekannten Schwierigkeiten (die in gewissem Sinn schon zeigen, dass diese Analogie keine vollkommene sein kann). Das Verstandestun ist etwas Leeres, es formt eine vorgegebene Materie, die Form ist „leere“ Form. Die Gemütsform ist nicht leer. Aber ist diese Rede nicht nur statthaft vom Standpunkt des hinterher objektivierenden Verstandes, demgegenüber natürlich alles, was nicht verstandesmäßige Form ist, „voll“, eben Materie ist?

Nr. 13 Z uw en d un g u nd D en ke n . Di e F r age d es S u bs tr at s1

§ 1. Die formende Spontaneität des prädikativen Meinens gegenüber dem bloßen Erscheinen und Erfassen. Das Erkennen als Erscheinungscharakter

5

10

15

20

25

30

Jedes Meinen hat ein Substrat: 1) Das schlichte Meinen hat als Substrat eine Erscheinung, dessen Erscheinendes es meint. Natürlich eine qualifizierte Erscheinung; das Meinen bringt nicht die Qualität hinein, bringt keine neue Qualität hinein. 2) Das synthetische Meinen hat Glieder, und jedes Glied hat sein Substrat (wobei aber eventuell in mehreren Gliedern dasselbe Substrat auftreten kann?).2 Wie ist es nun? Wir schreiben der gesamten Synthese eine Qualität und eine Materie zu. Ist das Verhältnis dieser Gesamtqualität zur Gesamtmaterie das gleiche wie bei den schlichten Akten bzw. bei den bloß qualifizierten sinnlichen Erscheinungen? Eine einheitlich qualifizierte Erscheinung ist eine Apparenz, die durch und durch von der Qualität durchtränkt ist; jeder mögliche Teil der Apparenz hat denselben qualitativen Charakter, jedes Moment. Muss man das Gegenteil von den synthetischen Akten sagen? Und muss man andererseits nicht doch sagen, dass sich im synthetischen Akt eine Materie, ein „Sachverhalt“ mit einer Gesamtqualität konstituiert, also das Ganze doch eine „Erscheinung“ mit einer Qualifizierung auszumachen scheint? Versuchen wir, die Sachlage so zu beschreiben: Nehmen wir eine einfache prädikative Synthese, ob eine eigenschaftliche oder relationelle. Wir haben dann eine Untersetzung, eine schlichte Zuwendung zum und Erfassung des Subjektgegenstandes und eine Formung, 1

Oktober/November 1911. – Anm. der Hrsg. Das kann doch nur sagen, jedes intuitive, jedes in voller Ursprünglichkeit vollzogene? Also auf dem Grund schlichter Perzeptionen. 2

text nr. 13

5

10

15

20

25

30

35

243

die das Subjekt als solches auszeichnet. Die bloße Zuwendung zum erscheinenden Gegenstand, wodurch die Erscheinung zur SubstratErscheinung wird für die bloße Explikation, ist noch nicht die Subjektion und die durch sie hereingebrachte Formung. Genauer müssen wir sagen: Zunächst haben wir die Veränderung, die eintritt dadurch, dass die Erscheinung (die qualifizierte immer) zur Unterlage der Hinwendung wird, dann die weitere Modifikation, die eintritt, wenn die Erscheinung zum Explikationssubstrat insofern wird, als ja durch den Übergang zum Explikat die Form des Explikanden erwächst. Das ändert im Wesen nicht die Erscheinung selbst. Es ändert sich die Funktion, und die Erscheinung nur insofern, als diese die neue Funktion mit sich bringt. Und dann weiter das Neue der eigentlich prädikativen Synthese. Hier tritt also das Eigentümliche der M ei n ung i m Si nn de s „ p r ä di k a ti v e n U r te il s “ auf mit all ihren syntaktischen Formen; die Meinung, das ist nicht b lo ßes Z ug ew end e ts ei n, bloßes Erfassen aufgrund eines Erscheinens, sondern hier haben wir gegenüber dem bloßen Erscheinen eine eigentümliche Formung, die eine völlig neue Dimension ausmacht. Und dieses Neuformen hat nicht etwa den Charakter einer Qualifizierung, ist also nichts spezifisch zum „Glauben“ Gehöriges, als einer Qualität, die schon in der Schicht der bloßen Erscheinung auftritt. Wir prädizieren aufgrund von Erscheinungen, die damit einerseits als Substraterscheinungen für ein SichHinwenden fungieren und andererseits als Substraterscheinungen für die formende Spontaneität des prädikativen „Meinens“.1 Aber wie steht da nun Erfassung, Zuwendung und dieses prädikative Meinen? Kann man zunächst das Z uw e nd e n und Er f as se n als etwas Verschiedenes ansehen? Es scheint nicht. Es sind zwei Worte für dasselbe. Im Zuwenden erfasse ich ein Erscheinendes, ein „Vorstelliges“, und dieses Erfassen ist nicht als wirklich nehmen oder als Wirkliches nehmen; was da erfasst ist, hat seinen Charakter schon, bringt ihn durch die „Erscheinung“, die ihre Qualifizierung hat, mit sich. Kann man dann weiter das Zuwenden oder Erfassen schon als primitivste Art des urteilenden Meinens ansehen, als schlichtes „Set-

1

Bedeutet dabei aber Substrat beiderseits noch dasselbe?

244

5

10

15

20

25

30

35

explikative und prädikative synthesen

zen“, derart wie im Urteil ein Setzen statthat, in der prädikativen Synthese? Ist es nicht richtiger, diese Frage zu verneinen und zu sagen, bloßes Erfassen sei zwar eventuell Unterlage eines prädizierenden Verhaltens, aber mit diesem trete etwas völlig Neues ein, eben das Prädizieren, das Bestimmen als so-seiend, das Behaupten, wodurch das einfach Erfasste alsbald seine prädikative Form erhält und sich in Sachverhalt-Gegenständliches verwandelt. Schwierigkeit macht hier allenfalls das mit dem Prädizieren Hand in Hand gehende „Erkennen“. Ich erfasse nicht nur die Person, die jetzt auf der Straße sichtbar ist, ich erkenne sie als „Hans“. Ich meine natürlich nicht prädikativ: „Das ist Hans.“ Das ist freilich etwas Eigenartiges und für sich zu Beschreibendes. Wir werden auch wohl sagen müssen, dass es ein Vorkommnis ist, das nicht wesentlich gehören muss zur Sphäre der Meinungen. Ich blicke in eine Landschaft und erkenne ein Haus wieder, und ich erkenne nun die ganze Landschaft wieder: Der Hintergrund, noch ehe ich mich ihm zuwende, noch ehe ich die gesamte Landschaft zum Objekt der Zuwendung mache, wird erkannt. Das Erkennen breitet sich sofort über den Hintergrund aus und seine Erscheinungen bzw. über die Erscheinungseinheit. A uc h d a s Er k e nn e n i s t e i n C ha rak te r, de r di e E r sc he i n u ng c h a r a k te r i s i e r t, mag dazu „Identifizieren“ gehören oder nicht. Man wird ja sagen: Wenn ich wiedererkenne und ein Erinnerungsbild des früher gesehenen Hauses auftaucht, so steht das ja auch schon als „bekannt“, nicht neu da, und das jetzt neu Erfasste identifiziert sich in einer vereinheitlichenden Deckung, nicht in eigentlicher synthetischer prädikativer Deckung, mit dem „Bekannten“. Jedes Erinnerte hat den Charakter „bekannt“. Und heißt hier bekannt anderes als Charakter der Erinnerung? Aber auch Gesehenes, Perzipiertes hat den Charakter „bekannt“, es hat den Erinnerungscharakter, den Charakter: „Das habe ich schon gesehen“. Das weist auf eine „verborgene Deckungseinheit“ zwischen der perzeptiven Erscheinung und dunklen Erinnerungserscheinungen hin. Freilich, Erkennen ist noch nicht Eigennennen, und überhaupt Nennen. Aber bringt der Eigenname schon eine Form der spezifisch doxischen Meinung, eine Urteilsform, Denkform mit sich? Erhält der Name, erhält das Nominale, und zwar das durch den Eigennamen Genannte, nicht erst in der Prädikation eben prädikative Form? „Der“ Hans, „den“ Hans etc.

text nr. 13

245

Das Erkennen, soweit es allgemein zum Ausdrücken gehört, scheiden wir also aus und fassen es nicht als wesentlich zum prädikativen Meinen gehörig und nicht als dessen Formen irgend fordernd; obschon natürlich fähig, jede dieser Formen auszudrücken.

5

10

15

20

25

§ 2. Im anschaulichen Urteil „erscheint“ ein Sachverhalt. Ein Sachverhalt kann in verschiedener Weise bewusst und Gegenstand der Zuwendung sein G e hö ren n un ab er n i c h t gl e ic hw oh l E rf a ss en u n d P räd i z i e r e n z u sa m m en? Kann ich Prädizieren, ohne mich dem Subjekt, Prädikat etc. zuzuwenden? Ohne es zu fassen? Andererseits, regt sich nicht oft „im Hintergrund“ ein Gedanke, dem ich mich nachträglich zuwende, den ich nicht nur zum Ausspruch, sondern zur artikulierten Meinung bringe? Aber ist nicht schon vorher die „Meinung“ da, die Prädikation also quasi-vollzogen, vollzogen und doch nicht in der Zuwendung vollzogen, nicht eigentlich vollzogen? Und in Zusammenhang damit steht die Frage: Prädizierend bin ich doch dem Sachverhalt zugewendet (oder wenn nicht zugerichtet: prädizierend bin ich mir doch eines Sachverhalts bewusst)? So wie ich mir in einer sinnlichen Erscheinung eines Gegenständlichen bewusst bin, aber nur ausnahmsweise ihm zugewendet, so bin ich mir im Prädizieren eines Gegenständlichen höherer Ordnung, eben des Sachverhalts bewusst, aber nicht immer ihm zugewendet. Und weiter: Im anschaulichen Urteilen „erscheint“ auch etwas, es erscheint ein „So ist es!“ Erscheint in der sinnlichen Erscheinung ein Dingliches oder ein Vorgang, so „erscheint“ es im anschaulichen Urteil, dass das Ding so und so beschaffen ist.1 (Und das überträgt sich auf alle Sätze, Wahrscheinlichkeitssätze etc.) Also scheint doch die prädikative Synthese eine eigenartige Verknüpfung von qualifizierten Apparenzen zu neuen Apparenzen, von Erscheinungen zu neuen

1 Ja, im Wahrnehmungsurteil, im sehenden Urteil. Das Zu-sein-Scheinen im bloß vermeinenden Urteilen ist kein Erscheinen des Sachverhalts, und nur der erscheinende Sachverhalt ist im Sachverhaltserscheinen, im sehenden Urteilen gegeben und ähnlich bewusst wie der gegebene Gegenstand in der sinnlichen Erscheinung; aber mit dem Unterschied, dass er nicht Zielpunkt einer Richtung-auf ist.

246

5

10

15

20

25

30

35

explikative und prädikative synthesen

Erscheinungen zu sein, mögen wir auch Grund finden, zu sagen, diese höheren „Erscheinungen“ seien keine sinnlichen. Es ist hier Folgendes zu überlegen: Ein bloßes Sich-Zuwenden zu etwas „V o rge geb en em“ ist also das denkende, prädizierende Meinen nicht; zu etwas Vorgegebenem, das im Wesen in derselben Art „erscheinen“, „konstituiert“ sein kann wie in der Zuwendung, so vor und nach ihr. A b e r e i n Z uw e n den li eg t d o ch v or. Das denkende Meinen ist ein spontaner Akt, ei n e S p on t a ne itä t , d ie or ig in är kon st it u ier t, die erzeugend konstituiert, w a s o ri gi nä r n u r i n d i e s er E r z e ugu ng ge gebe n i st. Und das Ich kann nichts spontan erzeugen, ohne dabei zuzu„sehen“ (nicht seinem Erzeugen, sondern dem Erzeugten), das heißt, ohne im Stufenbau der Erzeugungen der Erstehung des Erzeugten zugewendet zu sein. Das Zugewendetsein, das Erfassen ist dem Allgemeinsten nach hier kein anderes als da, wo wir, statt denkend zu „meinen“, in der Passivität eines Erscheinens leben; und Ähnliches wäre schon vorher zu sagen für die explikativen Übergänge, die noch unter der prädikativen Synthese liegen. Da ist aber die Rede von „originärer Gegebenheit“. Das Wort Gegebenheit kann hier irreführen. Es kommt zunächst darauf an, zu beachten, d a s s e i n U r t ei l s v er m ei nt es , e i n Sa ch ve r ha lt in v e rs ch i e de n e r W e i s e b e w us s t un d d abe i „ G e g en st a nd “ d e r Zu w e n du n g s e i n k a n n (wobei die Frage sein wird, ob dieser Unterschied eigentümlich zu den spontan konstituierten Gegenständlichkeiten gehört oder nicht). 1) Fürs Erste kann die S p o n t a ne i t ä t d e r E r ze ug ung statthaben, und im Fortgang der spontanen Akte und ihrer inneren Einheit konstituiert sich schrittweise der Sachverhalt, der aber fertig konstituiert erst ist, wenn das Erzeugen vorüber ist. Und wie schon gesagt: In diesem Fortgang des spontanen Setzens ist der betrachtende oder erfassende Blick zugewendet dem Sich-Konstituierenden. 2) Fürs Zweite kann der fertig konstituierte Gegenstand festgehalten werden, sozusagen als U r t e i l s e r g e b n i s, und nun erhält er etwa die Form des Dies, des Subjekts für eine neue Prädikation. Die originär konstituierende Prädikation ist abgelaufen und nachdem sie es ist, bin ich mir des Sachverhalts „noch“ bewusst. Die Intention ist nicht die fortdauernde „Erscheinung“ des Sachverhalts (etwa wie man die Erscheinung eines Gegenstandes dauernd haben kann, freilich nicht des Gegenstandes in seiner bestimmten Dauer: in der Dauer

text nr. 13

5

10

15

20

25

30

35

247

der Erscheinung erscheint derselbe Gegenstand, aber nach einer anderen Zeitstelle), sondern eben Retention, Noch-Bewusstsein. Und nun kann auch Festhaltung und neue Formung eintreten, nämlich die Formung als „dies“, als Subjekt einer neuen Prädikation und dgl. 3) Ich kann mich auch einem anderen zuwenden, während ich n o c h Fe st ha lt un g übe, oder vielleicht nachdem ich sie nicht mehr übe, und dann auf das Festgehaltene mich mit einem Strahl der Aufmerksamkeit zurückwenden, und bei dieser Zurückwendung habe ich ein Wi eder er f a sse n, bei dem eine „verworrene“ Sachverhaltsvorstellung, ein „verworrenes“ Bewusstsein des „S ist p!“, aber keineswegs ein wiederholendes, den Sachverhalt artikuliert konstituierendes Bewusstsein vollzogen ist. Hier haben wir einen Strahl der „Aufmerksamkeit“, einen Strahl der Zuwendung auf die „Meinung“, auf den komplizierten beweisenden Zusammenhang und dgl. Es ist nicht ein synthetischer Zusammenhang vollzogen mit all den Untersetzungen und Daraufsetzungen, mit all den einzelnen Strahlen der Zuwendung, die in den Gliedern walten und doch wieder ihre Einheit haben in einer durchgehend einheitlichen Zuwendung. Vielmehr haben wir einen einfachen Strahl, der hindurchgeht durch eine gar nicht artikulierte, verworren einheitliche „Vorstellung“, in der das Gegenständliche (das gar sehr kompliziert und in sich gegliedert ist) in einem verworrenen Eins erfasst und nach keinem Glied besonders gefasst ist. 4) Es kann auch sein, dass ein „Gedanke“, genauer eine Urteilsmeinung auftaucht, im Hintergrund sich regt, vorschwebt, noch ehe ich auf sie hinsehe, noch ehe irgendein Strahl der Zuwendung ihr und ihrem Inhalt gilt. Es braucht sich um gar keine Wiedervergegenwärtigung zu handeln; es soll natürlich hier nicht eine Retention sein einer eben gewesenen artikulierten Prädikation, die mit ihren Zuwendungsstrahlen herabgesunken ist usw. Diesem verworrenen Urteilsgebilde, wir pflegen hier von einem dunklen Gedanken, einem Einfall etc. zu sprechen, wenden wir uns nun zu: Ein Strahl der „Aufmerksamkeit“ geht durch diese Verworrenheit hindurch auf den betreffenden verworren bewussten Sachverhalt, und eventuell bringen wir uns diesen „näher“, machen ihn uns deutlich und klar; eventuell gestaltet er sich dabei bei Erhaltung eines gegenständlichen Hauptgehaltes etwas um, und nun „urteilen wir wirklich“, vollziehen wir wirklich das Urteil „S ist p!“ Sprechen wir schlechthin davon,

248

explikative und prädikative synthesen

dass wir urteilen, so haben wir diese Art des Vollzugs in der Regel im Auge. (Sprechen wir von einer Meinung, dann wohl nicht: Wir sagen zum Beispiel, meine Meinung kann ich so ausdrücken …) Ebenso wenn wir von dem Führen eines Beweises sprechen. Der Beweis kann 5 aber auch vorschweben, es kann eine verworrene „Beweisidee“ sein etc.1

10

§ 3. Die stetige Konstitution der dinglichen Einheit im Fortgang des Erscheinungsabflusses. Die dem Abfluss einer Erscheinungsreihe einwohnende Zuwendung gegenüber dem retrospektiven Blick auf die herabgesunkene Erscheinungsreihe und die durch sie konstituierte Einheit

Wir haben also mannigfache Art, in der uns eine prädikative Gemeintheit, ein Sachverhalt bewusst werden kann, gewissermaßen „erscheinen“ kann, und e s f ra g t si c h, w ie si ch di e s e „ E rs c hei 15 n un g e n “ v o n S a c hv e r h a l te n, di ese B e w us s t se i ns w e is en , i n d e n e n u n s „ Sa c h v er h a lt e “ z u m B ew u s st se i n k om m e n, c ha r a k t e r i si e r e n s ol l e n g e ge n ü b er d en E r s ch ei nu ng en i m g e wö h n l i c h e n Si nn , d e m B e w uss t sei n, i n de m u ns e i n e „ s i n n l i ch e “ Ge g e ns tä n dl i c h k e i t z u B ew uss t s ei n ko m mt. 20 Man könnte zunächst Gewicht darauf legen, dass ein sinnlicher Gegenstand, ein Ton, ein Ding, uns schlicht, in einem punktuellen Hinblicken zum Bewusstsein kommt, sofern er in der ihn konstituierenden Erscheinung sozusagen mit einem Schlag konstituiert ist. Der Gegenstand mag unverändert andauern oder sich verändern, 25 demgemäß wird die Erscheinung, ob sie von einem hinwendenden Blick durchstrahlt ist oder nicht, bald unverändert andauern (oder unverändert dauernd sein können), bald sich notwendig verändern, wofern eben der unveränderte oder veränderte Gegenstand sich in ihr konstituieren, in ihr als solcher erscheinen soll. Aber sowie die

1 Gerade der wichtige Unterschied zwischen artikuliert Urteilen und explizierend, aufgrund einer Gegebenheit Urteilen ist nicht erörtert. Nur in diesem Fall des intuitiven, sehenden Urteilens ist aber von Erscheinung des Sachverhalts wirklich die Rede.

text nr. 13

5

10

15

20

25

30

35

249

Erscheinung anhebt und bewusst ist, ist schon die Einheit des Gegenstandes erscheinend und so kann sich ihr das Erfassen schlicht „zuwenden“. Aber da ist zu beachten, dass jede sinnliche Erscheinung in gewisser Weise Erscheinung von dem einen Dauernden oder sich Verändernden ist, ebenso aber auch Erscheinung von dem dauernden Ding, von der Dauererstreckung der Unveränderung, oder im anderen Fall von der durch eine Dauer sich hindurch erstreckenden Veränderung: Kurzum, im weiteren Sinn ist Erscheinung einerseits Erscheinung von dinglich-substanzialen Einheiten, andererseits Erscheinung von dinglichen Vorgängen (im weiteren Sinn). Dieselben Erscheinungen können für den erfassenden Blick das eine und das andere darbieten, er „richtet sich“ bald auf die Dingeinheit, bald auf den Vorgang (der in einem anderen Sinn Einheit ist). Natürlich kann der erfassende Blick auch immer, aufgrund derselben Erscheinungen, auf „Eigenschaften“ gehen, nämlich auf Eigenschaftsmomente, auf unselbständige innere Momente, Formen, auf Stücke, Glieder, auf Verbindungsformen „verschiedener“ Gegenstände miteinander, auf Veränderungen, auf Vorgänge, an denen verschiedene Gegenstände beteiligt sind (dann aufgrund der erscheinungsmäßigen Einheit mehrerer Erscheinungen) usw. Man wird nun sagen müssen: Erscheinungen, die Einheit einer Erscheinung aufbauen, haben ihre Zeiterstreckung (nämlich ihre Ausbreitung im phänomenologischen Ablauf des inneren Bewusstseins), und in dieser Erstreckung sind sie unermüdlich konstituierend beschäftigt. Was sich in einer Strecke konstituiert, konstituiert sich in dieser Vollständigkeit nie in einem Teil der Strecke; es ist ein stetiges Konstituieren, immer weiter fortschreitend. Im Ablauf der Erscheinung schreitet auch der „erscheinende Gegenstand“ fort, immer neuen Inhalt annehmend. Die im ersten Moment konstituierte Einheit ist ja freilich schon die Dingeinheit, aber dass diese Einheit die eine und selbe ist im ganzen und weiteren Verlauf des Erscheinens, das sagt, dass eben ein durchgehendes Einheitsbewusstsein einigend vorhanden ist, im Wesen der Erscheinungsphasen gründend; und es sagt nicht, dass die Einheit ein leerer Punkt ist, dem weiter nichts hinzugefügt wird, vielmehr ist es ja immer die sich bald so, bald so darstellende und inhaltlich ausgestaltende Einheit, demnach bald so, bald so in Explikation und Prädikation zu bestimmen.

250

5

10

15

20

25

30

35

explikative und prädikative synthesen

Der inhaltlich bestimmte Gegenstand, genauer das Erscheinende als solches in seinem Gehalt, „baut sich“, konstituiert sich mit Fortgang des Erscheinungsabflusses stetig auf, und erst wenn wir am Ende sind, hat sich das Ganze konstituiert. Richtet sich der aufmerkende Blick auf den Vorgang, so ist es auch klar, dass dieser Blick stetig erfasst und dass der Vorgang als einheitlicher Gegenstand erst fertig erfasst ist, nachdem die stetigen Erfassungen, die „von ihm“ Phase für Phase fassen, zum Endpunkt des Vorganges gediehen sind. Wir überlegen nun, dass die Zuwendung zu einem Vorgang in sehr verschiedener Weise „erscheinungsmäßig“ fundiert sein kann. 1) Einmal können wir die Erscheinungsreihe, die ihn konstituiert, sei es in Wahrnehmung oder Erinnerung, jedenfalls in verlaufender Anschauung erleben, und zwar so, dass diesem Anschauungsverlauf stetig der zuwendende Blick einwohnt. 2) Fürs Zweite kann es sein, dass wir, nachdem der Vorgang in dieser Weise erscheinungsmäßig im Aufmerken (= im zuwendenden Erfassen) abgelaufen ist, wir uns nun ihm als Ganzem retrospektiv zuwenden, in einem Überschlag, während sich in diesem „Überschlag“ nicht etwa die Anschauung des Vorganges, sei es auch als „wiederholende Vergegenwärtigung“ erneuert, also sich der Vorgang von neuem anschaulich konstituiert. Es ist, als ob das Konstituierte anstatt in lebendig-beweglichem Abfluss einer Erscheinungsreihe in einer unlebendig erstarrten Erscheinung erschiene, als ob in der Retention, die an die lebendig abfließende Erscheinungsreihe angeschlossen ist, von ihr eine Erstarrungsmodifikation zurückgeblieben wäre, als wäre der Vorgang nun etwas in dem jetzigen Bewusstsein so Erscheinendes wie ein unverändertes Ding, auf das wir wiederholt hinsehen können in einem schlichten Blick. Aber freilich, diese Beschreibungen sind gefährlich und bedenklich. Jedenfalls, in dem jetzigen retrospektiven Blick haben wir nicht, oder im Allgemeinen nicht, einen sich durch eine Anschauungsreihe hindurch stetig verschiebenden Blick der Erfassung. Die ins Dunkel herabsinkende oder herabgesunkene Erscheinungsreihe bildet eine starre Strecke, auf die ein Blick sich richten kann und ebenso ein Blick in die kontinuierliche Einheit des Vorganges, die durch sie konstituiert ist. Öfters beobachten wir auch, dass der Blick in einem schnellen Zug durch diese starre Strecke von Anfangs- zu Endpunkt

text nr. 13

5

10

15

20

25

30

35

251

durchgeht, so wie er etwa über eine starre Gerade hinläuft; wobei der Unterschied evident ist, ob wir die Gerade lebendig beschreiben, von Anfangspunkt zu Endpunkt durch erzeugendes Beschreiben, durch das Linieziehen fortschreitend, oder ob wir nach dem Beschreiben auf das Ganze hinsehen und eventuell es sogar durchlaufen. In dem neuen Durchlaufen, in dem der Retrospektion, steht ein starres, wenn auch dunkles „Bild“ des Abflusses da; im originären Erfassen des Vorganges oder Anschauen desselben haben wir das stetige Erzeugen, Beschreiben, vor dem noch nichts Fertiges liegt. Und da ist ein erfassender Blick der Retrospektion auch möglich, der gar nicht durchlaufend ist und das starre Bild wie eine ruhende Erscheinung behandelt (freilich nicht wie eine dauernde Erscheinung eines dinglichen Seins, in dem sich etwa eine Dauer konstituiert, während hier sich in der „Ruhe“ nichts konstituiert). Natürlich kann auch eine Wiedererinnerung an einen Vorgang auftauchen als solch ein „starres Bild“, und es kann sich ein erfassender Blick dem Vorgang zuwenden als ein Momentanerfassen, eventuell an ihm entlang durchlaufen, ohne dass im mindesten eine wiederholende anschauliche Vergegenwärtigung des Vorganges statt hätte, dessen erzeugendem Konstituieren der immanente Strahl der Aufmerksamkeit, der Zuwendung folgte. Ebenso in der „Phantasie“ (in einer uneigentlichen Phantasie), in einer vorblickenden Erwartung eines Vorganges. Wir müssen offenbar sagen: Zum Wesen jedes Vorganges, jeder zeitlichen Gegenständlichkeit überhaupt gehört es, dass ihr ursprüngliches Erscheinen die Form eines phänomenologischen Werdens hat, eines Erscheinungsabflusses im inneren Bewusstsein, worin das Erscheinende als solches sich werdend erzeugt. Es ist nun aber klar, dass es auch zum Wesen eines Sachverhalts überhaupt gehört, dass sein „ursprüngliches Erscheinen“ sich in einem phänomenologischen Verlauf vollziehen muss, in dem das hier Erscheinende als solches, nämlich der vermeinte Sachverhalt, allmählich, schrittweise sich konstituiert und allmählich im erfassenden Blick erfasst wird. Ich sprach vom „u r sp rü n g li c h e n Er s ch e i ne n“. Es gehört zum Wesen des Gegenstandsbewusstseins, dass es in verschiedener Weise phänomenologisch statthaben kann, in sehr verschiedenen Phänomenen bestehend, und dass dabei eine Weise charakterisiert ist als

252

explikative und prädikative synthesen

„ursprüngliche“; wir werden hier bei der Sinnlichkeit sogleich sagen können: als Anschauung, die, wenn sie impressional ist, perzeptive Anschauung ist, und wenn nicht den Charakter der QuasiAnschauung, der Quasi-Perzeption hat. So bei den sinnlichen Ge5 genständlichkeiten. Jeder anderen schlichten Bewusstseinsweise des Gegenstandes entspricht eine mögliche „Anschauung“, ein mögliches originäres Sich-Konstituieren des Gegenständlichen (bzw. quasioriginär), demgegenüber jene Bewusstseinsweise den Charakter des Verworrenen, Un-explizierten, Uneigentlichen, Suggestiven hat, wie 10 immer man es nennen mag.

15

§ 4. Beim Sachverhaltsbewusstsein gibt es keine vorgebenden Erscheinungen. Vergegenwärtigung und Vorschweben als wesensverschiedene Arten von Nicht-Ursprünglichkeit. Verworrenes Urteilen gegenüber Verworrenheit in der Wahrnehmung

Wie ist es im Fall des Sa c h ver h al t ko ns ti t ui e re n de n B e w u ss t se i ns? Auch hier haben wir U n t e rsch ie d e de r U r sp rü ng l i c h ke i t un d N i c ht -U r s p r ün g l i chk eit, de r E i ge nt l i chk ei t, in der das Urteilsvermeinte „expliziert“ gemeint ist, und derjenigen, 20 in der es nur im Überschlag, verworren gemeint ist. Aber freilich, hier sondern sich die Begriffe „a n sc ha ul i ch es“ und e ige nt l i c h e s Erfassen.1 Das e i g e n tl ic he U r t ei l en besteht hier im wirklichen artikulierten Vollzug (der erzeugende) der verschiedenen Meinungsformen, die die Gesamtform des Urteilsver25 meinten wirklich aufbauen, während das anschauliche Urteilen, das Bewusstsein, in dem der Sachverhalt anschaulich klar bewusst ist, Forderungen an die Anschauung der hier unterliegenden „Substrate“ stellt, an die Anschaulichkeit hinsichtlich der Subjekte der Sachverhalte, Objekte etc. stellt. Jedes anschauende Sachverhaltsbewusstsein 30 (anschaulich konstituierend) ist eigentlich, aber nicht jedes eigentliche (nämlich „eigentlich“ urteilende) anschaulich. (Das hängt damit

1 Demnach doppelte Ursprünglichkeit und auch doppelter Sinn von Zuwendung und von Richtung-auf.

text nr. 13

5

10

15

20

25

30

35

253

zusammen, dass das Urteilsbewusstsein fundiert ist und dass zur vollen Anschaulichkeit eben gehört „Eigentlichkeit“ in der Ober- und auch Unterschicht. Und wieder damit hängt zusammen, dass auch die unvollkommene Eigentlichkeit, die der oberen Schicht, ihren Charakter von „Anschauung“ hat, dass hier allerlei einsichtig zu entnehmen ist, zu erschauen ist: nämlich alles rein Logische.) Gehen wir nun weiter dem Ve rg lei ch z wi sch en Sa ch ve r h al t s er sc h ei nu ng u nd s in nl ic he r E rsch ei nu ng nach, so werden wir zu sagen haben: B ei de k on sti tui er en si ch i n ei ne m E r s c he i n un gs ve rl auf. Aber natürlich ist der Sachverhalt (möge er auch auf Zeitliches Beziehung haben) kein Zeitliches, kein Vorgang, nichts selbst im Werden Stehendes, Vorgehendes, und nichts, mit dem etwas vorgeht. Und damit hängt Folgendes zusammen: Alle zeitliche Gegenständlichkeit ist sinnlich, ist in bloßer Rezeptivität erscheinend; seine Erscheinungen sind Passivitäten. Sie laufen passiv ab, und der erfassende Blick ist ein bloßer Strahl des Aufmerkens, der ein Vorgegebenes, vor ihm Konstituiertes erfasst, der das sich Konstituierende begleitet; er rezipiert nur oder akzepiert. Ich setze hier voraus, dass dieser rezipierende Blick anschauender ist. Die Anschauung im eigentlichen Sinn ist wohl nichts anders als das schlichte Erfassen, das schlichte Zugewendetsein einem sich ursprünglich erscheinungsmäßig Konstituierenden. Es ist wohl korrekt, wenn wir noch scheiden zwischen u rs p r üng l i c he r E r sc hei nu n g (wir könnten auch sagen, intuitiver Erscheinung, eigentlicher Erscheinung) und A n s c h a u u ng, deren Neues also besteht in dem Strahl der „Aufmerksamkeit“, der erfassenden Zuwendung zum eigentlich, ursprünglich Erscheinenden. Es ist auch unbehaglich von „Rezipieren“ zu sprechen. Dabei leitet uns die k an tische Rede von Rezeptivität. Aber es handelt sich nicht um ein Wiedererfassen, sondern um ein ursprüngliches Erfassen und eines in seiner Selbstheit Vorgegebenen. Eines Gegebenen, aber dem Erfassen Vorgegebenen. Wir könnten besser von „Akzipieren“ sprechen, und dem steht gegenüber das W i e de r e r fa s s e n oder Wi e d e r- z ur ü ck k om m e n- a uf - Et w a s, das nun nicht mehr gegeben, nicht mehr eigentlich erscheinend ist, sondern in einer „v er w orr e n e n V o r st e l lu ng“ bewusst ist, einer v e r wo rr e ne n M o di fi k a t i on d e r A n s ch a u u ng.

254

5

10

15

20

25

30

35

explikative und prädikative synthesen

Beides fasst sich zusammen als Aufmerken auf ein, sei es „Vorgegebenes“, sei es im Voraus Vorgestelltes oder Vorzustellendes, um ein Zugewendetsein, das einmal ein eigentliches Erfassen, das andere Mal ein uneigentliches Erfassen, also dann ein Zugewendetsein aufgrund eines verworren Vorschwebenden ist. Gehen wir nun zu dem S a ch ve r hal t sb ew us sts e in, zum urteilenden über, so haben wir hier das radikal Neue und Eigenartige, dass wir hier den Sachverhalt (das „Erscheinende“ – ursprünglich = anschaulich!) nicht „gegeben“ haben durch eine Passivität, dass wir ihn nicht „vorgegeben“ haben und haben können, nämlich dem erfassenden Blick gegenüber, sondern dass er nur gegeben sein kann als Meinen, und Meinen notwendig Erfassen ist. Man darf sich hier nicht täuschen lassen durch jene sich ergebenden, auftauchenden Ideen, Meinungen, denen wir uns in einem Blick zuwenden können, und nun denken, da sei ja eine vorgebende Erscheinung des Sachverhalts (der Gemeintheit). Verstehen wir unter einer „Erscheinung“ ein ursprünglich konstituierendes Bewusstsein, ein solches, das im Fall eines hineingesandten Strahls der Zuwendung eine „Anschauung“ oder einen „eigentlich“ gebenden Akt herstellt, dann ist jenes Erlebnis des Vorschwebens keine „Erscheinung“, kein „gebendes“ Erlebnis.1 Es heben sich da also wichtige Unterschiede heraus. Es scheiden sich die e i g e nt l i c h ko ns t it ui er e nd en E r le bn is s e (Gegenständlichkeit konstituierend) und die uneigentlich konstituierenden, eigentlich nicht konstituierenden, die b l o ße n V or sc hw eb un g en. In der sinnlichen Sphäre sind diese retentionale oder im weitesten Sinn vergegenwärtigende (Nachgegenwärtigungen, Wiedervergegenwärtigungen, Vorvergegenwärtigungen), und ihre Korrelate sind Zeitlichkeiten (das Soeben-Gewesen, das wiedervergegenwärtigte Gewesen, das Soeben-Sein-Werden und das wiedervergegenwärtigende, das „bildlich“ repräsentierte Sein-Werden). In der Urteilssphäre finden wir bei den Vorschwebungen wohl analoge Modifikationen; wir finden ja da auch das Soeben-geurteiltHaben, das Urteilen-Werden, die Erinnerung an Urteile, wobei jede Eigentlichkeit ausgeschlossen sein soll. Aber wir finden freilich auch

1

Die Artikulation macht es nicht. Es muss kategoriale Anschauung sein.

text nr. 13

5

10

15

20

25

30

35

255

ein Vorschweben, das nicht Zeitlichkeit in diesem Sinn in sich birgt. Es könnte übrigens hier hingewiesen werden auf das „vergegenwärtigte“ Jetzt in der sinnlichen Sphäre. Aber das klar vorgestellte Jetzt, aber in Erinnerungsweise vorstellige, hat kein Analogon in der Urteilssphäre, insofern als das verworren Vorschwebende, ein Gedanke, der mir (als neuer) einfällt, in Eigentlichkeit nur möglich ist als spontanes, also zuwendendes Urteilen, die Jetztvergegenwärtigung aber nicht mit Zuwendung verbunden sein muss. Dagegen besteht wohl Analogie, insofern als jede dieser und aller wirklichen Vergegenwärtigungen Qualität des „belief“ hat und ebenso die verworrene Vorschwebung einer Urteilsmeinung. Sollen wir nun sagen, dass eine vorschwebende Meinung phänomenologisch den Charakter einer Vergegenwärtigungsmodifikation habe? Urteile, und zwar Urteile als verworren-einheitliche Meinungen, haben oft den Charakter der retentionalen oder erinnernden Vergegenwärtigung. Mögen sie ihn aber auch haben, niemals ist der vermeinte Sachverhalt im eigentlichen Sinn etwas Zeitliches, etwas „Gewesenes“ oder „Künftiges“. Ebenso wie ja auch das originäre (artikulierte) Urteilen den Charakter einer Impression hat (insofern einer Gegenwärtigung), darum aber nicht gegenständlich ein Jetzt im zeitlichen Sinn bewusst hat. Würden wir das verworren vorschwebende Urteil als eine Art Vergegenwärtigungsmodifikation auffassen, so würde es darum also nicht das Korrelat zeitlich erscheinen lassen. Nun möchte man aber einwenden: Wenn ich eine Urteilserinnerung habe, so hat das Urteilen (und das Urteil, sofern es dem Urteilen immanentes ist) den Charakter des Gewesenseins und insofern beliefCharakter. Aber das gilt dem Urteilen nur als Inhalt des inneren Bewusstseins bzw. der inneren Reproduktion. Es kann nun sein, dass ich jetzt noch ebenso urteile, dass ich das Urteil „mitmache“, dass ich dem früheren Urteil zustimme. Es deckt sich dann vollkommen das (von einem Strahl der Zuwendung durchstrahlte) Erinnerungsphänomen, das Phänomen der Urteilsreproduktion, und das jetzige Urteilen. Das braucht nicht zu sein: Ich brauche „jetzt“ gar nicht zu urteilen, kann auch dagegen urteilen, nicht zustimmend, sondern ablehnend. Es ist hierbei einerlei, ob die Reproduktion eine eigentliche, die eigentliche Konstitution reproduzierende ist, oder eine verworrene.

256

5

10

15

20

25

30

35

explikative und prädikative synthesen

Nehmen wir nun eine beliebig auftauchende Meinung: Können wir noch annehmen, dass das eine Vergegenwärtigungsmodifikation sei? Sie ist doch jetzt und wirklich meine Meinung, und nicht vollziehe ich eine Vergegenwärtigung einer Meinung und Zustimmung. Handelt es sich um eine Vergegenwärtigung, so bedürfe es aber, wie im Fall einer Vergegenwärtigung der Erinnerung, so in jedem Fall einer Zustimmung. Man wird sagen können, dass die Versuchung, die verworren auftauchende Meinung für eine Vergegenwärtigung zu halten, aus einer Verwechslung der b ei den w e se nt li c h v e rs ch ie de ne n Art en de r Ni c ht - Urs p r ün g li c h k ei t entsteht, die hier vorkommen können. J e d e V e r g e g e n w ä r t i g u n g h a t e t w a s U n o r i g i n ä r e s, sofern sie eben vergegenwärtigt. Das Erscheinende gibt sich nicht als „Selbst“, als eigenpersönliche „Wirklichkeit“, sondern nur als vergegenwärtigtes Selbst. Andererseits hat j ed e ve r w or re n v or s c hw ebe n d e V e r g e g e nw ä rt i gun g noch dazu e i nen a n de re n C ha r a k t e r d e s „ N i c ht - S e l bst “, eben das Vor s c hw e be n. Das Vorschwebende kann ich mir näher bringen, so dass ich es nun selbst, nun eigentlich und wirklich fasse, es geht aus der Verworrenheit in die Deutlichkeit, eventuell Klarheit über. Im Fall der Vergegenwärtigung: wenn ich sie klar vollziehe. Andererseits, di es e n C h ar ak te r d e s Ni cht - S e lb s t ha t j e d e v e r w o r ren e „ Vor s c hw e bun g “, auch die vorschwebende Meinung, die ich mir „näher bringe“ in der Form des eigentlichen, artikuliert vollzogenen Urteils (bzw. des Quasi-Urteils der Phantasie etc.). Freilich, eine Schwierigkeit liegt noch vor. Sollen wir dann sagen, die Urteilserscheinungen (die Erscheinungen der höheren, synthetischen Stufe überhaupt) besitzen eine verworrene Modifikation, die bei den sinnlichen Erscheinungen fehlt, oder sollen wir so parallelisieren: D as v e rw o r r e n e Ur t e i l e n i s t U r te i l e n und ke i n e „ V e r ge ge n w ä rt i g u ng “, keine Reproduktion, also als Impression anzusprechen und demnach mit den Wahrnehmungen gleichzustellen? Nun sei aber auch zu scheiden zwischen Verworrenem und Eigentlichem, Ursprünglichem in der Wahrnehmungssphäre selbst, nämlich bei den apprehendierenden Wahrnehmungen. Je d e a pp r e he n di e r en d e W a h rn e h m ung s e i v e r w or r e n und wird zur fortschreitenden Eigentlichkeit, zur Stufe der „Ursprünglichkeit“ gebracht im Durchlaufen der Erscheinungen der Wahrnehmungsman-

text nr. 13

257

nigfaltigkeit, in denen sich die Einheit des Gegenstandes nach seiner Inhaltlichkeit zu eigentlicher Gegebenheit bringe. Freilich sei das ein grenzenloser Prozess, weil jede neue Wahrnehmung neue Uneigentlichkeiten hereinbringe und der Gegenstand ein Unendliches sei. 5 Aber freilich haben wir da einen kardinalen Unterschied zwischen der Verworrenheit der sinnlichen, apprehendierenden Impressionen und der Urteilsimpressionen, dass in die sinnliche Verworrenheit immerfort und mit Notwendigkeit auch Klarheit und Eigentlichkeit eingeht und umgekehrt in die Klarheit auch Verworrenheit, während 10 das beim Urteil nicht der Fall ist. Im Übrigen ist es wiederholt zu überlegen, ob das Mit-Apprehendieren (der Rückseite und dgl.) und das verworrene Meinen wesentlich gleichartig sind. Natürlich darf man das Mit-Apprehendieren nicht verwechseln mit dem Auftauchen dunkler Erscheinungen aus 15 der Erscheinungsmannigfaltigkeit.

§ 5. Sinnliche gegenüber kategorialer Erfassung. Der auf das verworren Gemeinte gerichtete Blick der Zuwendung gegenüber dem im eigentlichen Urteilen lebenden Blick. Das verworrene Denken gehört in die Sphäre der Passivität

20

Nach all diesen Untersuchungen können wir zur Frage des Substrats sagen: 1) Jede Zuwendung, Erfassung (jedes Aufmerken-auf) hat ein Zuwendungssubstrat, eine „Erscheinung“, in der das „erscheint“, 25 dem sich die Zuwendung zuwendet.1 In der Zuwendung wird im weitesten Sinn etwas erfasst, aber die Erfassung ist eine ursprüngliche, „eigentliche“ oder uneigentliche, je nachdem es die „Erscheinung“ ist. 2) Beschränken wir uns auf eigentliche, ursprüngliche Erfassung 30 (sei es auch unvollkommene), so kann sie entweder eine unmittelbare, eine schlichte sein oder eine mittelbare, synthetisch fundierte. Erfassen heißt hier überall nicht so viel wie „einstrahlig gerichtet sein auf etwas als gegenständlicher Zielpunkt“, und hat nicht den engeren Sinn von perzeptiv Erfassen. Im Denken ist etwas denkend erfasst, im Urteilen ist der Sachverhalt erfasst. 1

258

5

10

15

20

25

30

explikative und prädikative synthesen

Eine sinnliche Erfassung, Erfassung von einem Sinnlichen, setzt eine sinnliche Erscheinung voraus, und hier ist die Erfassung eine akzipierende, ein Annehmen und Aufnehmen eines Vorgegebenen, das auch ohne Erfassen gegeben sein könnte, eben in eigentlicher (oder in relativ eigentlicher) Erscheinung erschiene. Eine kategoriale Erfassung, eine Erfassung eines Gemeinten, setzt ein Meinen voraus, und das Meinen baut sich auf klarem oder dunklem Erscheinen auf (und sinnlich akzipiere). Das Meinen kann aber ursprünglich eigentliches sein, auch wenn es unklar ist,1 und vor allem wenn es uneinsichtig ist: Es tritt hier der Unterschied der Einsichtigkeit auf, das Meinen kann in verschiedener Weise auf Erscheinung beruhen. Davon sehen wir ab. Was wir jetzt aber betonen müssen, ist, dass Erfassung eines Gemeinten, wenn es ursprünglich eigentlich sein soll, in gewissen Schritten vonstatten geht, die immerfort Schritte der Zuwendung sind, und dass sich in diesen Schritten die „Erscheinung“, das ist hier die Meinung des Sachverhalts, aufbaut und dabei der so und so gemeinte Sachverhalt schrittweise ins Urteilsbewusstsein tritt, sich in ihm als gemeinter konstituiert. Dieses ursprüngliche Meinen ist nur denkbar als Zuwendung, als ein „Erfassen“. Verstehen wir unter „Substrat“ die „Erscheinung“, durch die der Strahl der Aufmerksamkeit, der zuwendenden Erfassung geht,2 so haben wir wie überall, so bei den Urteilen zwischen dem aufmerkenden, erfassenden Strahl zu unterscheiden und der Meinung, also dem „Substrat“, als „Erscheinung“-von. Der „Strahl“ ist hier nicht ein Strahl, sondern eine Reihe zusammenhängender Erfassungen, die doch zu einer Erfassung sich zusammenschließen, und diese Erfassung ist doch nicht anders charakterisiert als jede Erfassung, also ja nicht zu verwechseln mit Urteilsqualität. Ob wir wirklich Urteilen oder in der Phantasie uns urteilend bewegen oder bloß „sehen“, immer ist Zuwendung Zuwendung.3

1 Eigentliches Meinen als artikuliertes. Eigentliches Meinen als gebendes (intuitiv). Das gibt eine doppelte Ursprünglichkeit. 2 Warum aber die Charakterisierung dieser Erscheinung mit dazunehmen zum Substrat? Durch sie geht doch die Zuwendung nicht hindurch. 3 Vgl. aber „ξ“, 23.9.1911 = S. 218,7 ff.. – Hier fehlt aber die Unterscheidung zwischen dem Strahl der Richtung-auf und der Einheit der Zuwendung. Der ganze

text nr. 13

5

10

15

20

25

259

Das Substrat in diesem Sinn ist also nicht zu verwechseln mit der Materie,1 nämlich im Substrat2 unterscheiden wir Qualität und Materie,3 und die Qualität ist ein Moment des Substrats. Die Qualität drückt einen Modus aus, wie das Substrat bewusst ist (abgesehen von den Strahlen der Zuwendung). Ein Urteil hat kein vorgegebenes Gesamtsubstrat seiner Zuwendung. Aber jedes, wirklich und eigentlich vollzogene Urteil setzt doch Vorgegebenheiten voraus, jedes setzt unterliegende Erscheinungen voraus. Man kann auch die Erscheinungsunterlage, die für das Urteil Vorgegebenheit ist, als Substrat bezeichnen. Dann ist aber zu sagen, dass das für das Urteil Vorgegebene selbst wieder in Urteilen und überhaupt in synthetischen Akten bestehen kann und nicht etwa in sinnlichen Erscheinungen bestehen muss. Von da haben wir also auszugehen. 3) Wende ich mich einem im Bewusstseinshintergrund auftauchenden, verworren vorschwebenden doxischen Inhalt, Urteilsinhalt zu, so ist er mir nicht gegeben. Er ist auch nicht deutlich und eigentlich bewusst, aber in mehr oder minder unbestimmter verworrener Weise. Mit Evidenz kann ich aussagen: Mir schwebt ein Sachverhalt vor, und eventuell, es ist ein geometrischer, bezieht sich auf Kreis usw. Also jedenfalls etwas kann ich schon aussagen, und wenn ich das Urteil dann eigentlich vollziehe, kann ich sagen mit Evidenz: In diesem prädikativen Urteil spricht sich aus, was vorhin verworren mir vorschwebte, wobei freilich die Evidenz nicht soweit geht, dass ich sagen könnte, es sei sicher, dass der Sachverhalt gerade als so geformter bewusst war. Vorher ist aber zu sagen: Während eigentliches Urteilen nur ein Urteilen in Zuwendung sein kann, kann verworrenes Meinen ohne

Sachverhalt ist nichts, worauf wir gerichtet sind im Urteilen, dem wir aber zugewendet sind. Gerichtet darauf sind wir erst in einem reflektierenden Akt. 1 Substrat unterschieden von Materie. 2 Im Substrat? – Aber ist es nicht richtiger zu sagen, dass der Strahl der Zuwendung nicht durch die Qualifizierung der „Erscheinung“ hindurchgeht? 3 Zu bemerken wäre für das Verständnis des Textes: Artikuliert ist nicht eigentlich. Wenn ich lese und artikuliert verstehe, so ist das nicht ein eigentliches Urteilen; ein solches liegt vor, wo ich wirklich zum Subjekt setze und mache etc.; also eine, wenn auch völlig verworrene Vorstellung muss zu Grunde liegen. In diesem Sinn ist es richtig, dass jedes wirkliche Vollziehen und „eigentliche“ Urteil Vorgegebenheiten voraussetzt.

260

5

10

15

20

25

30

35

explikative und prädikative synthesen

Zuwendung sein, und die Zuwendung zum Sachverhalt, die sich vollzieht, wenn der Blick der Zuwendung auf das verworren Gemeinte sich richtet, unterscheidet sich wesentlich von dem Blick, der im eigentlichen Urteilen lebt. Der letztere ist ein System von mehrfältigen Zuwendungen, die doch Einheit der Zuwendung zum Sachverhalt sind, das Erstere aber ein einziger und unzerteilter Strahl der Zuwendung. Die S ynt he si s de r U r t ei l s m e in un g, der artikuliert oder vielmehr wirklich und eigentlich vollzogenen Urteilmeinung, ist S y nt he s i s i n d e r M a t e r i e, S y n t h e s i s i n d e r Q u a l i t ä t (sofern das Ganze des “Sachverhalts“ eine Qualität hat gegenüber den eventuellen Qualitäten der Glieder), endlich auch Synthesis in der Zuwendung als Einheit in einer mehrfältigen Zuwendung. Darin stehen verworrene Meinungen also sinnlichen Erscheinungen gleich, dass in ihnen die spontane Synthesis fehlt, die notwendig Zuwendung ist.1 Die Zuwendung ist zwar auch als Funktion der Spontaneität anzusehen; insofern ist Rezeption (Akzeption) auch Spontaneität, aber wir stellen sie der eigentlichen und höheren, schöpferischen Spontaneität gegenüber, sofern nicht bloß Zuwendung, sondern Aktion in der Denkgestaltung im Licht immer neuer Zuwendung statthat. Das auftauchende Meinen, das verworrene Denken rechnen wir in die Sphäre der Passivität, eben weil das, was bewusst ist, nicht in der Zuwendung und der Aktion innerhalb der Zuwendung bewusst ist. Hier ist nichts von Spontaneität. Es ist bestenfalls Ergebnis, totes Residuum von Spontaneität, aber nicht lebendige und wirkliche. Stellen wir also Passivität und Aktivität gegenüber, so steht bisher natürlich unter dem Titel Passivität: 1) die Sinnlichkeit, die klare und dunkle; 2) das verworrene Denken im Sinn der vorschwebenden Meinungen. Freilich könnte man (historischen Motiven darin auch folgend) den Begriff der Aktivität und Passivität (Rezeptivität) noch anders orientieren, nämlich sagen, in der Sphäre des inneren Bewusstseins sei

1

Meinung immer auf Denken, Urteilen bezogen.

text nr. 13

261

nur die sinnliche Empfindung als pure „Vorgegebenheit“ anzusehen, die Gestaltung, die Formung, die schon zu den Apprehensionen gehört, mit denen sich Natur konstituiere, sei schon eine „seelische Aktivität“, eine Leistung eben der Formung, und ebenso die höheren 5 Bildungen, die Denkgestaltungen, auch diejenigen der verworrenen Meinung.

§ 6. Affektion und Funktion. Die Spontaneität der Ich-Akte als freie Akte gegenüber den eigentlichen Willensakten 10

15

20

25

30

35

Wir gehen dann dem l et z te n „ M at e rial “, Stoff nach und sagen bildlich, e s s e i d ur ch A f f ek t io n da, in den Bewusstseinszusammenhang, in den der „Seele“ gekommen, und stellen den Affektionen die Funktionen gegenüber, das sind die aufgrund der Affekte sozusagen durch die Funktionen zur Konstitution kommenden Gegenständlichkeiten. Wir nennen dann F un k t io ne n (wenn wir darin nicht in naturwissenschaftlicher Einstellung ein kausales Leisten sehen, sondern das, was im Bewusstsein selbst deskriptiv vorliegt) all diejenigen phänomenologischen Momente, welche aus dem Ursprünglichsten des Bewusstseins „Erscheinung“-von herstellen, also dasjenige, woraus das Aufmerken, das Hinwenden eine Gegenständlichkeit entnehmen kann. Funktionen sind dann: 1) A p pre h e ns iv e F unk ti on en (Funktionen niederer Stufe) und 2) D e nk fu nkt i o ne n, (doxische) Funktionen höherer Stufe. Empfindungsinhalte sind die Untergrenze der Funktion: was im inneren Bewusstsein ist, aber nicht Funktion ist, sondern fungiert. Gehen wir hinter das innere Bewusstsein zurück, so löst sich alles wieder auf in die Funktionen des Zeitbewusstseins, die aber für die Konstitution von Empfindungseinheiten (sinnliche Inhalte) dieselben sind wie für das, was im inneren Bewusstsein Funktion heißt. Es ist also in der Tat ein (im inneren Bewusstsein verlaufender) fundamentaler Unterschied der zwischen Affektion und Funktion, zwischen letzter Materie der Erkenntnis, letztem S t of f und der F u nkt i o n, durch die für eine mögliche Erkenntnis „Erscheinung von“, Bewusstsein von einem Gegenständlichen zustande kommt.

262

5

10

15

20

25

30

35

explikative und prädikative synthesen

Die Gegenstandskonstitution bzw. das Erwachsen von Gegenstandserscheinung, Gegenstands-„Vorstellung“-von (objektivierendes Phänomen) stellen wir uns bildlich als ein Erzeugen vor. Aber wenn wir Pas si vi tä t un d A kt ivit ät gegenüberstellen, können wir offenbar nicht diesen Gegensatz im Auge haben, da die neuen Worte auf phänomenologische Charaktere eigener Art hinweisen. Das Denken ist nicht immer, nicht als Auftauchen einer verworrenen Meinung, sondern nur als artikuliertes Prädizieren, ein freies, spontanes Gestalten. Wenn ich intensiv nachdenke, wenn ich es auf die Lösung eines Problems abgesehen habe, dann gehen diese Denkintentionen immer wieder so zur Befriedigung über, dass zunächst Gedanken zum Auftauchen gebracht werden, denen sich das Denken zuwendet, die es näher bringt und in artikulierte Prädikationen verwandelt, die dann etwa im Fortgang der Denkintentionen durch Anschauung, durch Wesensintuition, durch Erfahrung zur Begründung gebracht werden. Haben wir da nicht überall ein „freies“, „spontanes“ Tun? Nun ja, es handelt sich dann um Willensvorgänge, und das Wollen, der Übergang von Willensintention zur realisierenden Handlung ist durchaus Spontaneität, durchaus Tat der Freiheit. Indessen müssen wir scheiden: das Denken selbst und die Willensintention auf Denken und das Denken im Charakter der realisierenden Handlung, in der sich diese Willensintentionen in ihrer Weise auswirken. Und wir müssen dabei wohl noch weiter scheiden: das Wandern des erfassenden Blickes im Feld der Erscheinungen, die Vorgegebenheiten konstituieren, und das mit dem Wandern Hand in Hand gehende Ablaufen der Erscheinungen, die das Feld der Vorgegebenheiten verändern, erweitern und dem freien Zuwenden neue Möglichkeiten geben, oder das freie Durchwandern der schon festgelegten, schon erworbenen (in Vorschwebungen verwandelten) Meinungen und dieses Haben dieser Meinungen; ferner müssen wir das Auftauchen von neuen, vorschwebenden Meinungen, deren sich der zuwendende Blick bemächtigt, scheiden von diesem Bemächtigen, diesem Zuwenden selbst. Das eine kommt dem willentlichen Absehen „entgegen“, das freie Wollen bemächtigt sich seiner, „kann“ es; das andere ist das freie Wollen, die freie Zuwendung und die freie Gestaltung selbst. Es ist dabei auch zu sagen, dass die Verläufe der motivierenden Empfindungen (Augenbewegungen, Empfindung der Handbewegungen und dgl.) den Charakter freier Verläufe haben.

text nr. 13

5

10

15

20

25

30

263

Kann man nun sagen, dass d a s De nk en s el bs t n eb en d em Wol le n ei ne S po n tan eit ät, ei n ac tu s d er Fr ei he it ist (so dass actus ein weiterer Begriff wäre, der Denken und Wollen befasste)? Man muss hier wohl sagen: Versteht man unter Wollen SichEntschließen und allenfalls a us fü hre nd es Wo ll en, eben das im Ausführen lebende Wollen, und wieder das einfache Wollen eines sich unmittelbar realisierenden fiat – ich will ergreifen und ergreife schon –, so haben wir es bei dem Umblicken, dem Hinwenden des aufmerkenden (aber auch physischen Blickes), dem Wandern der Aufmerksamkeit, dem denkend Gestalten und Sachverhalt-Erfassen (dem beziehenden Denken) nicht mit einem Wollen zu tun. Nun können wir schon i m A u sf ühr en ei nes W i lle nsv or s a tze s, in der Handlung, unterscheiden den Charakter der Er fü ll un g d es V or s a t z e s, der stetigen, schrittweisen, und den Charakter der Freiheit, des freien Ablaufs der Handlung, den Charakter freier Tat. Nun, w o a u c h g a r kei n Vor sat z u n d fi a t v o rhe r g eht, finden wir „Handlungen“, freie Taten, d i e al so ni ch ts v on V or sa t zer f ül l ung e n t h a l t e n, aber eben diese „Freitätigkeit“, den C h ar ak t e r d e r Sp o nt a n e i tä t. Jede Zuwendung und jeder Wechsel von Zuwendungen, jede Festhaltung, jeder artikulierte Denkvorgang hat diesen Charakter, jede Explikation, jede Prädikation usw. Aber natürlich auch das Sich-Entschließen, das realisierende Wollen, ferner jedes Gefallen, Sich-Freuen, jedes Missfallen, jedes Wünschen, Sichbegehrend-Zuwenden, Sich-im-Widerwillen-Abwenden. Nennt man all das freie Betätigungen und versteht man unter Wille diese Spontaneität, dann haben wir eine weite Sphäre, die Sphäre der I c h- Akt e i m s p e zi f is ch e n S i n n, einheitlich scharf zusammengefasst, aber nun doch den Willen extrem extendiert. Zwar können wir in gewisser Weise sagen, dass jeder spontane Akt auf ein „Ziel“ gerichtet ist, die schlichte Zuwendung „richtet sich“ auf den erscheinenden Gegenstand.1 Die spontane Meinung richtet sich auf den Sachverhalt und kulminiert als Meinung in der Konstitution des vermeinten Sachverhalts, die Zuwendung im Wünschen, im Vollzug einer artikulierten Wunschmeinung und diese selbst richtet

1 Man kann da sagen, der freie Übergang sei gerichtet von der nicht-erfassenden Erscheinung zur erfassenden.

264

5

10

15

20

25

30

35

explikative und prädikative synthesen

sich auf den sich konstituierenden Wunschverhalt; aber das ist das allgemeine Sich-Richten-auf, das Allgemeine einer frei sich auslebenden Spontaneität. Aber nur der Wille im spezifischen Sinn hat sein Willensziel, und nur eine Spontaneität, die einen Willensentschluss oder Willensimpuls realisiert, ist eine Handlung im echten volitiven Sinn. Willenshandlung geht auf Realisierung und ihr Ende ist die Tat (das Getane). Soll man etwa sagen, eine Zuwendung sei eine unmittelbare Handlung und die Tat ist das Haben des Gegenstandes im Fassen? Soll man sagen, dass jedes Denken, z. B. das Beobachten, dass unten ein fremder Mann geht, dass sich eine schöne Herbstfärbung im wilden Wein zeigt usw., eine Tat ist, dass darin ein Willensimpuls sich auslebt? Das geht nicht, und erst recht nicht bei der wünschenden Zuwendung, gefallenden Zuwendung etc. Allerdings macht an sich die unmittelbare Handlung, etwa bei einem Ergreifen der Zigarre (ohne vorgängigen Entschluss), Schwierigkeit. Aber hier ist ein Willensimpuls unverkennbar gerichtet auf das Handerfassen der Zigarre, In-den-Mund-Stecken etc., auf eine Realisierung. Wir haben hier erst die Vorstellung des Ziels und dann den Willensimpuls. Bei einer freien Zuwendung fehlt das aber. Übrigens ist es klar, dass sich durch die nicht-willentlichen freien Akte (darunter die freien Bewegungen) die Schwierigkeit versteht, wie ein Willensziel als solches vorstellig sein soll, da es doch voraussetzt, dass es Ende, Telos ist. Es ist vorgestellt als Ende einer Spontaneität, einer spontanen Erscheinungsreihe, und es gehört a priori zum Wesen der Handlung, dass sie ein fiat eines unvermittelten Realisierungswillens ist, das durch solch eine spontane Reihe stetig hindurchgeht, sich dabei stetig willentlich erfüllt, das ist, realisiert. Und umgekehrt, zum Wesen jedes fiat (das eine Handlung einleitet) gehört es, dass es als Ansatz und Eingangspunkt einer Kontinuität freier Spontaneität steht und ohne eine solche unmöglich ist. Man sagt, wollen kann man nur, was „ausführbar“ ist bzw. was vor dem Bewusstsein als ausführbar steht. Man kann besser sagen, wollen kann man nur im Feld der Spontaneität und da auch prinzipiell überall. Man darf das nicht missverstehen. Ich kann natürlich nicht mein Denken in der Art willkürlich gestalten, dass ich aus Ja Nein mache, aus Vermutung Gewissheit usw., oder dass ich wünschen kann, was ich in Wahrheit jetzt nicht wünsche etc. Es hieß „im Feld der

text nr. 13

265

Spontaneität“. Sofern eine Reihe von freien Zuwendungen von A zu B zu C geht, kann ich willkürlich wiederholt von A zu C und von C zu A übergehen etc., oder ich bin frei, wenn ich dieses Papier sehe und an ihm das Weiß, das Papier oder Weiß zum Subjekt zu machen, im 5 beziehenden Übergehen so oder so zu durchlaufen. Habe ich einmal das Urteil in bestimmter Weise synthetisch erzeugt, dann kann ich willkürlich es noch einmal herstellen, es nun willkürlich neu erzeugen usw. Das dürfte man doch richtig sehen. I ch u n t er sc h ei de al so S p o nt an ei tät ( Re ic h d er Fr e i he it ) 10 u n d W i ll e. Statt von S p on t ane i t ät sprechen wir von A kt im pr ä g n a nt en Si n n (spontaner Akt, wofern man unter Akt in einem weiteren Sinn jedwedes Erscheinen, jedwedes konstituierende Bewusstsein versteht), und unter den Aktarten ist einer der Wille. (Es wird dabei aber gut sein, zwischen Akt und Aufmerksamkeit insofern 15 zu unterscheiden, als wir bloße Aufmerksamkeit, die in eine Passivität hineinblickt, lieber nicht Akt, sondern Erfassung nennen; also Wahrnehmungen, ebenso Zuwendungen zu verworrenen Meinungen sind keine Akte.)

20

§ 7. Akzeptionen gegenüber spontanen Akten als Vernunftakten im prägnanten Sinn. Akt und Zustand – Aktivität und Passivität – Sinnlichkeit und Verstand (Vernunft). Die Konstitution der Vernunftgegenstände in spontanen Vernunftakten

Gehen wir weiter. Jedem spontanen Denken (jeder Denkspon25 taneität) entspricht eine Denkzuständlichkeit: eine Zuständlichkeit, das ist ein passives Erlebnis. Jede sinnliche Erscheinung ist eine Zuständlichkeit des Bewusstseins, und Spontaneität kann nur in sie hineinkommen durch Zuwendung und dann durch darauf sich gründende Akte, aber dem 30 artikulierten, dem spontanen Denken entspricht eine Serie von Zuständlichkeiten, die selbst Gedanken sind, sofern sie ebenso gut Meinung des Sachverhalts sind, als es das spontane Urteilen ist. Jedes spontane Denken geht eo ipso, nachdem es vorüber ist, falls nicht ein Festhalten sich anschließt, in bloße Zuständlichkeit über, und 35 jedes vorschwebende Denken ist eine Zuständlichkeit. Diese, wie

266

5

10

15

20

25

30

35

explikative und prädikative synthesen

jede Zuständlichkeit hat das Eigentümliche, dass es zum Substrat eines Strahls der schlichten Aufmerksamkeit werden kann, also das G em ei nsa me der sinnlichen Erscheinungen und aller sonstigen Z u st änd e ist dies, dass sie entweder bloße Passivitäten sind oder Passivitäten, die einen Strahl der aufmerkenden Aktivität in sich aufgenommen haben. Dabei kann man sagen: Es bleibt das Substrat Zuständlichkeit und es bleibt von dieser Zuständlichkeit zu unterscheiden der Strahl der Aktivität. Ich habe schon gesagt, dass Akte im ganz prägnanten Sinn nur Spontaneitäten heißen können, und zwar bilden da unter diesem Titel diejenige Spontaneitäten eine geschlossene Einheit, die nicht bloß einfältige, schlichte Zuwendungen sind zu dem in Form einer Zuständlichkeit konstituierten Gegenständlichen. Wir können alle schlichten Zuwendungen in eins fassen, und das würde einen prägnanten Begriff von Vorstellung bilden, nämlich wenn wir das zuwendende schlichte Erfassen mit der Zuständlichkeit, die sein Substrat bildet, als ein Ganzes nehmen, zusammennehmen. Freilich ist es fraglich, ob diese Terminologie bei der verwirrenden Vielfältigkeit der sonstigen Bedeutungen des Wortes Vorstellung empfehlenswert wäre, und insbesonders mit Rücksicht auf bestimmte Bedeutungen, die viel größere Vordringlichkeit haben. Versuchen wir zu sagen „Akzeptionen“ (da Perzeption aus denselben Gründen bedenklich ist) oder nicht lieber „Rezeptionen“, um an Rezeptivität anklingen zu lassen. Aber freilich die Silbe „Re-“ ist bedenklich. Versuchen wir es also so, dann wäre das Akzipieren nichts anderes als das Sich-schlicht-Zuwenden, und die Akzeption in eins genommen schlichte Zuwendung und Zuwendungssubstrat, welches eine Zuständlichkeit ist. Das Akzipieren ist identisch mit dem schlichten Bemerken, auch Aufmerken, wofern wir unter Aufmerken und Bemerken eben nichts anderes verstehen als Zuwendung überhaupt. Aufmerksamkeit liegt auch vor im Urteilen und sonstigen Spontaneitäten; wir sind dem sich schrittweise konstituierenden Sachverhalt zugewendet, sind auf ihn aufmerksam. (Freilich besagt Aufmerksamkeit auch oft sehr viel mehr: thematisches Interesse.) Den Akzeptionen stehen dann gegenüber die spontanen Akte, die Vernunftakte im prägnanten Sinn. Alle Vernunftakte sind fundiert in Akzeptionen (und in diesem Sinn hat jeder Akt eine „Vorstellung“

text nr. 13

5

10

15

20

25

30

35

267

zur Grundlage). Schlichte Zuwendungen sind die Unterlage der artikulierten spontanen Zuwendungen und meinenden Erfassungen, die wir Urteile etc. nennen. Die unterliegenden Akzeptionen haben objektivierende Zuständlichkeiten als Substrate, und insofern muss man also auch sagen, jed er Vern u n ft akt , j ede S pon ta n ei t ät d er Vern un f t , ha t ob j e k t ivi er en de Zu st ä ndl i ch ke i ten al s G r un d la ge, und zwar so, dass die in diesen Zuständlichkeiten konstituierten, „vorstelligen“ Gegenstände Zuwendung erfahren und ihrerseits mit eintreten in die Gegenstände höherer Ordnung, die Vernunftakte. Akt und Zustand scheidet sich dem Allgemeinsten nach als Spontaneität (Aktivität) und Passivität. Jeder Aktivität entspricht Passivität insofern, als Aktivität in Passivität sich wesensgesetzlich verwandelt. Nun ist Z u s t ä n dli c h ke it en tw ed er „ i nt e nt io nal “ ( Ge gen s t a nd ko ns t i t u i e re n d) o de r ni ch t (Letzteres betrifft die Empfindungsinhalte). Was die in te nt io nal e Z us tä nd li ch k ei t anlangt, so ist sie von d opp e l t e r A r t. Entweder sie ist ur s p rün gl i ch e P a s s i v i t ä t, das heißt, sie ist keine Abwandlung einer Aktivität, die ursprünglich dieselbe Gegenständlichkeit konstituiert, auf die sich die Zuständlichkeit bezieht, od e r s i e i s t ei ne s ol ch e Ab w a nd lu ng. Wir scheiden Ve r s t a n d und S i n n l i c h ke it. Die Scheidung vollziehen wir aber nicht einfach nach dem Schema von Aktivität und Passivität, noch abgesehen davon, dass bloß schlichte Zuwendung auch Aktivität ist und wir die spontanen Akte im weiteren Sinn der Zuwendungen überhaupt in sinnliche und Verstandesakte einteilen. Die Sphäre der S i nn l i c h k e i t bestimmen wir durch Empfindung und Apprehension (empirische Wahrnehmung und all ihre Verwandten). Die Objektivationen (Gegenstandskonstitutionen), die hier hereinfallen, sind u r s p r ü n g l i c h e P a s s i v i tä t e n, das heißt, ur sp r ün gl i ch g e g e b e n können die hierher gehörigen Gegenstände, die sinnlichen, nur sein in P a s s i v i t ät e n. Was aber die Ve r s t and e s s p hä r e ( Ve r n un ft sp h ä r e ) anlangt, so teilen wir sie ein in V er n u nf t a kt e und V e rn u n ft zus t ä nd e. Ferner, die Vernunftakte in u r s p rü n g li c h e V e rn u nf ta kt e (oder Vernunftakte schlechthin) und bl o ß e Z u we n du n g e n zu d e n i n Ve r nu nf t zu s tä nde n b e w us s t en Ge g e n st ä n dl i c h ke i t e n. Jeder Vernunftzustand hat das Wesentliche, dass er nicht nur Substrat einer Zuwendung werden

268

5

10

15

20

25

30

explikative und prädikative synthesen

kann, sondern auch übergeführt werden kann in einen e i g e n t l i c h en V ern u nf t ak t, in dem dieselbe Gegenständlichkeit, die in der bloß schlichten Zuwendung gemeint ist, in der Zuwendung des Vernunftaktes zu eigentlichem Vernunftbewusstsein, und dann eventuell zur Gegebenheit kommt. Wir können auch sagen: In der P as si vi tät konstituieren sich ur spr ü n gli c he G ege nst än d li ch ke it en, sie erscheinen, sie werden wahrgenommen usw., und die Gegenständlichkeiten, die Korrelate dieser ursprünglichen Passivität sind, können nur in Passivitäten, nur in „sinnlichen Erscheinungen“ ursprünglich bewusst sein. Es konstituieren sich aber auch in der Sphäre der Aktivität Gegenstände; sie erscheinen darin, und eventuell kommen sie darin zur Gegebenheit. D i ese G egen st än de kö n ne n n ur i n Ve r nu n ft a kt en z u r G e g e b e n h e i t k o m m e n, nur in ihnen ursprünglich erscheinen. Das spezifisch Vernunftmäßige in diesen Akten, das, was sie zu Vernunftspontaneitäten macht, ist hierbei konstitutiv für Gegenständlichkeiten, die V e r nu n f t gege ns t ä ndl ic hk ei te n. Ve r n u n ft g e g e ns tä n de k ön ne n ab er a uc h in Z u s tä ndl i c hke i t e n b e w us s t s e in („erscheinen“), und zwar darum, weil jedem Vernunftakt eine Vernunftzuständlichkeit entspricht, die dieselbe Gegenständlichkeit in passiver Weise bewusst hat, die der Vernunftakt in spontaner Weise konstituiert. Damit hängt zusammen, dass jeder, auch jeder Vernunftgegenstand Objekt einer schlichten Zuwendung werden kann (nämlich durch die Zuständlichkeit). Bl oß e Z uw e n d un g i s t a u c h S po n t an e i t ät , a ber k ei ne G ege n st a n d k o nst i t u i e r e n d e, s o nd e r n n u r G eg e n s t and e rf a ss en d e S po n t a ne i t ä t.

§ 8. Objektivation im Sinn der Zuwendung, des Zuwendungssubstrats und der Subjektion. Nur intentionale (gegenstandskonstituierende) Erlebnisse als Objektivationen im prägnanten Sinn können Substrate von Zuwendungen sein

Sind die bisherigen Ausführungen richtig, so müssen wir sagen: Zuwendung als solche (Aufmerksamkeit im weitesten Sinn, Erfas35 sung) ist etwas, das mit dem urteilenden Meinen keine besondere

text nr. 13

5

10

15

20

25

30

35

269

Affinität hat; es findet sich ebenso beim Wünschen, Wollen usw. In gewissem Sinn ist es ein Objektivieren als Zum-Objekt-Machen; die Zuwendung ist Zuwendung zu etwas und dieses Etwas konstituiert sich als Gegenständliches im Substrat der Zuwendung. Objektivation kann also heißen: 1) Das Zum-Gegenstand-Machen in dem Sinn des Einem-Gegenständlichen-Zugewendetseins; also einfache Zuwendung, Aufmerksamkeit in einem weitesten Sinn. 2) Das, was Zuwendung ermöglicht, das, was jede Zuwendung überhaupt fordert, nämlich das Zuwendungssubstrat, das entweder so, wie es ist, nur als Zuwendungssubstrat sein kann oder sein kann ohne Zuwendung, in dem Sinn wie eine sinnliche Erscheinung schon Erlebnis ist, und dann erst wendet sich die Aufmerksamkeit dem Erscheinenden zu, macht die Erscheinung zu ihrem Substrat. 3) Objektivation als Zum-Objekt-Machen oder als Objekt-Bewusst-Haben kann auch heißen Subjektion (wenn man will Subjektifikation), das ist das Zum-Subjekt-im-Sinn-eines-UrteilssubjektsMachen, Zum-Gegenstand-worüber-einer-Bestimmung-Machen. Wo immer eine Objektivation sub 2) vorliegt, die noch nicht Subjektion ist, kann sie in Subjektion verwandelt werden, und es ist dann evident, dass das in der Objektivation bewusste und das in der Subjektion in der Form des Subjekts bewusste Objekt dasselbe ist. In der Subjektion nimmt das Substrat, wenn es noch nicht Zuwendungssubstrat ist, zunächst den Strahl der Zuwendung an, ferner die Form des „dies, worüber“, des als Subjekt Gesetzten; wobei die Objektivation selbst ihrem Wesen nach sich nicht ändert, sondern nur eine neue Form, die der Subjektsetzung oder Untersetzung, annimmt. Verstehen wir Objektivation nach 2), so ist jedes Erlebnis, könnte man sagen, objektivierend, jedes kann als Substrat einer Zuwendung und somit auch einer Subjektion fungieren.1 Indessen, ist das richtig? Etwa in dem Sinn, dass jedes Erlebnis Gegenstand einer Zuwendung sein kann? Nein, Substrat ist nicht Gegenstand. Allerdings, der ausgesprochene Satz kommt gleichwohl in Betracht: Nämlich j e d e s E r leb n i s d e s i nn e r e n Be w u s s ts e i ns i s t i nn e r l i ch be w us s te s, und das ist hier Erlebnis. Innerlich Bewusstes sagt aber, jedes Erlebnis konstituiert sich durch eine „Erscheinung“ des inneren Bewusstseins, durch eine innere Wahrnehmung; und diese ist es, durch die der 1

Gegenstandkonstituierend, das ist nichts anderes als „intentionales Erlebnis“.

270

5

10

15

20

25

30

explikative und prädikative synthesen

Strahl der Zuwendung hindurchgeht: Zuwendung ist nichts, was auf etwas gehen kann, ohne dass dieses Was sich „konstituiere“. Also „Jedes innere Bewusstsein von einem Erlebnis kann Substrat einer Zuwendung sein“, so muss der Satz lauten, der sonach auch sagt, dass jedes Erlebnis Gegenstand und Subjekt einer Zuwendung sein kann. Andererseits kann nicht jedes Erlebnis seinerseits wieder Substrat einer Zuwendung sein, vielmehr nur diejenigen Erlebnisse, die selbst wieder gegenstandkonstituierende sind, also nicht sinnliche Inhalte. Wenn sie es sind, haben wir eine wunderbare Sachlage: Im inneren Bewusstsein konstituiert sich das Erlebnis als immanente Einheit, und das Erlebnis seinerseits ist wieder gegenstandkonstituierend, es ist einerseits selbst etwas, Einheit des inneren Bewusstseins, andererseits ist es „Erscheinung“ von etwas, das es nicht selbst ist. Der Strahl geht nun nicht durch das Erlebnis (im Sinn des Bildes vom Hindurchgehen) hindurch auf sein Erscheinendes, denn dann träfe die Zuwendung eben zunächst und auch mit die Erscheinung (das Erlebnis selbst), und das tut es eben nicht, wenn wir zum Beispiel auf ein äußerlich Wahrgenommenes hinsehen. Das Bild vom Strahl ist insofern also nicht zutreffend; aber wir dürfen ja von den Bildern, die uns bei der Wahl der Worte bestimmen, auch nicht zu viel verlangen und vor allem, nachdem wir das Wort gewählt haben, nicht von der inneren Sprachform in jeder Hinsicht echte Analogie verlangen oder gar, von ihr getäuscht, sie den Phänomenen unterlegen. Wir werden also a l s E r g e bn i s aussprechen: Su bs t r at e v o n Z u w e nd u n g e n a l s d i e Ob j e kt i v a t i o n en i m p rä g na n te n Si nn haben ein eigentümliches Wesen; sie sind „intentionale Erlebnisse“1, und die intentionalen Erlebnisse zerfallen: 1) in die Erlebnisse im Sinn des inneren Bewusstseins, das heißt, in die letzten Bewusstseinsphänomene, die absoluten Phänomene, die sich ihrem Wesen nach so verschmelzen, dass die Gebilde den Charakter eben von Objektivationen haben, den Charakter von Erscheinungen, in denen die immanenten Zeitlichkeiten erscheinen, oder 2) in das, was wir Erlebnis im gewöhnlichen Sinn nennen: Vorstellungen, Wahrnehmungen und Urteile etc. 1 Intentionale Erlebnisse als solche, die (Gegenstände konstituierende) Substrate sind bzw. solche wirklich als Substrate enthalten. Substrat und Gegenstand Konstituierendes sind dabei natürlich dasselbe, so dass der obige Ausdruck pleonastisch ist.

text nr. 13

271

Innerhalb dieser Erlebnisse im inneren Bewusstsein, der immanenten „inneren“ Gegebenheiten, sind sinnliche Empfindungen keine Objektivationen, aber äußere Erscheinungen, alle apprehensiven Erscheinungen, ebenso in höherer Stufe die Akte im spezifischen 5 Sinn: die Verstandes-, Vernunftakte. Man spricht von innerer Wahrnehmung und von äußerer Wahrnehmung. Wie unterscheidet sich eins von dem anderen? Im einen Fall haben wir Konstitution von „immanenten Gegenständen“, und zwar den Gegenständen der immanenten Zeit. Im anderen Fall Kon10 stitution von transzendenten, „äußeren“ Gegenständen der empirischen Zeit. In beiden Fällen erscheint ein Gegenstand als selbstgegenwärtige Wirklichkeit. In beiden Fällen steht der Wahrnehmung die Imagination gegenüber usw.

Nr. 14 S tü ck e, V erb i n d un gen u n d Ei ge n sch a ft e n. Z u r Leh re v on d er Ob jek ti va ti on und vo n d en ve rs c hi ede nen B est i mm u ngs w e isen ei n es G eg en sta n de s1

5

§ 1. Stücke als selbständige Teile gegenüber Verbindungen und Eigenschaften als unselbständige Momente

10

15

20

25

30

Ich meinte,2 selbständige Teile eines Dinges, eines Gegenstandes überhaupt, also Stücke, sind prädestiniert zur Auffassung als eigene Gegenstände, zur substantivischen nominalen Auffassung, und sie können nu r als „selbständige Gegenstände“, substantivisch erfasst werden. „Unselbständige“ Momente eines Gegenstandes können nur adjektivisch erfasst werden, sie können aber auch substantiviert werden. Ist das völlig korrekt? Und was liegt dahinter? Phänomenologisch müssen wir doch fragen, wie sich unselbständige und selbständige Gegenstände konstituieren. Wir dürfen nicht so tun, als ob Gegenstände wie zufällig in das Bewusstsein kommen. Erfasse ich die Raumgestalt eines Dinges als „etwas für sich“, erfasse ich sie gegenständlich im spezifischen Sinn, substantivisch, so sind die einzelnen sich abhebenden Stücke, etwa die Seitenflächen des Hexaeders, wenn es sich um die Flächenform Hexaeder handelt, selbständig. Die Oberfläche ist aber vom Standpunkt des Dinges, ebenso von dem des Dingphantoms, unselbständig, ebenso wie auch alle Stücke dieser Oberfläche. Ist das Dingphantom unselbständig? Man möchte einmal sagen: Nein, es ist doch nicht abzusehen, warum es volle Dinglichkeit fordern müsste. Andererseits ist es doch kein Stück eines Dinges. Stücke von Dingen sind wieder Dinge. Darauf wäre zu sagen: In den Logischen Untersuchungen ist Stück definiert als unselbständiges Moment und davon unterschieden das extensive Stück, der extensive Teil.3 1

Mitte Oktober 1911. Z3 = S. 168,14–169,12 und Πλ 6 f. = S. 182,26–184,15 f.. 3 Von „In den“ bis „extensive Teil“ ist eine Einfügung Husserls, die er später wieder gestrichen hat. – Anm. der Hrsg. 2

text nr. 14

5

10

15

20

25

30

35

273

Also extensive Stücke, da s si nd sel bst ä ndi ge T ei le , d i e v o n derse lb en Gege nst an ds kat ego rie si nd w i e d ie Ga n ze n. Extensives „Stück“ ist ni c h t dasselbe wie „selbständiger Teil“. Besseres Beispiel: Der Mensch als Ganzes aus Leib und Seele. Das sind nichtextensive Teile. Hinsichtlich der unselbständigen Momente ist zu überlegen: Nicht jedes unselbständige dingliche Moment ist aussagbar vom Ding als Eigenschaft. Etwa wenn ich mir durch das materielle Ding eine Ebene gelegt denke: Was sie von ihm herausschneidet, ist unselbständigdinglich und doch keine Eigenschaft; oder einfacher, die Kante des Dinges, die Oberfläche, aber voll-materiell genommen. Wenn ich mir die Raumgestalt des Dinges abstraktiv denke, die umgrenzte Ausdehnung, die materiell erfüllt ist, so ergibt das ein adjektivisches Prädikat: „Das Ding ist ausgedehnt, kugelförmig, hexaedrisch etc. ausgedehnt.“ (Die Ausdehnung hat geometrisch die Formen Kugel, Hexaeder etc.) Würden wir die bloße Oberfläche nehmen, kann die als Eigenschaft des Dinges angesehen werden. „Das Ding hat die Oberfläche, die die Raumgrenze ist.“ „Das Ding ist umgrenzt“ statt „hat kugelförmige Umgrenzung“. Die Kugel als räumliche (dreidimensionale) Ausdehnung hat die Oberflächenform. Ist sie aber nicht begrenzt (wobei die Grenze die Form hat, die Kugeloberfläche heißt)? Das Dreieck als zweidimensionale Ausdehnung ist begrenzt von einem Linienzug (die eindimensionale Grenze). Heißt „begrenzt“ soviel wie, es hat die Grenze, und zwar diese Liniengrenze? Wenn wir einen Fleck auf dem Papier sehen und sagen, er sei schwarz und kreisförmig, oder einfacher, er sei rund, so meinen wir doch die Umrundung, und andererseits meinen wir doch nicht „hat Rundung“. Die Umgrenzung in ihrer Form wird adjektivisch gefasst als Bestimmung. (Aber nicht als mittelbare?) Farbe ist eine Eigenschaft, Rauigkeit, Glätte auch und dgl. Aber die Gesamtfärbung des Dinges ist seine Eigenschaft, ebenso wie seine Gesamtform. Die Farben der einzelnen Stücke des Dinges sind ihre Eigenschaften und mittelbare Eigenschaften des Ganzen: „Das Ding ist rot: an dieser Stelle, in diesem Stück, blau an jenem usw.“ „Das Ding glänzt hier, ist hier glatt, dort, in jenem Teil, rau usw.“ Sagen wir kurzweg,1 das Ding ist rau, so ist dann zu ergänzen: dem und dem 1

Zu beachten ist, dass hier der Begriff der „Verbindung“ nicht erklärt ist und dass

274

5

10

15

20

25

30

explikative und prädikative synthesen

Stück nach. Ebenso, das Ding ist begrenzt: Eigentlich ist zunächst das Ding ausgedehnt, die Ausdehnung aber hat eine Grenze von der oder jener Form. Alles in allem werden wir wohl sagen müssen: I m B e g rif f d es T ei ls im prä gn a nt en Si nn e (also des Stücks, des selbständigen Teils) liegt, dass er im Ganzen mit anderen Teilen v er b und en ist (als Folge der Selbständigkeit des Teils); im Begriff des unselbständigen Moments, und zwar eines unmittelbaren, eines eigenschaftlichen, liegt es, dass es ni c h t „ ergän ze nd e “ M om e nte ha t, m i t d e nen es ver bun den i st. Doch das sei keine Definition; vielmehr definieren wir: Unmittelbar ist ein unselbständiges Moment Moment eines Gegenstandes, wenn es nicht Moment irgendeines Stücks ist oder ein Verbindungsmoment mehrerer Stücke.1 Jedes unmittelbare Moment eines Gegenstandes ist ein ei g en sch a ft l ic he s M om e nt. Darin liegt, zum Wesen eines unmittelbaren Moments gehört es als Folge, dass es nicht im Ganzen „verbunden“ sein kann mit anderen Bestandstücken des Gegenstandes (Teilen im weitesten Sinn). Es kann darum selbst zerstückbar sein, teilbar sein in verbundene Momente. Nur relativ zueinander selbständige Gegenständlichkeiten können Verbindung haben, können durch ihr Wesen ein „Verbindungsmoment“ fundieren. Kann man nicht umkehren: Gegenstände, die miteinander Verbindung haben, die durch ihre Wesen Einheitsmomente fundieren, sind selbständig? Sollte das als Definition dienen, so ist die Frage, ob denn selbständige Gegenstände Verbindung fundieren müssen! Ist „alles mit allem“ verbunden? Das wird man schwerlich sagen können. Kann man auch von jederlei selbständigen Gegenständen mindest sagen, dass sie ihren Gattungen nach Verbindung fundieren können (dass zwischen zwei Gegenständen solcher Gattung Verbindung möglich ist)? Jedenfalls kann man innerhalb eines Ganzen überhaupt unterscheiden: 1) „S t ü c k e“ des Ganzen, Teile, die im Ganzen mit anderen Teilen verbunden sind, und zwar so, dass das Ganze sich in einen Zusammenhang verbundener Teile einteilt. Jedes Glied einer

diese Blätter nicht Beziehung haben zu den voranliegenden, wo Verbindungsrelation und Vergleichungsrelation zusammengebracht werden. 1 Vgl. dazu das nächste Blatt = S. 275,18–276,5.

text nr. 14

5

10

15

20

25

30

35

275

solchen Verbindung, die das Ganze verbindungsmäßig ausmachen, ist ein Stück. Die Heraushebung eines Stücks teilt das Ganze schon ein, nämlich zumindest in dieses Stück in Verbindung mit seiner gesamten Ergänzung, die auch den Charakter eines Stücks hat. I s t n äm l i ch A ein S t üc k, so i st au ch d i e V erb in du n g vo n A un d B e i n S tüc k u sw . J e de Ve r bi n d un g vo n G egen stä n de n is t w ie de r ei n se lb st änd i g er G egen s t an d. E in G an ze s ka nn a ls o n ie m a ls ei n ei n z ig es S tü ck ha b en , vi e lm eh r e s ha t z um m in de st en zw ei. Ist A verbunden mit M, und ist M eine Verbindung von B und C, so ist auch A verbunden mit B und mit C. Ist ein Ganzes zerstückt in A und M, dann ist es unter diesen Umständen auch zerstückt in A, B, C. Stücke von Stücken sind Stücke des Ganzen. Solche Sätze sind in der III. Logischen Untersuchung ausgesprochen und dort auf den Begriff des selbständigen Teils gegründet worden. Man kann sie auch aufstellen, wenn man den Begriff des Stücks definiert als den des verbundenen Teils oder als den des Korrelats des „Verbindungsganzen“ als einer „Verbindung“ von Teilen. 2) Ob jedes Ganze Verbindungsganzes, zerstückbares Ganzes sein muss, mag dahingestellt bleiben. Jedes hat sicher „Eigenschaften“, und jedes hat sicher „unselbständige Momente“. Jedes Stück hat auch wieder unselbständige Momente, d. i. „Teile“, die keine Stücke sind. Kann man nun sagen: Unselbständige Momente eines Gegenstandes, die nicht unselbständige Momente seiner Stücke sind, sind Eigenschaften? Aber da regt sich das Bedenken, dass die Verbindungsformen, etwa die Verbindung eines herausgehobenen Stücks des Ganzen mit dem „Übrigen“, dem Gesamtergänzungsstück, doch wohl nicht eine Eigenschaft ist. Müssen wir also nicht sagen: Momente eines Gegenstandes, die nicht zu seinen Stücken als ihre Momente oder die zu irgendeinem Inbegriff von Stücken als ihre Verbindung gehören, sind Eigenschaften des Ganzen? Haben wir also nicht zu unterscheiden St ü c ke , V e r bi n d un g e n, E ig e n s ch a ft e n? Man kann Verbindungen und Eigenschaften auch in eins nehmen (also unselbständige Momente) und unterscheiden: 1) unselbständige Momente eines Inbegriffs, eines Kollektivum, die nicht unselbständige Momente seiner Glieder sind (Eigenschaften im weiteren Sinne von Inbegriffen: Verbindungseigenschaften, Formeigenschaften); 2) unselbständige Momente eines Nicht-Kollektivum, eines singulären Subjekts, die zu ihm als Ganzem gehören, also nicht ge-

276

explikative und prädikative synthesen

hören zu seinen Stücken oder zu ihren Kollektionen (Eigenschaften im engeren Sinne, unmittelbarste Eigenschaften). (Im weitesten Sinn Eigenschaften: Alles, was dem Gegenstand eigen ist, alles Aussagbare überhaupt, das Haben von Teilen, Eigenschaften von Teilen, 5 Eigenschaften von Teil-Inbegriffen etc.)

§ 2. Die unterschiedliche Gegebenheit von Stücken und Eigenschaften in der Explikation. Die Verwandlung des eigenschaftlich bestimmenden in ein relationell bestimmendes Bewusstsein 10

15

20

25

30

35

In der III. Logischen Untersuchung handelte es sich darum, in rein ontologischer Erwägung das Wesen der verschiedenen Arten von Ganzen und Teilen zu erforschen. Auch oben waren all unsere Feststellungen und Unterscheidungen ontologisch. Diese haben nun aber ihre Korrelate im Phänomenologischen, in der Weise der phänomenologischen Konstitution. Ein absolut selbständiger Gegenstand kommt anders zur Gegebenheit als ein unselbständiger, und innerhalb eines Ganzen, d. h. in der Explikation, heben sich selbständige Teile, Stücke anders heraus als die verschiedenstufigen unselbständigen. Zum Wesen jedes Gegenstandes gehört, was die Beziehung auf das konstitutive Bewusstsein anlangt, die Möglichkeit der Betrachtung, die Möglichkeit der Explikation. Zum Wesen des selbständigen Teils gehört, dass, sowie er Explikat des Ganzen wird, sich in diesem ein „Überschuss“, ein plus abhebt, das für sich erfassbar ist als ein zweites, mit dem ersten verbundenes Stück. Ich sage „erfassbar“. Denn das Abheben besagt nicht, dass das Abgehobene für sich erfasst sei. Erfasst ist vielmehr „auf dem Grund“ des betrachteten Ganzen nur das eine Stück. Aber es ist eine eigene Weise der Deckung, die hier vorliegt. Jede explikative Deckung (wenn wir das Wort gebrauchen wollen; wir können auch sagen, Aussonderung auf dem Grund des Ganzen) sondert etwas heraus und lässt anderes übrig, was nicht ausgesondert ist, und so ist die Kongruenz nur eine partiale. Aber es besteht e i n w e s e nt l i ch er U nte r s c h ie d i n d e r A rt , w i e da s N ic ht - E x pl i z i e r t e b e wu ss t i s t i n d i e s em Ko n g ru e n zb e w u s s ts e i n: Ist das Explizierte ein Stück, so ist das Nicht-Explizierte „außer ihm“ und von ihm abgeho-

text nr. 14

5

10

15

20

25

30

35

277

ben. B eim u n selb st änd ige n Mo m ent a b er i st ke in Ab g e h o ben es „ au ß er ihm “. Man achte darauf, wie es sich bei der Sondererfassung einer Farbe am Gegenstand (Weiß der Kanne) verhält und wie bei der Sondererfassung eines Stücks, wie etwa des Henkels dieser Kanne. Es bestehen offenbar auch wesentliche Unterschiede bei den unselbständigen Momenten, je nachdem sie Eigenschaften des Ganzen sind oder sonstige unselbständige Momente, sei es Eigenschaften der Stücke oder Verbindungsformen. Ein unselbständiges Eigenschaftsmoment eines Stücks kann nicht erfasst sein, ohne dass das Stück abgehoben, und wohl auch nicht, ohne dass das Stück sondererfasst ist. Ein solches Moment ist wesentlich nur erfassbar als mittelbares Moment des Ganzen. Weiter, eine Verbindungsform ist nur erfassbar als Moment der Verbindung der Verbundenen, das heißt, diese müssen erfasst und dann in höherer Stufe „an“ ihnen die Verbindung erfasst sein. Somit sind auch Verbindungsmomente innerhalb eines Ganzen notwendig mittelbare Beschaffenheiten, und zunächst mittelbare Explikate. Beschränken wir uns auf u n m i tt elb a re E x pl i ka te, so haben wir also nur zweierlei: entweder die unmittelbare Explikation führt auf ein Stück oder auf ein unmittelbares unselbständiges Moment des Explikanden. Ein unmittelbares Stück des Ganzen (jedes Stück ist unmittelbar erfassbar, scil. wenn es nicht Stück eines Moments ist) unterscheidet sich in der Weise der Explikation vom unmittelbaren unselbständigen Moment, und letzteres ist immer und notwendig „Eigenschaft“. Wir können Eigenschaft auch definieren als unmittelbares unselbständiges Moment eines Ganzen oder als einen unmittelbaren Teil eines Ganzen (auch ein unmittelbares Explikat), der neben sich am Ganzen keine unmittelbaren Teile hat, mit denen er verbunden wäre. Also natürlich ist das Wesen des einen Teil und eine Eigenschaft gebenden Bewusstseins verschieden. In sich hat die Teil-Explikation (Stück-Explikation) und Eigenschaftsexplikation ein unterscheidbares Wesen: eben korrelativ damit, dass Stück und Eigenschaftsmoment wesensverschieden sind. Was besagt nun d er Un t e rsc h i e d de r P r ä di k a t i on e n „ A i st w eiß “ u n d „ A ha t W e i ße “? Eigenschaft bleibt natürlich Eigenschaft. Aber einmal finden wir die s u bs t a nt i v i s c he Fassung, das andere Mal die ad j e kt i v i s ch e. Und weiter wird man sagen: Im einen

278

5

10

15

20

25

30

35

explikative und prädikative synthesen

Fall vollziehen wir ei n e i n ner e Be s tim m u ng, e in e ir re la ti v e , i m and eren Fal l ei ne re l ati ve. Tun wir das Erstere, so vollziehen wir die Explikation des unselbständigen Moments aus seinem Explikanden, dem A, und dann zu A zurückkehrend, setzen wir es als Bestimmungssubjekt und bestimmen es, indem wir daraufhin setzen, dass es weiß ist: Nämlich, indem wir die Einstellung der Bestimmung vollziehen, steht das in der Weise unmittelbarer Einzelerfassung von Unselbständigem Bewusste als das A Bestimmende, als Merkmal des A da und erhält als bestimmend die Form der Adjektivität. Denn Adjektivität ist überhaupt die Form des Bestimmenden in der prädikativen Synthese. Andererseits, Substantivität ist die Form dessen, was Träger einer Bestimmung ist. Doch ist es vielleicht richtiger zu sagen: Schon im explikativen Übergang, bevor die eigentlich prädikative Setzung erfolgt, ist der Explikand, nachdem das Explikat zur Heraussonderung gekommen ist, in geänderter Weise bewusst, nämlich, wenn das Explikat ein unmittelbar unselbständiges Moment ist, als das A, an dem etwas ist, das an ihm ist als etwas es Bestimmendes. Aber erst in der Rückwendung zum A, an dem das p, das weiß ist, und in der prädikativen Darauf-Setzung des Bestimmenden als bestimmend haben wir das „A ist weiß“. Das als Träger von etwas Bewusste, das bewusst ist als etwas, an dem eine Bestimmung ist, erhält überhaupt die Form der Substantivität. Man möchte sagen: Träger-Sein, das ist die Substantivität, und die kann auch da innerhalb einer Prädikation auftreten, wo das betreffende Substantivum nicht als Subjekt fungiert und wo das an ihm als seine Bestimmung Prädizierte nicht auf die Subjektsetzung hin als Prädikatsetzung gesetzt ist. Nämlich, wo eine Relation vollzogen wird, ein relationelles Übergangsbewusstsein zwischen A und B, da hat im Übergang von einem zum anderen (und zwar in dem besonderen synthetischen Übergang, der die betreffende Relationsart auszeichnet) das A sowohl wie das B den Charakter des Trägers, an dem etwas ist, an dem ein Adjektivisches, ein Unselbständiges und Bestimmendes (eben ein „an“) ist. In der Prädikation wird aber nur eins zum Subjekt, etwa A, und das an ihm Seiende wird „von ihm ausgesagt“, wird auf die A-Setzung als Prädikat gesetzt. Aber das Prädikat ist ein Bezügliches, bezogen auf das B, das nun, indem es als bezügliches Objekt gesetzt ist, die Form der Substantivität

text nr. 14

5

10

15

20

25

30

35

279

zeigt: weil es hier als Träger bewusst ist. Die Form der Substantivität haben wir also zu unterscheiden von der Subjektform. Das als Subjekt Stehende hat notwendig substantive Form, aber zugleich die funktionale Form des Trägers, der als Bestimmungssubjekt fungiert. Doch zweifle ich, ob diese Auffassung nicht gekünstelt und ein wirklicher Ausdruck der Sachlage ist. Ich möchte versuchen, in folgender Weise auszuführen: 1) In jeder Betrachtung, in jeder Explikation wie in jeder beziehenden Betrachtung, wird der Explikand in ausgezeichneter Weise gesetzt, als ein An-und-für-Sich, als ein Gegenstand in ausgezeichnetem Sinn. Jedes Sich-einem-Gegenstanderfassend-Zuwenden ist ein Ihn-zum-Gegenstand-für-sich-Machen, wenn die Erfassung Ansatzpunkt einer explizierenden oder beziehenden (relativierenden) Betrachtung ist, ohne allererst eine Formänderung zu erfahren. Schließlich kommen wir dazu, dass es eben etwas Besonderes ist, jene Erfassung zu vollziehen, die einen Gegenstand als an und für sich erfasst. Nicht jedes Erfassen tut das, wie gerade die Erfassungen innerhalb der Explikationen und prädikativen Synthesen erweisen. Das „Anund-für-sich“, das ist die Form der logischen Substantivität. Sofern die beziehenden Übergänge der prädikativen Synthesen zugrunde liegen, tritt das Substantivische, neue Formen annehmend, eventuell in die Prädikation ein und erhält eventuell den grammatischen Ausdruck des Substantivum. Jedenfalls deutet jedes SubstantivischGrammatische ein logisches Substantiv an, obschon nicht immer der Ausdruck getreu dem Logischen folgt. 2) Gegenstand im weiteren Sinn ist, was als ein An-und-für-Sich erfassbar ist. Phänomenologisch sagt das, ein Bewusstsein kann schon in gewisser Weise Bewusstsein vom Gegenstand sein, ohne dass der Gegenstand dabei im eigentlichen Sinn gegenständlich ist, also ohne dass das Bewusstsein ein im prägnanten Sinn vergegenständlichendes ist (zum An-und-für-Sich machend). Wir könnten diese prägnante Objektivation auch als l o g is ch e Su b s t ant i v i e r ung bezeichnen. Natürlich besteht dann die ideale Möglichkeit, in einem Einheitsbewusstsein das eine Bewusstsein in das substantialisierende überzuführen und dann einzusehen durch neue substantialisierende Vergegenständlichungen: Das hier und dort Bewusste sei ein und dasselbe. Demnach, wenn wir zwischen selbständigen und unselbständigen Ge-

280

5

10

15

20

25

30

35

explikative und prädikative synthesen

genständen unterscheiden, so ist schon gesagt, dass die letzteren wie die ersteren zu logischen Substanzen werden können. 3) Jeder Gegenstand ist bestimmbar, jeder ist Gegenstand möglicher Betrachtung, zunächst möglicher Explikation. Es gilt nun das Gesetz: Wenn ein Gegenstand (mag er auch unselbständig sein) in der Form der logischen Substanz bewusst ist, so hat in der Explikation notwendig jeder seiner (relativ zu ihm) selbständigen Teile ebenfalls die substanzielle Form, und eine andere kann er da nicht haben. 4) Was die Explikation von unselbständigen Momenten des Gegenstandes anlangt, und zwar, wie wir der Einfachheit halber annehmen wollen, von unmittelbar unselbständigen Momenten, so haben wir zu unterscheiden: a) die schlichte Explikation. Im unmittelbaren Übergang zum unselbständigen Moment, das sich auf dem Grund des Explikanden aussondert, hat das unselbständige Moment nicht, und kann es nicht haben, den Charakter des An-und-für-Sich, also nicht die Form der Substantivität, vielmehr die sie ausschließende Form der Adjektivität, d. h. die Form des „an etwas“. Der Explikand erhält die Form dessen, woran etwas ist, das Explikat die Form des „an ihm“. Diese Adjektivität ist aber nicht die einzig mögliche, es ist die irrelative, „absolute“. Der allgemeine Charakter der Adjektivität ist das „an etwas“ und setzt somit einen Träger voraus. Das „an“ hat seine besondere Affinität zum Unselbständigen. Jedes unselbständige Moment „weist“ auf etwas (eventuell auf einen Inbegriff) zurück, an dem es ist, und darin besteht seine Unselbständigkeit. Dieses „Zurückweisen“ besagt aber, eine Explikation ist idealiter möglich bzw. eine darauf gebaute Prädikation (und zwar immer auch eine unmittelbare), in welcher das Unselbständige in dem Bewusstsein, in der Form des „an etwas“, der Adjektivität dasteht, wobei der Explikand der Träger ist (Explikation ist dabei aber weiter genommen, ich denke z. B. auch an Verbindungsformen). Doch kehren wir zur schlichten Explikation eines unmittelbaren unselbständigen Moments zurück, so besteht nun b) die Möglichkeit, dass das unselbständige Moment zur Substanz gemacht wird. Dann verliert es den Charakter des „an“, der Adjektivität, und es v e r wa n d el t s i ch d a s e i g e ns ch a f t l i ch be s t i m me n de B e w us st s e in i n e in R e la ti o n sb e w us s t s e i n (das relationell bestimmende). War früher „weiß“ Bestimmung seines Trägers A, so steht dieser nun in einer relativen Bestimmung als Weiße-habend

text nr. 14

281

da. Dabei besitzt das Haben einerseits Gemeinsamkeit mit jederlei Teilverhältnis (Ganzes und selbständige Teile), andererseits seine besondere Eigentümlichkeit, insofern das Gehabte hier eben ein Unselbständiges ist, eine Adjektivität, die Substantivierung erfahren 5 hat.

10

15

20

25

30

§ 3. Die relative Bestimmung eines Gegenstandes als Übergangssynthese zu einem zweiten substantivischen Gegenstand. Absolute und relative Adjektivität. Relationen als Kollektiv-Komplexe mit Kollektiv-Prädikaten. Der Unterschied zwischen Verbindungs- und Vergleichungsrelationen. Psychische Eigenschaften und die unzerstückbare Einheit des Ich Schließen wir nun die Erörterungen der R e l a ti on en ü be rh aup t an. Unter dem Titel Explikation hatten wir Formen synthetischer Betrachtung, gewisses Übergangs- und Einheitsbewusstsein von zwei Erfassungen, in welchem ein Gegenstand als logische Substanz sich bestimmte, sei es eigenschaftlich oder durch seine Teile bzw. sei es irrelativ oder relativ (und das also eventuell ohne die Form des prädikativen beziehenden Bewusstseins anzunehmen). Wir können von bestimmendem Übergangsbewusstsein sprechen und von SichBestimmen vor der Prädikation und in der Prädikation. Es gibt aber noch andere Formen der vorprädikativen Bestimmung. Relative Bestimmung ist dadurch charakterisiert, dass eine Übergangssynthese von einem substantivischen Gegenstand zu einem zweiten ebensolchen führt; wobei diese Synthese verschiedene Formen haben kann, von welchen uns nur eine, die von Ganzem und Teil, entgegengetreten war. Im Wesen von Gegenständen liegt es, dass sie bei substantivischer Fassung ein Übergangsbewusstsein fundieren können von ganz bestimmtem Gehalt, und das „Ergebnis“ des Übergangs ist dies, dass der erste Gegenstand, der ausgezeichnet ist als Subjekt, als der, auf den ein besonderes Absehen1 geht, den

1 Dieses besondere Absehen ist überall für das Explikat und überhaupt das Bestimmungssubjekt zu beachten, und es gehört zum Vorprädikativen.

282

5

10

15

20

25

30

35

explikative und prädikative synthesen

Charakter eines Trägers erhält, an dem eine Adjektivität ist, die aber sich unterscheidet von der absoluten Adjektivität dadurch, dass sie neben dem Träger einen Gegenträger, sozusagen nämlich das bezügliche Objekt fordert und bewusstseinsmäßig mit sich vereint hat. Relativ ist jede Bestimmung eines Gegenstandes (der damit als Substantiv und als Subjekt charakterisiert ist), die das Subjekt bestimmt aufgrund einer Übergangssynthese zu einem zweiten substantivischen Gegenstand; so viele Formen solcher Übergangssynthese, so viele verschiedene relative Bestimmungen. Wir haben also eine doppelte Adjektivität: 1) D i e a b s olu t e A d je k t ivi t ät : J ed em a bs olu t en Ad je kt iv e n t s p r i c ht e i n T eil , ei n u n sel bst ä n di g er T e il de s Ge g e ns t a n de s, und das sagt nichts anderes (korrelativ), als dass jede adjektivische Prädikation in eine relative verwandelt werden kann. 2) D i e r e l a t i v e A dj ek t i vi tä t: Ein solches relativ Adjektivisches ist an dem Träger in Bezug auf anderes und i s t ni c ht ein Tei l , ni c h t e i n M om e nt, das als in dem Gegenstand aufgefasst werden kann. Es ist daher auch verkehrt zu sagen, durch den beziehenden Übergang wachse dem Gegenstand ein neues Moment zu, das dann aus ihm durch Explikation herauszuholen sei, als ob Bestimmung des Gegenstandes eine Erweiterung des Gegenstandes durch ein plus an Teilen wäre. Objektiv heißt es: Ein Gegenstand hat für sich genommen innere Beschaffenheiten, nämlich innere Merkmale (absolute Eigenschaften), Teile und dann eventuell mittelbare Eigenschaften, Eigenschaften der Teile, als ihn bestimmende usw., auch Verbindungen der Teile. Ein Gegenstand hat, in Bezug auf andere Gegenstände genommen, äußere Beschaffenheiten. Für die Konstitution aber heißt es: Natürlich, das gebende Bewusstsein der ersteren erfordert es, dass der Gegenstand bloß expliziert, das gebende Bewusstsein der anderen, dass der Gegenstand zu ihm fremden Gegenständen in Bezug gesetzt wird. Sagen wir, die relativen Beschaffenheiten wachsen dem Gegenstand durch Relation zu, so heißt das nicht, dass sie ihm nicht objektiv zukommen, sondern dass sie ihm eben in dem Sinn zukommen, der die relative Bestimmung erfordert: zukommen in Bezug auf anderes, während die inneren in ihrem Sinn Bezug auf ihn selbst erfordern.

text nr. 14

5

10

15

20

25

30

35

283

Am Rand der vorigen Seite = S. 282, 19 ff. ist der Fehler, in den ich wiederholt verfallen bin, klargelegt. Der Gegenstand hat objektiv seine inneren Momente, seine Bestimmungen, seine Teile; dem erfassten Gegenstand als solchem „wachsen“ die Bestimmungen als solche in der explikativen Synthese zu, und zwar wachsen ihm einmal die puren eigenschaftlichen Bestimmungen und das andere Mal die relativen Bestimmungen von Eigenschaften als Gehabtheiten zu. Aber natürlich, der Gegenstand ist, was er ist, und der Prozeß der Explikation gibt ihm nicht im objektiven Sinn neue Eigenschaften, sondern bringt sie zur Gegebenheit. Ebenso wachsen dem Gegenstand in der beliebigen Relation (im relativierenden Übergang) nicht neue Beschaffenheiten zu, sondern neue Beschaffenheiten werden bewusst, kommen zur Gegebenheit; Beschaffenheiten, die ihrem Wesen nach Beschaffenheiten in Bezug auf substantivische Gegenstände sind. Es hat daher gar keinen Sinn, diese Beschaffenheiten wie Momente des Gegenstandes (mögliche Teile) zu behandeln und sie durch Explikation herauszuholen. Ferner ist zu bemerken: Explikation ist ein bestimmendes Bewusstsein, das einen einzelnen Gegenstand „auseinanderlegt“. Wir haben aber neben Explikation nicht bloß äußere Relation oder neben eigenschaftlicher Bestimmung relative Bestimmung. Vielmehr ist daran zu denken, dass auch Kollektiva Beschaffenheiten haben, und zwar nicht Beschaffenheiten der Glieder, die in Bezug auf das Kollektiv mittelbare Beschaffenheiten wären, sondern Beschaffenheiten der Kollektiva selbst. Es ist hier das Problem, wie sich die Formen zu den Relationen (als bestimmenden Synthesen) verhalten, und ob alle Beschaffenheiten von Kollektiven Verbindungsformen sind. Hier ist von vornherein einiges zu notieren. Jeder Relation, verstanden als bestimmende relative Synthese, entspricht ein K o l l e kt i v - Ko m pl e x , u n d da s P a a r de r  B e zi eh u ng sg l i e de r h a t e i n Ko l l e k t iv - P r ä di k a t. Dieser KollektivKomplex ist d i e i d e nt i s c he S a c h l a g e, di e s i c h i n d i e be i de n r el at i one l l e n, k o l l e kt i v e n S a c h v e rh a l te a u s e i na nde rl eg t. Die Ähnlichkeitssachlage, das Raumverhältnis (die räumliche Lage: das Bündel der Linien, das Punktpaar, das Geradenpaar, in ihrer Lage genommen etc.) und die Glieder in ihrem Zusammen haben dann als Prädikat die „Form“ des Zusammens, so bei allen Relationen. Dabei besteht ein Unterschied zwischen V e r b i ndu ng s r e l a t i o ne n und

284

5

10

15

20

25

30

35

explikative und prädikative synthesen

Vergleic h u ngs rel at i o nen (allgemeiner: Deckungsrelationen). Einmal hat die Relation ein Fundament in einer Verbindung; die Glieder sind durch die Verbindung geeinigt, und das Verbindungsmoment ist vor der Relation (ohne dass Relation konstituiert werden müsste) ein Adjektivisches an den Gliedern, nämlich an ihrem Kollektiv. Das andere Mal, bei den Vergleichungsrelationen (mit denen wir als D ec k u ngs rel at ion e n die Beziehung zwischen Ganzes und Teil zusammennehmen können), haben wir an den Gliedern, an ihrem Kollektiv, nicht vorher eine Verbindung, die das Fundament der beziehenden Synthese bildete, sondern die Einheit der Sachlage besteht nur darin, dass eben eine gewisse Deckungsweise statthat, die ihre Umkehrung notwendig fordert, und das Kollektiv der Glieder, z. B. der einander Gleichen und Ähnlichen, hat in sich im Voraus kein „Moment“ als Adjektivität, sondern hat die Beschaffenheit, wechselseitig ähnlich oder gleich zu sein, die Beschaffenheit, derartige Deckung und daraufhin derartige Relation zu begründen. Einige Beispiele wollen wir noch erörtern. Wie steht es mit p sy c h i s c h e n Ei g e n sc ha f te n? Wir sagen „Jetzt ist ein Ding rot und dann blau“, ebenso „Jetzt ist ein Mensch zornig, dann lustig, nachdenklich“ etc. Das sind also temporäre Eigenschaften des zeitlichen Individuums Mensch. Ist aber Zorn etwas „Unselbständiges“? Nun in der Tat, das Ichbewusstsein ist nicht eine extensive Einheit, in welcher verschiedene Zustände nebeneinander und außereinander liegen. „Zorn“ setzt ein psychisches Subjekt voraus, das zornig ist, und dabei ist das Subjekt des Zornes nicht ein selbständiges Etwas neben dem Zorn, sondern, wie das Ding farbig ist und dabei einerseits Farbe nichts außer dem Ding ist, selbständig, und andererseits das Ding nichts außer der Farbe, sondern in ihr ist wie in all seinen Eigenschaften, so verhält es sich auch mit dem Ich und seinen Zuständen. Es sind Unselbständigkeiten, in denen das Ich ist. Ferner ist von Interesse: Das Ding ist ein extensives Ganzes, es lässt sich zerstücken, räumlich und zeitlich. Aber das Ich lässt sich, zunächst von seiner Zeitlichkeit abgesehen, nicht zerstücken. Was aber die Zeitlichkeit anlangt, so ist es zumindest fraglich, ob ein zeitlich erfülltes „Ich-Stück“ wirklich für sich sein könnte. Der Bestand an Phänomenen des Ich (die ihre phänomenologisch-zeitliche Einheit haben) lässt sich als eine Verbindungseinheit ansehen und zeitlich zerstücken, aber dieser gesamte Bestand an Phänomenen in seiner

beilage xx

285

Einheit ist, wie man vielleicht einsehen kann, unselbständig, ist Gesamteinheit von Ichakten und Ichzuständen, deren Zerstückung nicht besagt, dass das Ich zerstückbar sei. Das Ich ist eine absolute, in keiner Hinsicht zerstückbare Einheit. Was da zerstückt oder abgestückt 5 wird, ist immer und notwendig eine Ich-Eigenschaft, eine extendierte Eigenschaft, die vielerlei Sonderheiten unterscheiden lässt, sämtlich unselbständig. Wir sagen die psychischen Eigenschaften von Menschen aus, so wie wir seine leiblichen von ihm aussagen: Er ist zornig, heiter, er 10 ist groß, vierschrötig etc. Dem Menschen schreiben wir eine leibliche und geistige „Seite“ zu und sagen von ihm zweierlei Eigenschaften aus, die ihm zukommen, „sofern“ er die eine und sofern er die andere Seite hat. Würden wir den Menschen nicht als eine wahre Einheit, sondern als einen Verband von zwei Stücken ansehen, Leib und Geist, 15 so würden wir sagen müssen, dem leiblichen Teil nach ist er das eine, dem geistigen nach das andere, nota bene falls wir unter Leib den physischen Körper der physischen Natur verstehen.

Beilage XX Eigenschaftliche gegenüber relationellen Bestimmungen: die Frage nach ihren Fundamenten, den Möglichkeiten der Nominalisierung und des Habens. Der Unterschied zwischen Verbindungs- und Vergleichungsrelationen1

20

Hier kommen auch in Betracht meine alten Unterschiede:2 1) Die Farbe Weiß in der Farbenmannigfaltigkeit, das Weiß als Gegen25 stand für sich außerhalb der Bestimmung gesetzt. 2) Im bestimmenden Sachverhalt, „weiß“ als Prädikatterminus in „S ist weiß“, natürlich das Wort „Terminus“ hier rein als Bestandstück der Sachverhaltssynthese genommen. Wir können statt Prädikatterminus auch sagen, das adjektivische „weiß“, von dem wir substantivisch sagen, indem 30 wir es zum Subjekt machen, dass es dem S zukomme. Es ist dabei zu beachten, dass diese Rede, das Weiß (das Adjektivum, das nominalisiert wurde) komme dem S zu, einen anderen Sinn hat als die Rede, die Farbe Weiß (aus

1 2

Mitte Oktober 1911. – Anm. der Hrsg. Auch zur Lehre von Ganzen und Teilen (III. Logische Untersuchung).

286

5

10

15

20

25

30

35

explikative und prädikative synthesen

der Farbenmannigfaltigkeit) komme dem S zu (etwa in Hinweis auf eine Farbenreihe: „Diese Farbe hat der fragliche Gegenstand“). Der Gegenstand hat die Farbe Weiß und damit äquivalent ist, er hat das Prädikat (es besteht der Sachverhalt und in ihm ist „weiß“ das Prädikat des Subjekts S). Das Prädikatglied im Sachverhalt ist zwar dem Wesen nach die Farbe, aber eben in Form des Prädikatterminus, in der Form der Adjektivität. Es ist auch klar, dass wenn die Farbe sich näher bestimmt, etwa als bläulich, dass dann nicht das Prädikat weiß sich näher bestimmt, sondern in ein neues, das Subjekt näher bestimmendes Prädikat übergeht: S ist bläulich-weiß = S ist weiß, und dieses Weiß (die Farbe) ist bläulich, dieses Weiß scil. = das Weiß, das das S hat. 3) Im Sachverhalt finden wir das volle Prädikat „ist weiß“. Der bestimmenden Darauf-Setzung (auf die Unter-Setzung des Subjekts) entspricht dieses einheitliche, obschon unselbständige „ist weiß“, und auch das kann zum Gegenstand gemacht werden, zum Beispiel, wenn wir sagen, d a s W eiß s ei n zie h t d a s Au s ge d eh nt se in n ac h s ic h, überhaupt das a-Sein das b-Sein. Wir können ebenso gut sagen ohne Sinnesänderung, das „ist weiß“ im einen Sachverhalt zieht „in Wahrheit“ das andere, das „ist q“ nach sich etc. Wir sagen auch, das eine Prädikat ziehe das andere, die eine Eigenschaft, Beschaffenheit, die andere nach sich; in übertragener Weise freilich sagen wir dies auch von den Terminis sub 2). Wieder ist die Bedeutung der Rede vom Zukommen modifiziert. Wir sagen auch, dass das Prädikat, das Weißsein, dem Subjekt zukommt, wie wir sagen, dass die Farbe und dass das Weiß ihm zukommt (der Prädikatterminus). Wenn wir nun Relationsurteile nehmen, etwa „A ist ähnlich mit B“, so können wir das ebenso wie „A ist weiß“ in „A hat Weiß“ verwandeln, in „A hat Ähnlichkeit mit B“.1 Welchen Sinn hat das nun? Da fällt uns auf, dass Relate und relative Prädikate natürlich zu Gegenständen gemacht werden können, womit nur Bestandstücke von Sachverhalten gewisser Grundformen, der relationellen, vergegenständlicht sind. Das Ähnlich steht gleich als ∼ 3). Das nominalisierte Adjektivität dem Weiß sub 2), das Ähnlichsein = Ähnlich ist ein Adjektiv, und zwar eine Form von Relaten, wie das Weiß eine Form von adjektivischen Terminis ist. Im Sachverhalt sind A und B verbunden durch das Relat „ähnlich“, durch Ähnlichkeit. A hat ferner Ähnlichkeit mit B. Das ist das bestimmende Prädikat: die Beschaffenheit Ähnlichkeit mit B = Ähnlichsein in Bezug auf B. Aber dem Weiß sub 1) entspricht kein Analogon?

1 A hat Weiße = 1) A hat die Farbe weiß. 2) Ein ganz anderer Sinn: A hat das Prädikat weiß und hat die Eigenschaft Weißsein.

beilage xx

5

10

15

20

25

30

35

40

287

Überlegen wir näher. Abstand ist eine Relation, Richtung ist eine Relation. Aber Abstände machen wir zu Gegenständen und betrachten sie in der Abstandsmannigfaltigkeit. Ebenso sprechen wir von Ähnlichkeiten und von der Ordnung der Ähnlichkeiten nach graduellen Abstufungen. So wie das Weiß mögliche Bestimmung ist, nämlich „unselbständig ist“ und, wofern es ist, immer Bestimmungsstück eines Gegenstandes ist, aber darum doch nicht gesetzt sein muss als Bestimmung, sondern auch gesetzt sein kann als „Gegenstand für sich“ und betrachtet in der Farbenmannigfaltigkeit, so ist Entfernung und Entfernung in eins mit Richtung etwas Unselbständiges, und zwar ein doppelt Unselbständiges, das Entfernung eines a zusammen mit einem b (oder, was genau dasselbe ist, eines b zusammen mit einem a) ist: ein Unselbständiges, das zwei Ergänzungen fordert; und nun besteht die doppelte Möglichkeit, das In-der-und-der-Richtung-Entferntsein, -Abstehen zu fassen als Entferntsein des A vom B oder umgekehrt; andererseits aber auch die Möglichkeit, die „Strecke“ für sich und die gerichtete Strecke zum Gegenstand zu machen in der Streckenmannigfaltigkeit. Ebenso haben wir die Bildungen: die Größe in der Größenmannigfaltigkeit, das Größer und das Größersein-als-Etwas, -als B. Doch entspricht die Größe nicht der Strecke, sondern der Lage, die Größenmannigfaltigkeit der Lagenmannigfaltigkeit. Dem Abstand entspricht das Größenverhältnis, das selbst ein Abstand, ein Größenabstand ist. Es fehlt uns ein Name zur Bezeichnung des unselbständigen Moments, das eine Einheit zwischen den Beziehungspunkten herstellt, eine Einheit, die erfasst werden kann vor der Aufeinanderbeziehung bzw. die als dieselbe erkannt werden kann, ob wir von a zu b übergehen oder umgekehrt. D as R e la t i o ns f u nd a m e nt i m a lt e n S in n : D i es es en ts p r ic h t d em in ne r e n M o me nt e in e s G eg e ns t an d es , d as als fu n d am e nt um ei gen s c ha f t l i ch e r B e s t im mu n g f u ng ie r t. J e de B e st i m mu n g h a t ih r F und a m e n t , e in e in n er e B es t im m u n g e i n e ig en s ch a ft l ich e s F u nd a m e nt , je de äu ß er e Bes t im m u n g e in r e la ti o ne ll es F u nd a m en t , da s e r st er e e ins eit ig, d as l etz t ere z we is e i t ig un s el bs t än d ig. Der Gegenstand hat Weiß, hat sein eigenschaftliches Fundament als „Moment“; das Gegenstandspaar a, b hat das relationelle Fundament, und hat es in ganz anderer Weise als „Verbindung“ (wenigstens bei den Verbindungsrelationen), als Form ihrer sachlichen Einheit: Einheitsform. Das Ganze aus a und b hat, möchte man sagen, das Relationsfundament als „Moment“, doch in besonderer Weise, sofern dieses Moment nicht Eigenschaft des Ganzen ist, nicht unmittelbar an ihm zu finden, sondern an dem Paar. In dieser Hinsicht müsste noch tiefer gebohrt werden, insbesondere was die verschiedenen „Einheitsformen“ anlangt, die als fundamenta der Relationen dienen. Es besteht da ein kar d in a l er U nt er s c hi e d, d er d e n

288

5

10

15

20

25

30

35

explikative und prädikative synthesen

d e r R e la t i o ne n in V e rgl ei c hu ng s- u n d V er b in d u n gs rel at i o n en nach sich zieht.1 Die V e rb i nd u ng sf orm e n sind Formen der Wirklichkeit, sind wirklich existierend mit den Verbindungsgliedern. Existiert das Verbundene wirklich, so hat auch die Verbindung Wirklichkeit der Existenz. Zwei Dinge haben einen Abstand, und der Abstand gehört zu den Dingen, und wenn auch der Abstand keine Existenz als Ding hat, so hat er doch als durch die Existenz der Dinge fundierte Existenz eben Existenz. Gehen wir zu den Ideen über, so erhalten wir Ideen von Verbindungen, die ihre singulären individuellen Einzelheiten in individuellen Existenzialformen, in Wirklichkeitsformen haben. Teile einer Figur haben Verbindung: Die Figur ist eine Wirklichkeitsform (genauer, Idee von einer Wirklichkeitsform), in welcher die Teile wirklich eins sind. Hi ng e ge n i st je de V e r gl eic hu n g s re l ati on a ls s o l ch e k ein e W ir k li ch k e i ts r e l at io n, die Einheit ist eine unwirkliche Einheit. Ein Ton, den ich höre, und ein Ton, den ein anderer hört, als Empfindungsinhalt genommen, mögen gleich sein, mögen einen Ähnlichkeitsabstand, einen Intensitäts- oder Qualitätsabstand haben, aber die Einheitsform gehört nicht zu den Toninhalten als Wirklichkeiten, als eine wirkliche, sie verbindende Form. Ebenso Beziehungsformen, die bestehen zwischen meinen und eines anderen psychischen Phänomenen. Psychisches jeder Art hat Einheitsformen als Wirklichkeitsformen, als Verbindungsformen, sofern es Psychisches innerhalb eines individuellen „Bewusstseins“, sagen wir, einer individuellen Seeleneinheit, ist. Insofern hat im intuitiven Gleichheitsbewusstsein das Gleiche mit dem Gleichen eine „sinnliche“, „wirkliche“ Verbindung. Aber diese besteht eben nur innerhalb einer seelischen Einheit, und die Verbindungsrelation, die sie stiftet oder die wir beziehend stiften, ist nicht zu verwechseln mit der Vergleichungsrelation, die mit ihr im individuellen Bewusstsein Hand in Hand geht: mit der Deckungsrelation. Vergegenwärtige ich mir durch Einfühlung den Bewusstseinsinhalt eines Anderen und vergleiche ihn mit meinem (oder auch zweier fremder Personen, und vergleiche ihre psychischen Erlebnisse miteinander), so mag ich Gleichheit, Ähnlichkeit, Steigerung finden und in der Zusammenhaltung der Beziehungsglieder die sinnlichen Formen. Aber näher besehen illustriere ich nur durch sinnliche Formen. Eigentlich ist meine Tonempfindung und die eines Anderen, mein Zorn und der eines Anderen nicht „verbunden“, aber im Übergang von meinem Empfindungserlebnis zur Vergegenwärtigung der Empfindung des

1

Cf. weiter unten L8, zweite Seite wohl S. 283,27–284,16.

beilage xx

5

10

15

20

25

30

35

40

289

Anderen erlebe ich die Synthese der Gleichheit, der Ähnlichkeit und dgl. Habe ich nur eine „angemessene Vorstellung“ des fremden Erlebnisses, so habe ich eine ausreichende Grundlage für die angemessene Erfassung der Beziehung, für den angemessenen Vollzug der Synthese. Habe ich eine angemessene Vorstellung eines mir nicht gegenwärtigen Dinges, so reicht das nicht hin, um den Abstand dieses Dinges von einem soeben wahrgenommenen zu erfassen: Eben weil das Verhältnis ein Wirklichkeitsverhältnis ist, dessen Erfassung Wirklichkeitserfassung voraussetzt für beide Verbindungsglieder. Die Einheit von Teilen eines Ganzen ist Verbindungseinheit. Das Ganze braucht kein individuelles Ganzes zu sein, z. B. Verbindung von Teilen eines Satzes. Die Wirklichkeit der Verbindung ist von derselben Art wie die Wirklichkeit des Ganzen bzw. wie die Wirklichkeit der Verbindungsglieder. In dieser Hinsicht wäre also weiter zu forschen. Muss man nicht sagen: Vergleichungsrelationen haben eigentlich gar kein „fundamentum“? Alle Relationen entspringen durch beziehendes Hinübergehen und Zu-einersynthetischen-Einheit-Bringen, aber nur Verbindungsrelationen haben ein mit dem Zusammensein der Beziehungsglieder gegebenes fundamentum (als ein Mit-Seiendes), eine Verbindung, die durchlaufen wird und deren Durchlaufen das Wesen der Synthese bestimmt. Die Relation zwischen Ganzem und Teil gehört nicht etwa zu den Vergleichungsrelationen, andererseits aber auch nicht zu den Verbindungsrelationen, sondern bildet ei n e ei ge n e G r u pp e. Auch da gibt es kein eigentliches fundamentum. Was uns hier aber interessiert, ist Folgendes: Wir haben oben festgestellt die Mehrdeutigkeit des Habens bei den inneren Bestimmungen. A hat Weißsein und hat Weiße (als fundamentum des Weißseins). Wir können nun auch bei den relativen Bestimmungen das Haben etablieren. Anstatt prädikativ zu sagen „A ist ähnlich mit B“, können wir sagen „A hat Ähnlichkeit mit B“. Es hat sich herausgestellt durch unsere obigen Analysen, dass, was hier gehabt wird, das Ähnlichsein ist, während das Analogon der Farbe Weiß als des fundamentum nicht von A ausgesagt werden kann als von ihm Gehabtes: hier aus dem Grund, weil Ähnlichkeit ein „eigentliches“ fundamentum nicht hat, jedenfalls kein „Moment“ hat, das so wie „weiß“ oder wie räumlicher und zeitlicher Abstand mindestens zum Zusammen der Beziehungspunkte gehört oder zu ihrer verbundenen Einheit gehört. Wir können auch sagen: Es ist zu unterscheiden das nominalisierte Adjektivum von dem „Moment“, von dem unselbständigen Gegenstand, der als Teil eines umfassenden Gegenstandes nur sein kann, und das das fundamentum des Adjektivum bildet. Das wird nominal zum Gegenstand, eben wenn wir von ihm aussagen; es ist aber nicht nominalisiertes Adjektiv, so wie Weißsein

290

explikative und prädikative synthesen

und Ähnlichsein = Ähnlichkeit mit B. Nominalisierte Adjektivitäten sind entweder solche, die eine oder zwei Leerstellen haben, sie weisen entweder nur auf ein Subjekt oder auch auf ein bezügliches Objekt hin.

Nr. 15 S ac h l ic h e E in he it en de r V er s ch mel zu ng u n d der Verb in d un g als S ubs t r at e f ür id ent if i z i er en de u nd rela t i onel l e Sy n th es en. Zu r Leh re vo n d en Präd ik at i ons f or me n . G run dl ege nd e s zu r R e la t io nst h eor i e 1

5

§ 1. Sinnlich-sachliche Einheit der Verschmelzung, sukzessiv-zusammenhaltende Synthesis und spontane Erkenntnisakte 10

15

20

25

30

Das Vergleichen als Tätigkeit („geistige Bewegung“) setzt ursprünglich voraus eine „ s in n li c h e “ G leic hhe i t oder Ähnlichkeit, ein in der Sinnlichkeit vor aller Einzelauffassung und Aufeinanderbeziehung Wirksames: Mehrere sich sinnlich abhebende (noch nicht für sich erfasste und konjunktiv zusammengefasste) Gegenstände fundieren sinnlich die Einheitsform der sinnlichen Ähnlichkeit oder Gleichheit, die sinnliche Gruppe. Dieses Sinnliche übt einen Reiz aus, es geht davon eine Tendenz aus, einzelne Erfassung und durchlaufende Zusammenhaltung zu üben. Doch hier haben wir offenbar an eine Gruppe ähnlicher Gegenstände in der Koexistenz gedacht. Die Durchlaufung ist ein sukzessiver Vorgang, was leistet sie? Wir gewinnen eine Sukzession von Erfassungen und eine Sukzession von Erfasstheiten; die herausgegriffenen, für sich erfassten Gegenstände als solche bilden eine Sukzession, die Gegenstände selbst verbleiben eventuell in der Koexistenz, sie dauern gleichzeitig. Was geschieht nun in diesem Übergehen von Einzelerfassung zu Einzelerfassung und in der Einstellung auf das Erfasste? Das schon vor dem Übergehen gewissermaßen betonte Fundament der Ähnlichkeit oder Gleichheit hier und dort und das schon vordem damit sich kontrastierende Unähnliche (das Differenzierende) hebt sich im Übergang für das Bemerken ab. Wir sagen, es „deckt“ sich das Gemeinsame, es scheidet sich das Differente. Es findet hier eine „geistige Überschiebung“ statt. 1

Herbst 1917. – Anm. der Hrsg.

292

5

10

15

20

25

30

35

explikative und prädikative synthesen

Wir können vielleicht sagen: In der Koexistenz ist Mannigfaltiges, und der aufmerkende Strahl des Ich geht in verschiedenen „Richtungen“, nämlich er geht bald auf dies, bald auf das in der Koexistenzsphäre und richtet sich auf Verschiedenes. Aber in sich hat der aufmerkende Strahl nur eine Richtung; er kann sich verdoppeln, vervielfältigen, er eignet das Ichfremde, das Sachliche, dem Ich zu, macht es zum Erfassten, und jede Mannigfaltigkeit der Erfassung bringt das Mannigfaltige, das ein Vertrautes war in der Ichentfremdung, zu einer Einheit, und diese ist nicht nur die Einheit des Zusammenlaufens von erfassenden „Strahlen“ im Ich, sondern eine ursprüngliche Synthesis der Sachen selbst. Es ist die S y nt h ese d er Ü be r s ch ieb u n g, welches ein Ausdruck ist, der den Wandel im Modus der Gegebenheitsweise ausdrückt und auch die eventuell erwachsende sachliche Synthese dynamisch bezeichnet. Gehen wir vom allgemeinsten Fall aus, dass zwei oder mehrere beliebige koexistente Gegenstände im Durchlaufen zur Einheit gebracht werden, so scheiden sich folgende Fälle: Die einzelnen und ursprünglich „auseinanderliegenden“ Sachen werden für das Ich sukzessiv, im Übergang von irgendeiner zur zweiten in eine Richtung gebracht, eben im Doppelstrahl der auf beide zugleich gerichteten Erfassung. Genauer: Das Ich wendet sich dem A zu, erfasst es (betrachtet es eventuell näher, was Durchlaufung von Momenten oder Teilen besagt und was Vielfältigkeiten hereinbringt, die zunächst außer Betracht bleiben mögen), geht zu B über, das soeben Erfasste noch im Griff behaltend. Es ist dabei in modifizierter Weise bewusst. Wir haben zwar, wenn A noch perzeptiv gegeben ist, A in gewisser Weise ursprünglich gegeben, aber nur ursprünglich vorgegeben und nicht im eigentlichen Sinn wahrgenommen. Zur Wahrnehmung im eigentlichen Sinn gehört, dass sie perceptio, Erfassung sei und das Objekt perceptum, und zwar haben wir auch in Hinsicht auf die Erfassung eine Originarität, eben die der eigentlichen perceptio, während das sekundär im Griff Behaltene (während primär ein anderes perceptum ist) schon ein Abfall der Originarität ist von der Ursprünglichkeit der perceptio als solcher. Ist B nun zum ursprünglich Perzipierten geworden, so tritt dieses, das also einen eigentümlichen Vorzug hat, mit dem Noch-Perzipierten in eine eigentümliche Synthese. Doch noch eins muss unterschieden werden: Statt Einzelnes zu perzipieren und im Übergang zu dem neu Perzipierten das soeben

text nr. 15

5

10

15

20

25

30

293

Perzipierte im Griff zu halten, kann ich es aus dem Griff lassen, während es doch noch bewusst (und sogar ursprünglich vorgegeben bleibt, da wir es mit dauernd koexistierend bewussten ursprünglichsinnlichen Daten zu tun haben) und noch in einer vorzüglichen Weise bewusst bleibt gegenüber derjenigen, wo keine Perzeption vorangegangen war. Das Aus-dem-Griff-sich-entgleiten-Lassen, das Esnicht-für-eine-Synthese-nützend-Festhalten ist in gewisser Weise trotzdem noch halten, noch in Händen haben, obschon nicht ergreifend mit dem Neuen zusammen begreifen. Der erste Fall ist der, dass neben „synthetisch-kategorialer“ Deckung, wenn wir so sagen wollen, die das Zusammengreifen einer Ich-Zueignung (das Zusammenhalten) ausmacht, eine ganz andersartige Deckung in den Sachen besteht und sich einstellt. Das ist so zu verstehen: Gleiches und Ähnliches im Zusammen der sinnlichen Koexistenz (innerhalb der bloßen Vorgegebenheit) schließen sich „sinnlich“ zusammen, rücken aneinander, verschmelzen sozusagen in verschiedenem Grad. Sie suchen sich gleichsam nach dem Maß ihrer Verwandtschaft, ziehen einander an und haben dadurch, dass sie (wie wir hinterher, nachdem wir schon Analyse vollzogen haben, es ausdrücken) Wesensgemeinschaft haben, schon eine Einheit, die in den Gleichheits- und Ähnlichkeitsmomenten wurzelt.1 Andererseits, korrelativ gesprochen, sie trennen sich, „fliehen“ sich nach dem Maß ihrer Differenzen, diese halten sie auseinander, bestimmen ihre Entfernung, oder hindern die Innigkeit der Einigung und Einigung überhaupt zur vollkommenen Einheit. Man ziehe hier ab, was bildlich ist in der Rede, und achte auf die Phänomene. In der ursprünglich sukzessiven Synthese des Zusammenhaltens, oder besser, des das Erste an das Zweite Haltens (eins an das andere Haltens), wandelt sich der Gegebenheitsmodus der sachlichen Einheit jener Verschmelzung und Nicht-Verschmelzung, der sachlichen Aneinandergebundenheit und Voneinandergesondertheit: Das Gleiche deckt sich mit dem Gleichen, in gewisser Weise auch das Ähnliche mit dem Ähnlichen, und das Differente hebt sich vom Differenten ab, und differiert von ihm. Doch das muss klarer beschrieben werden.

1 Aber ist dann „Maß der Verwandtschaft“ und „Grad des Sich-Suchens“ nicht Ausdruck für dieselbe Sache?

294

5

10

15

20

25

explikative und prädikative synthesen

a) Gleichheit: Erfasse ich A und gehe nun zu B über, so einigt sich das an B, was wir dem A Gleiches nennen, eben mit diesem derart, dass das betreffende Moment an B ausgezeichnet ist, abgehoben, und zwar „dadurch“, dass es das Entsprechende des A überdeckt und ohne jeden „Abstand“ überdeckt, völlig mit ihm eins und dasselbe ist (eins in besonderem Sinn) und, indem es das ist, durch das Verdeckende voll hindurch gesehen wird. Die geschiedene Zweiheit der A und B und auch ihres Gemeinsamen ist in eine Identitätseinheit übergegangen, die im Bewusstsein eine Doppelheit behält, aber sachlich keine Zweierleiheit und Zweiheit des „Außereinander“. Die beiden sind ineinander und nur sofern zwei. b) Ähnlichkeit: Ist dagegen das Verhältnis ein solches bloßer Ähnlichkeit, so besteht zwar auch Deckung, das betreffende und ursprünglich perzipierte B-Moment deckt auch das entsprechende im noch Bewussten gegebene A-Moment, aber das Ähnliche des A, das durch das Ähnliche des B hindurch gesehen wird und sich da mit ihm „deckt“, hat einen „Abstand“, es ist mit ihm „verschmolzen“ in einer Gemeinsamkeit, aber es bleibt eine Zweiheit auch der sachlichen Sonderung, die Sonderung und Überdeckung ist von „Verwandtem“, von „Ähnlichem“. Sie gehen nicht zusammen zu einem Gleichen, sondern zu einem Paar, wo das eine dem anderen „gleicht“, aber von ihm „absteht“. Man kann vielleicht sagen: Alles Koexistente hat, mag es sachlich noch so fremdartig aneinander sein, seine sinnliche Form des Zusammen. c) Und dann hätten wir noch einen dritten Fall,1 dass Heterogenes im Zusammenhalten zur Einheit gebracht wird. Dann blickt von dem einen durch das andere in ursprünglichster Perzeption Erfasste gar nichts durch, es deckt sich überhaupt nichts, die beiden haben nur die Synthesis des Zusammenhaltens, aber „sachlich haben sie miteinan-

1 Man könnte sagen: Das Negativum der Homogeneität, die Heterogeneität, ist nicht ein gleichstehender Fall. Heterogeneität tritt auf, wenn eine Intention auf Homogeneität vorangegangen war, als Enttäuschung: so wie auch im Vergleichen als Intendieren von Gleichheit Erfüllung eintreten kann. Heterogeneität ist danach als Negat bezogen auf Homogeneität und enthält das Motiv der Enttäuschung. Hinter der Erfüllung einer Intention auf Gleichheit liegt aber die sachliche Deckung als ein eigenes Verhältnis, demgegenüber Nicht-Deckung Privation ist.

text nr. 15

5

10

15

20

25

295

der nichts zu tun“, sie haben keinen Abstand, sie gleichen einander nicht. (Sie haben keine gemeinsamen inneren Prädikate, wie wir in weiterer Folge zu sagen hätten.) Doch fragt es sich, ob das nicht eine Übertreibung ist. Ob nicht alles Koexistente schließlich noch eine Gemeinsamkeit hat, auf der die sinnliche kollektive Einheit beruht, welche dann übergehen kann in eine synthetische Zusammenhaltung und „Vergleichung“. Aber wie, wenn wir von einem heterogenen Merkmal zu einem anderen übergehen und einen Gegenstand betrachtend durchlaufen „nach seinen heterogenen Bestimmungen“? Die bilden doch im Gegenstand nicht vorher eine kollektiv-sinnliche Einheit, sondern eine konkrete Einheit.1 2 Aber was immer die Motive sein mögen, die das Einzelauffassen bestimmen, im Übergehen finden keine Deckungen statt: abgesehen davon, dass jedes als Moment des Gegenstandes sich mit ihm als Einheit deckt (Partialdeckung), und jedes dann als Merkmal dieses selben Gegenstandes Gemeinschaft hat mit jedem anderen und insofern auch eine Deckung. Wo in der „Abstraktion“ jedes rein für sich herausgehoben wird, da gibt sich im Durchlaufen dieser Abstrakta jedes als ein Heterogenes, es hat mit dem anderen nichts zu tun, sie liegen völlig auseinander, sind einander inhaltlich fremd. (Das setzt Intention auf Gleichheit voraus, cf. Rand voriger Seite = S. 294, Anm. 1.3) Das Kolligieren als Zusammennehmen, Zusammenfassen von Einzelnen zu einer Mehrheit müssen wir scheiden von dem Auseinanderhalten, Aufeinanderbeziehen (als dem, was erst ein Bewusstsein der Beziehung schafft, aber es selbst noch nicht ist).4 Kolligiere

1 Das gehört nicht hierher. Wir sprechen doch von Ergebnissen der Zusammenhaltung auf dem Grund sinnlicher Ähnlichkeitsverbundenheit, der Einheit sinnlicher Ähnlichkeit. Hier aber ist die Einheit die eines abgehobenen Konkretums. 2 Man wird da sagen: Die Abhebung der Momente weist auf die Vergleichung und sinnliche Verbindung der Gleichheit etc. zurück. 3 Das führt also über die eigentümlichen Verhältnisse der Homogeneität hinaus. Das ist besonders zu betrachten. Die Verbindung der Momente ist hier hergestellt durch „Abstraktion“ oder vielmehr durch Ketten der Explikation desselben S, und die Momente haben etwas gemein in der Rückbeziehung auf dasselbe S. 4 Nein! Vgl. Rand folgende Seite = S. 296, Anm. 2. – Das Aneinanderhalten ist das allgemeine Aufeinanderbeziehen, es reicht also über das mögliche Erfassen von Gleichheiten und Ähnlichkeiten, die besondere Beziehungen sind, hinaus. Jedes ursprüngliche Erfassen von Beziehungen ist fundiert in einem Aneinanderhalten.

296

5

10

15

20

25

30

explikative und prädikative synthesen

ich, so erfasse ich A und gehe erfassend zu B über; sofern ich A festhalte, ist es allerdings auch an B gehalten. Und eben damit treten notwendig die Gleichheits- und Ähnlichkeitsdeckungen ein. Notwendig: Denn die zusammenhaltende Synthese bringt die Gleichen und Ähnlichen in eine geistige Lage, in der die sinnliche Gleichheits- und Ähnlichkeitsverschmelzung den Modus der Überdeckung annehmen muss. Sie projizieren sich dadurch hintereinander. Und so mit jedem Schritt von neuem. Man kann dabei fragen: Haben wir da nicht notwendig Überdeckungen zweiter, dritter … Stufe? Gewiss. Das Überdeckte verliert an Klarheit, wie ja immer das neu Erfasste den Vorzug der primären Klarheit, der höchsten, hat. So ähnlich wird es sich doch für jede Relation verhalten, die in den Zusammengehaltenen selbst und innerlich gründet, nur dass nicht dann statthat, was hier für die Verhältnisse der Homogeneität „Überdeckung“ heißt (oder sofern die betreffenden Verhältnisse in solcher fundiert sind, wie Steigerung: nicht bloß das statthat), dafür eigentümliche neue Eigenheiten. Das Allgemeine ist Überschiebung, in einen Strahl bringen. Das ist sozusagen ein mechanischer Prozess: Wesensmäßig tritt die Überdeckung mit der Zusammenhaltung und jeder neuen Zusammenhaltung ein, eine Wesensfolge, die keine Spontaneität mit sich führt. Nun kann aber mit der Zusammenhaltung sich verknüpfen ein neuer spontaner Prozess, der Prozess der eigentlichen Vergleichung und Unterscheidung, der Explikation, der Wesenserfassung, der Prädikation usw.1 Es kann aber das Zusammenhalten auch andere Zwecke haben. Ich durchlaufe und verbinde, um etwa eine Einheit einer Konfiguration bestimmt zu erfassen, die ich beziehen will auf eine andere. Nein, das eigentliche Zusammenhalten ist Tendenz auf die Einzelheiten. Jedenfalls müssen wir die mit dem Zusammenhalten sich verknüpfende intentionale Tendenz auf spontane „Erkenntnisakte“ (und zwar der „beziehenden“) von dem bloßen Zusammenhalten (und bloßen Kolligieren, das schrittweise umfassende Vielheiten explizierend konstituiert) unterscheiden. Der Begriff des Zusammenhaltens nimmt gewöhnlich schon diese Intention auf.2 1

Der Prozess der eigentlichen Beziehung (des Aufeinanderbeziehens), allgemeiner gesprochen. 2 Das ist, einen „Komplex“, eine mehrheitlich gegliederte Einheit als Komplex, als

text nr. 15

297

Zusammenhalten, konjunktiv zusammenfassen kann ich alles und jedes, aber zu einem Vergleichen wird es, wenn ich die Intention auf eine Gleichheit oder Ähnlichkeit habe bzw. die Intention darauf, ein Gemeinsames zu „suchen“. Im Eingang sagte ich aber, Verglei5 chen setze „sinnliche Ähnlichkeit“ schon voraus. Wie stimmt das? Ich kann auch bei heterogen sich Darbietendem den Ansatz einer Ähnlichkeit machen und zusehen, ob wirklich eine solche vorhanden ist. Ursprünglich aber motiviert nur eine schon vorhandene sinnliche Gleichheit als Einigungsart den Übergang in Einzeldurchlaufung und 10 in der Tendenz auf Heraushebung des Gemeinsamen.

§ 2. Die universelle Funktion von Identifikation und Prädikation. Identifizierende Synthesis als Quelle neuer relationeller Prädikation Vergleichen und „Beziehen“. Beziehen als ein Akt, in dem eine Beziehung, Relation zum Bewusstsein kommt. Jede Beziehung ist ein prädikabler „Sachverhalt“, aber nicht jeder prädikable Sachverhalt ist eine Beziehung in einem prägnanten Sinn; wir unterscheiden ja die Urteile in Relationsurteile, „a ist ς β“, und in Urteile wie „a ist α“, Eigenschaftsurteile; sie sagen eigenschaftliche Verhalte aus. Ich 20 müsste sagen: Relationen erster Stufe, Relation zwischen selbständigen Gegenständen. Selbständig fundierte Relationen wie Gleichheit, Ähnlichkeit, Steigerung weisen auf Verbindungen von gesonderten Gegenständen, auf zusammengesetzte Einheiten, Einheiten, die aus Einheiten, Gegenstände, die aus Gegenständen, und zwar disjunkten 25 Gegenständen in der Tat „zusammengesetzt“ sind, zurück. Sie liegen dem Beziehungsbewusstsein (in seiner Ursprünglichkeit) voran, und zwar so, dass die disjunkten Sondereinheiten, und nicht ihre Verbindung, die höhere Einheit, zum Thema wird, also den Reiz auf die 15

solche Einheit durchlaufen; sie ist das S, und es kommt als S zu beständiger Deckung (Identität) mit sich, während Schritt für Schritt ihre Glieder zur Sonderauffassung kommen und sie sich in ihren Gliedern bestimmt. Und es deckt sich dann Sm≡Sn≡Sp oder auch Sm = Smn = Smnp und in der Wiederholung Smnp = S(mnp)m etc. ganz wie bei jeder Explikation. Aber da liegt eben kein Zusammenhalten vor. Wir haben den Unterschied: Intention auf die Mehrheit als Einheit und Intention auf die Einzelheiten nach innen und nach außen.

298

5

10

15

20

25

30

35

explikative und prädikative synthesen

thematische Vergegenständlichung üben. Die Rede von Verbindung im Gegensatz zur Rede vom Ganzen weist schon auf die verbundenen Gegenstände primär hin, die Rede vom Ganzen weist hin auf Vergegenständlichung der verbundenen Einheit und freilich auch auf die Beziehung dieser Einheit zu den Sondereinheiten. Aber die Rede von Verbindung weist doch hin darauf, dass Gegenstände vereinigt sind, aber „verbunden“, das lenkt den Blick auf das Band, auf die „Form“, die Einheit herstellt. Die Rede vom Ganzen aber macht nicht die „Bänder“, die Verbindungsformen zum Thema, sondern den Gesamtgegenstand, der zwar Teilgegenstände in Verbindungsformen umspannt, aber diese sind nicht zu eigenen Gegenständen gemacht, wo das Ganze gegenständlich ist, in dessen Begriff also die Teile „enthalten“, aber nicht in der ursprünglichen Gegebenheit gegenständlich sind. Ein Relationsbewusstsein, wie Ähnlichkeit, Steigerung, hat, wiederhole ich, voranliegen eine Einheit der Verbindung, in der die Verbundenen zu thematischer Erfassung drängen, und das in der Art, dass die Verbundenen eben in ihrer Verbundenheit den Reiz üben, die Verbindung selbst also gehoben ist. Und nun erfolgt thematische Einzelerfassung, Übergang von dem einen zum anderen, Zusammenhaltung, gewissermaßen Projizieren der Glieder (und das kann nur paarweise statthaben) aufeinander. Im Hin- und Hergehen habe ich noch kein prädikatives Beziehen, sondern einen neuen Modus der Einheit, einen synthetischen Modus, in dem jedes Glied vermöge der Projizierung des Gegengliedes auf es selbst, bei der Ähnlichkeit vermöge der Ähnlichkeitsdeckung des Gemeinsamen und Nicht-Deckung, Scheiden des Geschiedenen, seinen synthetischen Zusammenhangscharakter hat. (Im nicht-synthetischen, im sinnlichen Verbundensein hat jedes seinen sinnlichen Zusammenhangscharakter.) Das A in diesem Zusammenhang kann nun zum Subjekt einer prädikativen Synthesis, das ist, einer Identitätssynthesis werden, ich „mache“ A zum Subjekt und erfasse an ihm identifizierend seinen Beschaffenheitscharakter, der ihm in diesem Zusammenhang mit B bzw. in der beziehenden Überschiebung zuwächst, und so habe ich A ist ς B; und in umgekehrter, korrelativer Richtung B ist ς´ A. Das gilt aber für alle „Relationen“, auch für räumliche Lagenrelationen, zeitliche Relationen, und so zunächst bei allen unmittelbaren und einfachen Relationen, die wir zunächst bevorzugen wollen.

text nr. 15

5

10

15

20

25

30

35

299

Die Prädikation geht auf die I st - Syn th e se, ein Gegenstand ist so und so beschaffen, er ist in seinen Beschaffenheiten, oder er ist in dem Beschaffensein, So-und-so-Beschaffensein. Ein Gegenstand ist „mit sich Identisches“. Ein sinnlicher Reiz ist kein Gegenstand, nur ein rezeptiv Gewordenes, aber ursprünglich in Ist-Synthese konstituierter Gegenstand ist im Hintergrund schon Gegenstand, aber eben im Modus der Rezeptivität. Was ist aber „mit sich Identisches“? Nichts anderes als Subjekt von Prädikaten, mögen sie prädizierte sein oder nicht (zu prädikativem Ausdruck kommen oder nicht). Das Prädikat als solches ist aber kein Subjekt, ist kein Gegenstand, es kann nur zum Gegenstand werden und ist dann kein Prädikat mehr (nominalisiertes Prädikat gegenüber Prädikat in Funktion). Die Ist-Synthese ist nicht eine Synthese, die Gegenstände mit Gegenständen verknüpft, sie stellt nicht eine Verknüpfung, Verbindung von Gegenständen her, nämlich eine Einheit des Bewusstsein, die in ihm Gegenstände verbindet (die als Gegenstand bewusst wären) oder Gegenstände „aufeinander bezieht“. Erst durch Vergegenständlichung (Nominalisierung) des Prädikats wird für das Bewusstsein ein Gegenstand konstituiert, und dann geht die Ist-Synthese über in eine Relation zwischen Gegenstand und Beschaffenheit. Die Abgehobenheit der Beschaffenheit und ihre Erfassung in der Weise des Prädikats ist nicht Abgehobenheit des Gegenstandes und Erfassung der Beschaffenheit als Gegenstand. Bedeutungslogisch: In der Relation (als relationellem Urteilsinhalt) haben wir zwei nominale Vorstellungen, und Beschaffenheiten treten in Relationen nur dadurch, dass sie vorher nominalisiert worden sind. Die nominalisierte weist in sich auf die nicht-nominalisierte, auf die adjektivische, auf die Prädikatform zurück. So setzt auch, wenn ein sinnliches Ähnlichkeits-Gleichheits-Phänomen vorlag, oder ein sonstiges Verbindungsphänomen, der Übergang in ein Kollektivum von Gegenständen, in ein Ganzes, in e i ne n G e g e ns ta nd, voraus eben „Vergegenständlichung“. In der Hinwendung und Erfassung liegt eine Modifikation des Bewusstseins; etwa wird jedes Glied für sich erfasst, es wird zu einem Seienden, indem es mit der Zuwendung betrachtet als dies und das und als selbiges Subjekt, mindest als Subjekt seiner Dauer, als dauernd-identisches und dann eventuell als jetzt so, jetzt anders seiend, oder im Hervortreten verschiedener Eigenschaften als solcher, mit denen es, dasselbe, dauert, als so be-

300

5

10

15

20

25

explikative und prädikative synthesen

schaffen und andererseits so (als rot, rund etc.) aufgefasst wird. D a s i st b est än d iger Vo ll z u g d es G ege nst an ds bew u ss ts e in s a l s S ub st rat b ew uss t sei n und als Subjektbewusstsein für Prädikate. Das Z us am m enh al t en setzt schon Gegenstände für das zusammenhaltende Bewusstsein voraus; und was im Zusammenhalten hervortritt, ist seinerseits damit noch nicht Gegenstand. Im Übergehen von einem zum anderen treten an jedem Beziehungsprädikate hervor, und jeder wird nun nicht nur zum möglichen Subjekt seiner eigenschaftlichen Prädikate, sondern auch dieser „äußeren“, relationellen Prädikate, und erst dann können diese wie andere Prädikate nominalisiert selbst zu Gegenständen werden. Prädikative Is t- S yn t h e se (in gewissem Sinn identifizierende, aber doch nicht im Sinn einer relationellen Synthese) ist also prinzipiell unterschieden von jeder r el at io nel le n S ynt h es e, das prädikative Bewusstsein ist nicht als solches beziehendes, obschon jedes beziehende Prädizieren eben Prädizieren ist.1 Es ist aber die Frage, ob diese Zurechtlegung, die gewiss Gutes enthält, doch in jeder Weise richtig ist. Das Prädikat sollte kein Gegenstand sein? Es ist freilich kein Subjekt, kein prädikatives Substrat, aber ist es darum kein Gegenstand? Vergegenständlichung heißt hier: zum prädikativen Substrat, zum Subjekt für Prädikate machen.2 Sage ich „Dieses Papier ist weiß“, so ist das „weiß“ zwar gegenständlich, aber es ist nicht ein Gegenstand, der Subjekt ist und als Subjekt bewusst ist. Sage ich „Dieses Papier hat Weiße“, so ist das „weiß“ nicht mehr bloß Prädikat, sondern der Gegenstand ist apperzipiert als Beschaffenheit; „weiß“ ist also Subjekt für ein Prädikat, wenn auch nur für das formal-allgemeine, Beschaffenheit zu sein. Und was hat das für eine Bedeutung in unserer Frage?

1

Einwand. Es ist hier zu bemerken: Es ist ein guter Begriff vo n G egen stan d , als Gegenstand im prägnanten Sinn, dieses them atisch es S u b strat zu sein (nominaler Gegenstand), aber auch ein guter Begriff, Thema überhaupt zu sein; Gegenstand ist freilich „mit sich Identisches“, aber auch das Prädikat (das eigenschaftliche oder relationelle) wird in wiederholtem Rückkehren darauf identifiziert, ohne nominal zu werden; und ebenso auch die ganze prädikative Synthese, das Ist und so alle Prädikationsformen, die eben die allgemeinsten „Gegenstands“formen sind. 2

text nr. 15

5

10

15

20

25

301

Einmal haben wir die Prädikation „x ist weiß“. Das andere Mal „x hat Weiße“, „hat die Beschaffenheit weiß“. Soll man so sagen: Nachdem ich die ursprüngliche prädikative Synthese vollzogen habe, kann ich „weiß“ zum Subjekt machen und es in dieser Synthese relationell bestimmt finden (nämlich an ihm das im Übergang zum x hervortretende Beziehungsprädikat finden): Es ist das α Beschaffenheit von x, es kommt das „weiß“ dem x zu; wie aber umgekehrt? Ich bin schon vorher von x zu α übergegangen und habe die identifizierende Synthese vollzogen. In dem Aneinanderhalten, das sich mit der Einzelauffassung x und der Einzelerfassung des α vollzog, erschien x prädikativ bestimmt und wurde x zum Subjekt des Prädikats. Dient nun diese Synthese dazu, wenn ich wieder x betrachte, dem x ein neues Prädikat zu verschaffen, ein Beziehungsprädikat? Jetzt heißt es nicht „x ist weiß“, sondern „ist Weiße habend“. X hat das Prädikat weiß. X ist nicht einfach Subjekt des Prädikats weiß, sondern Subjekt des Prädikats, das Prädikat weiß zu haben. (Natürlich lässt sich das in infinitum wiederholen.) Jede Relation, könnte man sagen, weist zurück auf eine Verbindung, auf eine Einheit von „Gegenständen“. Im besonderen Fall kann die Einheit eine Identitätseinheit sein, eine Einheit von Ganzem und Teil, und der Teil kann konkreter Teil und abstrakter Teil sein, was verschiedene Prädikationsformen ergibt. Jeder solchen Form entspricht eine Relation. Und Ganzes kann dabei beliebig weit genommen werden, auch eine bloße Kollektion, eine beliebige Verbindung kann als Ganzes gelten. Daher die universelle Funktion der Identifikation und Prädikation.

§ 3. Grundformen der Relationen und Sachverhalte Jede Relation weist zurück auf eine Verbindung, die aber nicht selbst identifizierende Verbindung, das ist Synthesis von Gegenstän30 den, sein muss; die Identifikation ist Verbindung, weist aber nicht selbst auf Verbindung notwendig zurück. Verbindung sagt hier Synthese. Der Teil, das Moment, das im Ganzen ist, ist in ihm, wenn das Ganze nicht von vornherein eine Synthese ist, sondern ein sinnliches Ganzes ist, „implicite“ enthalten, aber explicite ist die Synthesis der 35 Inexistenz erst konstituiert in der Prädikation bzw. Identifikation.

302

5

10

15

20

25

30

35

explikative und prädikative synthesen

Jede Identifikation als Synthese führt über in eine Relation, wenn die Relation hergestellt wird, oder jede führt über in eine neue relationelle Prädikation, wenn das Subjekt der Identifikation auf das mit ihm Identifizierte „bezogen“, das ist, wenn die in ihm vermöge der Synthese der Identifikation zuwachsende relationelle Bestimmtheit als Prädikat erfasst wird. Ist die Synthese eine nicht-identifizierende Synthese, wie eine Steigerungssynthese, eine Synthese der Ähnlichkeit oder Gleichheit, von Stücken eines physischen Ganzen usw., haben wir also Einheiten, die erst in Einzelerfassung ihrer Glieder, ihrer verbundenen Momente durchlaufen werden und im beziehenden Zusammenhalten aneinander gebracht werden, so gewinnen sie Verbindungsbestimmtheiten (jedes Glied bereichert sich so vermöge des Zusammenhangs), die nun in identifizierenden (prädikativen) Synthesen erfasst werden und eigene Identitätsformen ergeben: die relationellen. Jede Verbindung ist eine Quelle von relationellen Prädikationen, jede Prädikation ist eine neue Verbindung und selbst eine Quelle von relationellen Prädikationen. So sind Re l at io n und I d e n t i f i k a t i on (Prädikation) universelle Titel, allumfassend. Es scheiden sich: Relationen der ursprünglichen Verbindung (Verbundenheit), der „sinnlichen“, vor allen spontanen Synthesen stehenden; Relationen von ursprünglich Ganzem und Teil: dann aber auch für alle Verbindungen und alle, sei es auch spontan gewordenen Ganzen; Relationen der Ähnlichkeit mit der Grenze der Gleichheit (Unähnlichkeit, Ungleichheit); Relationen der St um p f’schen Verschmelzung; Relationen zwischen Individuum und Spezies; Relationen zwischen Gattung und Art. (Wie steht das zu Ganzem und Teil?) Aber das ist ein Nebeneinander-Nennen und keine Einteilung und kein inneres Verständnis. Eine wichtige Frage ist: Welche Rolle spielt Gleichheit und Ähnlichkeit für die Ermöglichung anderer Relationen? St e i ge r un g z. B. ist nicht selbst eine Ähnlichkeitsrelation, aber der Zusammenhang ist klar. Jede Ähnlichkeit führt als solche in Steigerungsreihen größerer oder geringerer Ähnlichkeit. Andererseits, Töne z. B. sind nicht nur mehr oder minder ähnlich, sie stehen auch im Verhältnis der Intensitätssteigerung, das voraussetzt, dass es sich eben um Töne handelt, die als solche einer und derselben Gattung sind, also ähnlich. Die Intensität nennen wir ein Moment, und sie hat ihre Gradualität, die Ähnlichkeit ist, aber eine besondere Form der Ähnlichkeit ist: Von

text nr. 15

5

10

15

20

25

30

35

303

einem beliebigen Intensitätspunkt ausgehend, können wir (nach zwei Seiten) von größerer oder geringerer Ähnlichkeit sprechen. Aber es gibt auch ein Zweites. Gleich Ähnliches zu dem gewählten Punkt steht in einem besonderen Verhältnis des „minder intensiv – mehr intensiv“ gegenüber diesem Punkt. Und dieses Moment der Intensität, das für sich diese eigentümliche Ähnlichkeitsreihe bildet, setzt voraus die Qualität Ton und eine andere unter diesem Titel stehende Ähnlichkeitsmannigfaltigkeit. Also i n m eh rf a che r W ei se s et z t h i er St e ige run g Äh nl i c h k eit v or aus : in der einen, weil Intensität Qualität voraussetzt, in der anderen, weil Intensität selbst ein Ähnlichkeitsgebiet ist. Räumliche Relationen: Das Räumliche als solches, ebenso Zeitliches als solches, ist homogen. Das Räumliche steht in räumlichen Relationen vermöge der spezifischen Raumbestimmtheiten, ebenso das Zeitliche; und dieses Fundiertsein ist Fundiertsein in Ähnlichkeiten. Man wird also daran denken müssen, von „Relationen der Homogeneität“ zu sprechen, als welche Ähnlichkeit voraussetzen. Aber da ist viel zu überlegen. Relation setzt Verbindung voraus. Kann sachlich „Beziehungsloses“, „Unzusammengehöriges“, also schließlich doch Inhomogenes verbunden sein? Verbundensein ist äquivalent mit Ganzes-Sein; Teile eines Ganzen müssen doch miteinander etwas zu tun haben. Schließlich können wir wohl Beliebiges kolligieren, aber ergibt diese Verbindung auch eine Relation? Nun ja, die eben durch diese „Verbindung“ gestiftete, das „kolligiert mit B sein“, „kollektiv Glied dieser Menge sein“. Das ist also eine ähnlich gestiftete Relation wie die durch eine prädikative Synthesis gestiftete. Und wir bemerken, dass da wieder Ähnlichkeit eine Rolle spielt. Alle kolligierten Glieder haben das „miteinander gemein“, dass sie das sind. Alle Eigenschaften eines Gegenstandes haben das miteinander gemein, dass sie das sind. Wir müssen nun aber sa c hl i ch e Ge me in s a mk e i t, eigene innere Ähnlichkeit und Gleichheit (die vor aller aktiven Synthese liegt) scheiden von der f o rm a l e n Ge me i ns a mk e i t, die gestiftet ist durch die formalen, durch die universellen formalen Synthesen, die F un kti o n en d e r l o g is c he n V e r kn üp f un g. Das sachhaltig Gemeinsame bestimmt die eigentliche Homogeneität, und wir haben eine Klasse von Relationen, die in der Homogeneität gründen. Und dann haben wir alle kategorialen Relationen, die in den kategorialen

304

5

10

15

20

25

30

explikative und prädikative synthesen

Formen gründen und wieder auf Ähnlichkeit zurückweisen, auf die Homogeneität der Form als Form. Allem Beziehen liegt zugrunde Verbindung, und Verbindung ist Verbindung von irgend Zusammengehörigen, sich als ähnlich durch Gemeinsamkeit abhebend. Teile von Ganzen kann ich erst aufeinander beziehen, wenn ich sie ausgeschieden habe, und in der Ausgeschiedenheit haben sie Verbindung, sie haben etwas gemein, was sie einheitlich abhebt, was ihnen Gemeinsamkeit gibt, und das kann ein Formales oder Materiales sein. Das alles ist für eine verständige Relationstheorie grundlegend, und es fragt sich nun, wie wir die Scheidung von material und formal fruchtbar machen, und wie wir nun die Relationen nach Hauptgruppen unter diesen Titeln wieder sondern sollen. Im F o rm a le n, und das heißt hier wohl, i m G e b ie t d er dur c h S po n ta ne it ä t „ g e s t i f t e t e n “ Ei n he it e n, müssen alle ontologischen Kategorien ihre Anwendung finden, die logischen Abwandlungen eines Gegenstandes überhaupt als Substrats überhaupt. Zunächst die F o r m G a n z e s, als Verbundenheit von Teilen, die im Ganzen als disjunkte enthalten sind. Die I ne xi s te nz des Teils soll zunächst besagen I ne x i s t e n z r e la t iv s elb st än di g er , u nm i tt el ba r e r T e i l e, dann diejenige mittelbarer Teile. Relationen der Stücke eines Ganzen, der konkreten Inexistenz, Relationen der Momente eines Ganzen, der abstraktiven Inexistenz, Relationen der Ähnlichkeit und Gleichheit, Relationen der Gattung und Art.1 Welche mögliche Arten der Inexistenz und Ko-Inexistenz gibt es? Sind die logischen Kategorien nicht die Ist-Kategorien, die Kategorien der Inexistenz bzw. der I de n t i t ät, der Gegenständlichkeit als des mit sich Identischen als solchen? Heißt also „eine Relationstheorie aufstellen“ nicht, eine Theorie der prädikativen Relationen oder prädikativen Kategorien aufstellen? Ich rede da recht ungeschickt. Aber die Sache muss eben besser durchüberlegt werden.

1

Relationen des Enthaltenden und Enthaltenen, des Ganzen zum Teil, des Teils, der enthaltender ist, zum enthaltenen Moment oder Teil, des Ganzen zur Form des Ganzen.

text nr. 15

5

10

15

20

25

30

35

305

Der Gegenstand ist das Identische, er ist das mögliche i de nt i s ch e Su bs tr at von Ex pli ka t io n en b z w . f ü r In e xi st en ze n. Er birgt in sich mögliche Stücke, mögliche Momente verschiedener Stufe, Momente, die ihm unmittelbar zu eigen sind, und Momente, die Momente seiner Stücke sind. Und wieder, er birgt in sich die Verbindungs-FormMomente, die ihm eigen sind, sofern sie in den Stücken oder sonstigen Inexistenzen fundiert sind. Wir explizieren und vollziehen die Synthesen der Identifikation, die verschiedenen Ist-Synthesen. Im Vollzug der synthetischen Akte konstituieren sich Sachverhalte als Ist-Verhalte. Die konstituierten Sachverhalte können wieder zu „Gegenständen“ werden, wieder expliziert werden, neue Ist-Synthesen können erzeugt, neue Sachverhalte bewusst, dann wieder gegenständlich werden usw. Wir unterscheiden da die S y nt h ese n e r st er St uf e, in denen sich die ersten Gegenstände logisch explizieren, und die Sy nt he s e n hö h e r e r St u f e, in denen die immer neu gewonnenen Sachverhalte zur Explikation kommen. Wir können auch sagen, allem voran liegen letztlich Gegenstände unterster Stufe, die nicht Sachverhalte sind, und die sind Substrate der ersten sie explizierenden Sachverhalte. Die Frage ist dann die nach den Vorkommnissen (nach den Grundformen) dieser ersten Sachverhalte (die also keine Sachverhalte zu Substraten haben) und nach den Prädikaten, die solchen Gegenständen a priori zukommen können in diesen Sachverhalten (als den prädikativen Inhalten). Die Synthesen weisen auf das zurück, was vor ihnen liegt: Phänomenologisch hat das noch Unexplizierte sein Wesen, das eine Reihe von Modifikationen der Gegebenheitsweise erfährt, sofern es eben in Explikation tritt und seinem unexplizierten Wesen nach treten kann. Das ist, als Identisches vor der Explikation ist es Substrat idealer Möglichkeiten, die Gegebenheitswandlungen zu erleiden, die wir Explikationen und prädikative Synthesen nennen können, und diese Wandlungen durchlaufend, ist es doch „dasselbe“. Es kann dabei 1) eigentliche Explikation, Auseinanderlegung des in ihm Seienden, dessen, was es in sich selbst ist, erfahren: innere Prädikate. Es kann 2) als Glied in Verbindung eintreten mit anderem, was eventuell nur zufällig mit da ist, aber nicht notwendig mit da sein muss. Es bildet mit anderem relativ zu ihm Selbständigen ein Verbindungsganzes. Oder es ist unselbständiger Teil eines solchen, das nur „abstrakt“ für sich

306

5

10

15

20

25

30

explikative und prädikative synthesen

genommen worden ist, und wird nun in synthetische Beziehung zu diesem Ganzen gesetzt, wobei aber die Einigkeit vor der Synthese (dem spontanen In-Beziehung-Setzen) schon vorhanden ist, vor den betreffenden Sachverhalten und ihrer aktuellen Konstitution. Ferner kann die Verbindung selbst zum Thema werden. Nicht das Verbundene, und was ihm daraus zuwächst, das relative Prädikat, sondern die Verbindung oder das Zusammen der Verbundenen als kollektives Zusammen und als Inbegriffsträger der Verbindung. 1) Innere Prädikate eines Gegenstandes; 2) äußere Prädikate; 3) ein Gegenstand als Mitglied mit anderen Gegenständen zusammen (als seinen Mitgliedern) gefasst innerhalb eines Ganzen, nicht als zu ihnen in den betreffenden Relationen stehend, die aus der Verbindung jedem zuwachsen, sondern a l s S ub s tr a te ei ne r Ve rbi nd un g s f o r m, z. B. diese Kugeln bilden einen Haufen, eine Sternfigur, diese Töne bilden eine Melodie etc. Das ist nicht Relation von Teil zum Ganzen, sondern zur Form (die Form habend und dann Teil eines Ganzen dieser Form seiend).1 Wir haben also: äußere und innere Prädikate, oder 1) EigenschaftsVerhalte, 2) relationelle Sachverhalte, 3) G enthält (hat) γ, das Ganze enthält den Teil, der Teil ist im Ganzen. 4) Der Inbegriff Σγ ist einig in der Form G; die Form umfasst in der Art G die Σγ. Ad 1) Verhältnis von Konkretum zu unmittelbarem Moment oder zu Art und Gattung, Verhältnis von Art zu Gattung etc., Verhältnis des Koordinierten zueinander. (Jedenfalls die Lehre von „Ganzen und Teilen“ bedarf genauester Ausführung, neuer Erwägung und ist das Fundament.) Und die Identität eines Gegenstandes in mannigfaltigen Gegebenheitsweisen, die Identität eines individuellen Gegenstandes in seiner Dauer, in verschiedenen Strecken seiner Zeit. Jede Einheit der Identität als Korrelat eines Einheitsbewusstseins ist überführbar in Synthesen der Identifikation. A ist dasselbe wie A, nämlich das in der Gegebenheitsweise Aα Gegebene identisch mit dem Aβ; also die eigene Gruppe der Identitätsverhalte.

Wir können bilden das plurale Urteil γ1, γ2 … sind in G, sind Teil von G. Aber ein anderes ist: Der Inbegriff der γ1, γ2 … ist verbundener zu diesem Ganzen, die γ sind zu diesem Ganzen verbunden, sie sind Mitglieder. 1

beilage xxi

307

Vorprädikativ. Dauereinheit eines Dauernden, kontinuierlich einig, ohne Absatz oder mit Abhebungen einzelner Stücke der Dauer. Das Dauernde selbst für sich abgehoben. Mehrere solche „Gegenstände“ einig in der Form des Gleichzeitig 5 oder Nacheinander, ferner des Nebeneinander in der Koexistenz, und zwar räumlich. Mehrere Gegenstände inhaltlich (nach Inhalt des Dauernden) ähnlich oder gleich, wobei die Dauer mit zum Bestand gehört und „mitwirkt“. Sinnliche Ähnlichkeit als eine Verbindung. Einheit der Abhebung: ursprüngliche Abhebung und nicht ursprüng10 liche, schon auf diskrete Gleichheit oder Identität zurückweisend. In der ursprünglichen die kontinuierliche Identifizierung der Dauer. Können nicht auch zugleich sich abheben oder auch im Nacheinander (ohne aktive Synthese) Ganzes und Teil? Dann hätten wir diese Partialdeckung schon vor der Synthese und Beziehung. Abhebung einer 15 Verbindungsform durch diskrete sinnliche Verbindung der Gleichheit. Alle prädikativen Synthesen weisen zurück auf vorprädikative Einheiten und auf eine „sinnliche Gleichheit“ zur Ermöglichung der Einheit des sich Abhebenden.

Beilage XXI Die verschiedenen Begriffe von Relationsfundament bei den Gleichheits- und Ähnlichkeitsrelationen1

20

Gleichheit und Ähnlichkeit sind „Relationen“; sie „gründen“ in den „Beziehungspunkten“, die insofern die Beziehungsfundamente sind.2 Die Ähnlichkeit gründet im Ähnlichen. Was dieses „gründen“ besagt, tritt hervor 25 in der im Zusammenhalten der „ähnlich“ genannten und als ähnlich nachher charakterisierten (begrifflich bestimmten) Gegenstände. An ihnen tritt das ihre Ähnlichkeit Begründende hervor als Moment ihres Wesens oder als ihr Wesen im Ganzen. Im einen Fall sind die Gegenstände ähnlich um der Ähnlichkeitsmomente (der primär und eigentlich ähnlichen, aber so nicht 30 genannten Momente) willen. Im anderen Fall sind sie ähnlich um ihrer selbst, oder vielmehr um ihres vollen eigenen Wesens willen. Oder noch deutlicher: Die Ähnlichkeit (und Gleichheit) hat ihr Gründendes, und das ist das ganze Wesen, die volle Konkretion, oder es ist ein bloßes 1 2

Herbst 1917. – Anm. der Hrsg. Erster Begriff von Relationsfundament.

308

5

10

15

20

25

explikative und prädikative synthesen

Moment dieser Konkretion, ein Wesensmoment da und dort. Im ersteren Fall sind die Gegenstände selbst ähnlich, ähnlich im Ganzen, das andere Mal sind die Gegenstände bloß in einer gewissen „Hinsicht“ und um ihrer Art willen ähnlich. Das eine weist auf „konkrete Begriffe“, auf konkrete Gattung, Art und niederste Differenz (aus zu erörternden Gründen nicht auf die individuelle Differenz) hin, das andere auf „abstrakte Begriffe“, auf eigenschaftliche Gattungen, Arten, niederste Differenzen hin. Es ist aber noch, ehe wir weitergehen, zu erörtern ein anderer Begriff vom fundamentum relationis. Die Fundamente im bisherigen Sinn sind nicht etwa die Beziehungsglieder selbst, sondern die ihnen zugehörigen Wesenheiten (Washeiten), im Ganzen oder nach Momenten. Jede1 Relation und so jede Ähnlichkeits- oder Gleichheitsbeziehung, wie wir hier zu sagen haben, weist zurück auf einen vorgegebenen oder vorzugebenden sinnlichen Ähnlichkeitszusammenhang.2 Halten wir a und b zusammen, so ist, je nachdem wir beziehend a oder b zum „Subjekt“Glied machen, a ähnlich b oder b ähnlich a (und so bei allen Relationen a > b, b < a etc.). In diesem beziehenden Bewusstsein ist das Korrelat die „Beziehung“ als das „Verhältnis“, und wir haben notwendig zwei korrelativ zusammengehörige Verhältnisse. Beiden liegt aber zugrunde das Vorgegebene und auch während der spontanen Denkaktion zugrunde liegend Bleibende und identisch Verbleibende (sinnliche Ähnlichkeitszusammenhänge oder überhaupt Zusammenhänge), und auch dieses kann als fundamentum relationis bezeichnet werden.3 Dieses fundamentum gibt einen Begriff von identischer „Sachlage“ gegenüber der Weise seiner Gegebenheit im Denken. a > b und b < a besagen „sachlich“ dasselbe, dieselbe Sache nur in zwei Verhältnissen gedacht. Besser: Wir haben zwei Denkgegenstände, zwei Denkverhalte, Urteilsverhalte und die „Sache selbst“, der Sachverhalt ist derselbe. Das ist ein Begriff von Sachverhalt.4

1

Zweiter Begriff von Relationsfundament. Das gilt doch allgemeiner: warum Ähnlichkeitszusammenhang? Es gilt doch auch für gestiftete Verbindungen. 3 Die ausdrückende begriffliche Fassung, als das ausdrückende Bedeuten, ist eine höhere Schicht über dem im Beziehen sich konstituierenden Sachverhalt. „Denken“ ist zweideutig. 4 Auch zwei Sätze, wobei wir scheiden müssen die gesetzten Verhalte (Sachverhalte im zweiten Sinne) und die Aussagesätze, die „begrifflich gefassten“. 2

beilage xxii Beilage XXII Der Unterschied zwischen den Beziehungen der Verträglichkeit und Unverträglichkeit einerseits und denjenigen der Gleichheit und Verschiedenheit andererseits: Ersteren liegt eine gestiftete Einheit zwischen Ansatzintention und Erfüllung bzw. Enttäuschung, Letzteren eine sinnliche Einheit zugrunde1

5

10

15

20

25

30

35

309

U n v e r t r ä g l ic hk e it. Rot und Grün sind unverträglich als sich über dieselbe Ausdehnung in derselben Zeit ausdehnende (in der immanenten Sphäre ausbreitende) Qualia. Das Verhältnis konstituiert sich also in der Art, dass wir beginnen, den „An s a t z“, irgendetwas sei rot und grün „zugleich“ (örtlichzeitlich) oder eine Ausbreitung sei mit Rot und Grün zugleich, und zwar in entsprechender Verteilung, erfüllt, zur Realisierung zu bringen, das ist, in der Erfüllungsintention gehen wir über zur Ausfüllung einer Ausbreitung (überhaupt) mit Rot und haben dann eine rote Ausbreitung (überhaupt);2 dann aber in der Anmalung sozusagen der als identisch festgehaltenen Ausbreitung mit Grün tritt das Vorkommnis ein: Das Grün hebt das Rot auf, wie in umgekehrter Richtung das Rot das Grün. Und diese Aufhebung gehört ins „überhaupt“. Andererseits: Rot und kreisförmig sind verträglich. Eine einheitliche Anschauung, die etwas als rot und kreisförmig ergibt, ist „m ö gl ic h“.3 Ist danach nicht Unverträglichkeit und Verträglichkeit in einer ganz anderen Linie gelegen als Gleichheit und Verschiedenheit? Hier hätten wir einen vorgestellten sinnlichen Zusammenhang, der übergeführt wird in ein „beziehendes“ Bewusstsein. Bei der Unverträglichkeit aber haben wir den Übergang eines „Ansatzes“, eines synthetischen „Gedankens“, in die „erfüllende Anschauung“. Dieser Übergang mit seinen zwei typischen Vorkommnissen schafft selbst eine Einheit zwischen Ansetzungsintention und Erfüllung. Diese Einheit liegt zugrunde als fundamentum relationis, wenn wir eben vom Verhältnis zwischen Intention und Erfüllung oder zwischen Ansatz und Wirklichkeit oder zwischen Ansatz und Möglichkeit oder Unmöglichkeit sprechen. Je nachdem wir es mit einem „Urteil“ oder einem als α und β oder sonst wie bestimmten Gegenstand (als das im Denken Angesetzte) zu tun haben und seinem möglichen Sein. Und von da aus kann der Blick sich richten auf die

1 2 3

Herbst 1917. – Anm. der Hrsg. Das „überhaupt“ kann zunächst unterbleiben. Cf. übrigens die Entwürfe zu „Logische Untersuchung VI“ vgl. Husserliana XX/1.

310

explikative und prädikative synthesen

angesetzten Bestimmungen, die hier ihren mitbestimmten Zusammenhang haben, und ihre Einheit im Ansatz steht da in einer Zusammenhangsbeziehung zu ihrer Einheit in der Erfüllung oder „Enttäuschung“ bzw. in ihrer Einigkeit oder Uneinigkeit. Das sind wieder Deckungsverhältnisse. Wir sehen aber den Unterschied. Einmal geht der Beziehung voraus die 5 sinnliche Einheit, die Einheit, die vor aller Spontaneität der Akte liegt, das andere Mal wird eine E in h ei t „ g e st i f te t “ durch solche Akte, und die gestiftete Einheit ist selbst die Unterlage für ein neues „Beziehen“. Wird das aufs Genaueste studiert, so gewinnen wir eine P h än o m en o lo 10 g i e d e s „ B e z i e h e n s “ und des beziehenden „Denkens“, der „gedanklichen“ und ausdrücklichen Sphäre. Und von da aus eine „U r te il st h eo r ie“ nach ihrem wesentlichsten Stück, ja die ganze, sofern wir auf die „Qualitäten“ Rücksicht nehmen und nehmen müssen.

III. ZUR ANALYSE DER STELLUNGNAHMEN IN IHREN MODI UND FUNDIERUNGEN

Nr. 16  D ie V e rh ä l tn i s se zw ische n Er s che inun g , b el ief u n d S e t zu ng i m H i nbli ck a uf di e dre ig l i e d ri g e S tr uk tu r de s Bew uss tsei ns 1

5

§ 1. Setzung und Substrat. Schlichte und explikative Setzung. Die funktionelle Abhängigkeit der auf dem Grund einer Erscheinung zu vollziehenden Setzungen voneinander

10

Je d e S et zun g fo rde r t i hr S ub s tr at; zum Beispiel, wir betrachten einen Gegenstand aufgrund der Wahrnehmung oder Erinnerung, vollziehen dabei Explikationen, Beziehungen, synthetischprädikative Akte. Schritt für Schritt haben wir dabei Setzung und 15 Substrat der Setzung zu unterscheiden. Für die schlichte Setzung als Gegenstandserfassung fungiert als Substrat die Wahrnehmung (die bloße Wahrnehmung), die, während ich einen anderen Gegenstand setze, schon als Umgebungswahrnehmung ihre Abhebung und im Großen und Ganzen denselben Inhalt und Charakter haben möchte. 20 Kann nicht dieselbe Wahrnehmung Substrate abgeben für verschiedene Setzungen, für verschiedene Erfassungen? Ich kann meine Aufmerksamkeit richten auf und mir zur Erfassung bringen das „Sehding“, richten auf das „Erscheinende, so wie es erscheint“; die Wahrnehmung ist dabei dieselbe, die als Unterlage 25 fungiert. Ich kann auch speziell auf die Farbe achten, die Form etc.

1

Wohl Oktober 1911.

© Springer Nature Switzerland AG 2020 311 U. Melle, T. Vongehr (Hrsg.), Studien zur Struktur des Bewusstseins, Husserliana: Edmund Husserl – Gesammelte Werke 43-I, https://doi.org/10.1007/978-3-030-35788-7_3

312

5

10

15

20

25

30

zur analyse der stellungnahmen

Indem ich sie erfasse, liegt dieselbe Wahrnehmung (nicht Setzung) immerfort zugrunde, derselbe „apparenziale“ Akt. Freilich, indem ich explikativ die Farbe heraushebe, hebe ich damit auch eine partiale Erscheinung, wenn auch eine unselbständige, heraus, und die ist das unmittelbare Substrat. Aber dieses ist unselbständig und fordert eine Gesamterscheinung; jedenfalls liegt diese, wenn nicht notwendig, so praktisch auch bei der Erfassung eines Gliedes zugrunde. (Man wird aber darauf aufmerksam machen können, dass dieses Glied da, so wie es da bewusstseinsmäßig konstituiert ist, eben Glied ist und in seiner Besonderheit dadurch mitbestimmt ist, dass es von der Erscheinung des Ganzen explikativ abgehoben ist.) Da s S u bst r at i st nat ür li c h n ic h t z u v er we c h sel n mi t A kt ma t e r i e. Im Wesen des als Substrat fungierenden apparenzialen Erlebnisses (der qualifizierten Erscheinung – freilich keiner Spontaneität, sondern einer Passivität, einer Zuständlichkeit) gründen verschiedene apriorische Möglichkeiten der s c hl ic ht se tzen d en , e x pl i ka t i v s e t z e n de n , z usa m m e ns et zen de n, bez i e hen d en „ M e i nu n g “, und jedem solchen Unterschied entsprechend haben wir verschiedene „me i ne nd e A k t e“ mit verschiedenem Sinn und verschiedener Gegenständlichkeit.1 I n d e r A p p a r e nz s i nd ma n n ig f a lt ige G e ge ns tä n dl ic hk ei t e n „ v e rb or g e n “; s i e w e r de n „ o ff e n ba r“ d ur c h K ons ti t ut i on v on o b j e k t i v i er e n de n Me i nu n g en, und teils sind diese Gegenständlichkeiten durch schlichte Erfassung oder durch Explikation zu Gegenständen im prägnanten Sinn zu machen. Jede Apparenz kann also 1) Substrat einer schlichten Zuwendung werden, die einen Gegenstand schlicht erfasst: den Gegenstand, von dem es heißt, dass er in der betreffenden Erscheinung erscheint; 2) kann die Apparenz Grundlage von explikativen Erfassungen werden, durch welche Gegenstände zu Erfassung kommen, die da Teile und Momente des erscheinenden Gegenstandes heißen. Natürlich in anderer Richtung liegen die Erfassungen auf dem Grund des inneren Bewusstseins, des Erlebnisses selbst, der Erscheinung als inneres Erlebnis, wobei

1

Dann ist aber „Meinung“ ein bestimmter Modus, den jedes intentionale Erlebnis annehmen kann, und in diesem Modus heißt das Erlebnis ein intentionales im prägnanten Sinn, ein patent intentionales, ein vollzogenes etc.

text nr. 16

5

10

15

20

25

30

313

die Erscheinung immerfort bewusst, aber nicht selbst das Substrat ist, vielmehr das innere Bewusstsein von der Erscheinung. 3) Ein Problem ist es, wie es sich mit Gegenständlichkeiten der Art wie Phantom, okulomotorisch Erscheinendes als solches, Sehding in verschiedenem Sinn gegenüber dem vollen Ding und wieder dem Ding in verschiedener Interpretation als sinnliches Ding, physikalisches Ding etc. verhält. Weiter kommen dann aber die au fgru n d de rs el be n E rs ch ein ung a l s U n t er lag e zu k o n st it u ieren d en Sa ch ve rh al t e, wobei bald der Gegenstand der Erscheinung, bald einzelne seiner Teile oder Momente zu Gegenständen-worüber werden, eventuell dann in der Rückwendung aber auch solche Sachverhalte selbst. (Dann aber haben wir wohl von Substraten höherer Stufe zu sprechen?) Es kann eventuell eine Einheit der Erfassung mehrere Substrate haben, sofern mehrere Erscheinungen einer solchen Einheit zugrunde liegen; dann kann die Mehrheit selbst zum pluralen Subjekt eines Sachverhalts werden usw. Das ist also ein wichtiges Studium, di e s e Ar t w i e „ M ei nu ng“ , w i e s c hl i ch te Z u we n du n g u n d E r f ass ung u nd pr ä di ka tiv be z i e he n d e M e in u n g a us un t e rl iegend en Z ust ä nd l ic hk ei t e n i hr e M ög l i c h ke i t e n , di e Q u el le n ih re r Si n ng ebu ng u n d A k t m a t e r ie s c höp fe n. Die „S e t z un g“ ist es, durch die erst g e g e n st ä nd l ic h e Be z i e hu ng i m a kt ue l le n Si n n konstituiert ist, aber Setzung ist darin gebunden an das Substrat. Es baut sich schlichte Setzung auf neue Setzung, und mit der Setzung geht Formung Hand in Hand, eine Formung, welche die Form des „Sachverhalts“, darin des Subjekts, des Prädikats etc. konstituiert. Aber das alles sind leere Formen, die Konkretion, Gehalt durch das Substrat und die Weise, wie es da fungiert, gewinnen. Offenbar sind die verschiedenen, auf dem Grund einer Erscheinung (einer Apparenz) zu vollziehenden Setzungen miteinander verflochten bzw. in ihren Möglichkeiten voneinander, insbesondere in der Richtung vom schlichten zum beziehenden Meinen, funktionell abhängig.

314

zur analyse der stellungnahmen § 2. Inwiefern Unterschiede der Auffassungsform und der belief-Charaktere den Erscheinungen vor der Zuwendung angehören können

5

10

15

20

25

30

35

Es ist ferner zu bemerken, dass wir schon in den Apparenzen belief-Modalitäten derselben Gattung finden wie in den Meinungen und dass die „Qualitäten“ in der Stufe des Meinens abhängig sind von denjenigen in der Stufe des Substrats. Freilich liegen hier nicht geringe Schwierigkeiten. Als Substrate können fungieren Wahrnehmungen, Erinnerungen (Gegenwärtigungen, Vergegenwärtigungen), Retentionen, Bilderscheinungen, Phantasien, Zeichenerscheinungen (signitive Vorstellungen) oder besser gruppiert: Erscheinungen, die den Charakter der Aktualität haben und dabei die verschiedenen Modi der Impression und Reproduktion oder den Modus der Inaktualität (gedankenhafte Modifikation, Anaxiose). Was im ersten Fall die „Modalitäten“ des belief anlangt, so können es sein: Charaktere der Wirklichkeit (als belief-Charaktere), und zwar Gewissheit oder Ungewissheit, Schwanken, auch Nichtigkeitscharaktere. Muss man nun nicht sagen, dass alle diese Unterschiede der Auffassungsform und auch d i e „be l i e f“- C h ar a kt er e d en E r sc he i nu n g e n s c h on v or d e r Zu we n du n g zu ge hör e n kö nne n ? Und sie verteilen sich über die einheitlichen Erscheinungszusammenhänge in verschiedener Weise, dabei voneinander Abhängigkeit zeigend. So ist das Bildbewusstsein, der Auffassungscharakter der Bildlichkeit, abhängig davon, dass eine wirkliche Welt ausgezeichnet ist, gegenüber der die Bildwelt ihre Weise der Kontrastierung hat usw. Freilich erscheint es kühn, dass wir solche Unterschiede nicht erst im klaren Licht der „Zuwendung“ sich konstituieren lassen, sondern schon dem unerleuchteten Bewusstsein, dem dunklen Gebiet des nicht aufmerksam Erfassten zuschreiben wollen. Das ist das Thema für eine durchaus notwendige und sehr wichtige Untersuchung. Zunächst, der Unterschied zwischen Impression und Reproduktion kann doch unmöglich als ein erst in der Zuwendung sich konstituierender angesehen werden. Wie steht es dann etwa mit dem Unterschied zwischen bloßer Phantasie und Erinnerung? Und wir haben dabei eine reproduktive Apparenz, einmal im Charakter der

text nr. 16

5

10

15

20

25

30

315

Erinnerung, also qualifiziert als seiend und in der Auffassung gewesen, das andere Mal ohne Beziehung zum aktuellen Jetzt und im Charakter des Nichts. Wie ist es schon mit der Apparenz selbst? Kommt sie erst in der Zuwendung zustande und sind vor ihr bloß „Phantasmen“ ohne Auffassung? Oder ist bald das eine, bald das andere der Fall? Sollte nicht eine Phantasieerscheinung auftauchen als Erscheinung und wir uns dann erst ihr zuwenden? Und erst recht eine Erinnerung. Die Auffassung als vergangene setzt, wird man doch sagen müssen, Motivationen voraus, die vom aktuellen Jetzt ausstrahlen. Aber wie, wenn ich mich nun in eine Reproduktion vertiefe (Sprechzimmer der Universitätshalle etc.) und gar keine Zuwendung dem aktuellen Jetzt zukommen lasse, d. i. dem in irgendeiner aktuellen Wahrnehmung sich konstituierenden Jetzt, also in dieser Hinsicht keine Setzung vollziehe, hat nicht doch die Erinnerung Erinnerungscharakter? Spielen nicht doch die Motivationen, eben weil die erscheinende Wahrnehmungswelt doch für mich da ist, vor der Zuwendung in Wahrnehmungsapparenz erscheinend, die eben ihre Qualität wie ihre Materie hat, ob ich Zuwendung und Setzung übe oder nicht? Allerdings ist es schwierig zu sagen, wie die Hintergrunderlebnisse beschaffen sein sollen.1 Wenn eine Erinnerung auftaucht, so bin ich ihr noch nicht zugewendet (näher ihrem erscheinenden Gewesen). Die Erinnerung reproduziert aber die frühere Wahrnehmung, und das war eine Zuwendung, Erfassung. Also taucht doch wohl ein Phänomen auf, das in reproduktiver Modifikation auch die Zuwendung enthält. Und wie ist es hinsichtlich einer Hintergrundwahrnehmung? Enthält auch sie in einer Modifikation, etwa nach Weise apprehensiver Bestandstücke, die Zuwendung? Wie ist es ferner mit der Bildauffassung? Kann eine solche als Hintergrundauffassung statthaben? Oder konstituiert sie sich erst mit der Zuwendung? Aber warum sollte das nicht möglich sein? Ich trete in ein Vestibül, das mit Statuen geschmückt ist, ganz zugewen-

1 Vgl. über diese und alle weiteren Punkte die Blätter Σ = Beilage XIX: Sinnliche Erscheinungen vor und in der Zuwendung. Die Spontaneität des Durchlaufens gegenüber der schöpferischen Spontaneität des Denkens. Gibt es analoge Unterschiede zwischen Zuwendung und synthetischer Erzeugung im Gemüt? (S. 238) und die späteren, weiter unten beiliegenden.

316

5

10

15

20

25

zur analyse der stellungnahmen

det dem führenden Hausherrn. Ist es mir nicht ganz anders zumute schon vor der Zuwendung, je nachdem, ob es ein Vorraum ist, in dem Menschen stehen, oder ein Vorraum, in dem Figuren an den betreffenden Stellen stehen? Wie unvollkommen und vage auch die Hintergrundauffassung sein mag, sie kann schon alle Auffassungsunterschiede enthalten und mit ihnen untrennbar verbunden, qualitative Unterschiede. Es steht natürlich auch nichts im Wege, dass im Hintergrund Auffassungswechsel, Schwanken sich einstellen. Noch ehe ich mich zuwende, wandelt sich eine normale Wahrnehmungsauffassung in eine Bildauffassung, etwa in eine Spiegelbildauffassung, und das kann allererst als Reiz der Zuwendung wirken. Es ist bei all dem aber zu überlegen, inwieweit die Beurteilung dieser phänomenologischen Vorkommnisse der dunklen Sphäre von Wichtigkeit ist für die der hellen Sphäre. Jedenfalls enthält auch die Analyse der Phänomene in der Zuwendung Stücke einer Analyse von „verworren bewussten“ Phänomenen. Und es sind auch zu beachten die eventuellen Unterschiede derjenigen Verworrenheit, die notwendig mitgehört zu der betreffenden Klarheit, Unterschiede des zu einem Erscheinenden speziell gehörigen und mitverflochtenen Hintergrundes und der verworrenen Sphäre, die sich nicht auf solchen Hintergrund bezieht oder sich wenigstens nicht nachweisbar darauf bezieht.

§ 3. Die funktionelle Abhängigkeit der belief-Qualitäten der Prädikation von den belief-Qualitäten der als Substrat fungierenden Apparenz. Urteilen aufgrund einer Phantasieerscheinung als Phantasie-Prädikation oder als wirkliche Aussage über das Erscheinende als solches

D ie H a up t s a ch e i st f ü r me i ne Un t er s uc hu ng d a s v o ll e i nsi c h ti ge V e rs t ä nd n is d e s V e r h ä l t ni ss e s de r be l i e f- M o d i b e i d e r a ls S u bs t r a t f un g i e re n de n od e r i n d i e S ubs tr a tf un kt i on t r et e n den Ap p a r e nz z u de n b e l ie f- Mo di, w e l c he di e d ar a uf ge ba u t e Me i nu n g h a t , un d d e sg l e i c he n da s P r ob le m, w i e si c h Z u w en d u n g zu M e i n un g v e r ha l t e , o b Z u we n dun g 35 s elb s t s c hon M e in u n g i st o de r n i ch t.

30

text nr. 16

5

10

15

20

25

30

317

Wie verhält sich das M ein en, Akt im prägnanten Sinn, zum G l au ben? Wir gebrauchen das Wort „Glauben“ in der Regel als gleichbedeutend mit „Meinen“. Indessen: Wenn wir zugestehen müssen, dass schon innerhalb der schlichten Erscheinungen ein Charakter auftritt, durch den das in der Apparenz Erscheinende in Seinsweise bewusst ist (scil. im Fall der Wahrnehmung bzw. Erinnerung gegenüber dem Fall des Bildfiktums oder dem der bloßen Phantasie), und wenn wir andererseits in der aufgrund der Apparenz sich aufbauenden Urteilsmeinung (prädikative – oder bloß synthetische Meinung?) abermals eine belief-Qualität annehmen und davon sprechen, dass sie den sich da konstituierenden Sachverhalt als seiend „erscheinen“ lässt, so müssen wir fragen, wie sich die eine und andere beliefModalisierung, „Qualifizierung“ zueinander verhalten. Das theoretische (synthetische) Meinen vollzieht eine konstituierende Leistung in einer Spontaneität, eventuell in einer Spontaneität, die sich in Schritten entfaltet. Gehen wir von einer Phantasieapparenz aus, einer bloßen Phantasie: Ich wende mich spontan dem Phantasierten zu, „erfasse“ den erscheinenden Zentaur, betrachte ihn in einer Explikation seiner Teile und Momente, mache ihn zum Subjekt eines Sachverhalts, beziehe auf das Subjekt in den Formen der Prädikation die oder jene Teile oder Eigenschaften, oder setze ihn in Relation zu einem anderen Phantasierten (eventuell auch zu einem jetzt wirklich Wahrgenommenen). Ich vollziehe dabei theoretische1 Akte, synthetische Meinungen auf dem Grund bloßer Phantasien. Vergleichen wir nun diese s p o nt an e n Leistungen mit denjenigen, die wir vollziehen, wenn wir „genau ebenso“ verfahrend eine Erinnerungserscheinung als Substrat haben. Die Akte des synthetischen Meinens sind beiderseits genau „dieselben“. Bei gleicher apparenzialer Materie haben wir „dieselben“ Ergebnisse, aber freilich mit einem wesentlichen Unterschied: Einmal ist der Sachverhalt ein Wirklichkeitsverhalt, er steht da in der Weise des „So ist es in Wirklichkeit“,2 das andere Mal ist er ein Fiktionsverhalt, der dasteht in der Weise „Das alles ist Fiktion“. 1

„theoretische“ gestrichen, dazu die Bemerkung „besser synthetische und eventuell zugleich begreifende, aussagende“. – Anm. der Hrsg. 2 Zunächt nehmen wir bloß synthetisches Meinen, und dann können wir auch das

318

5

10

15

20

25

30

zur analyse der stellungnahmen

Aber das ist nicht ganz eindeutig. Sprechen wir genauer. Ich kann ganz in der Ph an t as ie leb en, und während mir der Phantasiezentaur vor Augen ist in seiner Phantasieumgebung, begleite ich diese Erscheinung und die Erscheinungsveränderungen dieser fingierten Welt mit prädikativen Fassungen, mit „Prädikationen“, die den Rahmen der Phantasie nirgends überschreiten. D a nn is t di e Pr ädi kat i on sel b s t „ Pha n t as ie “. So wie ich den Zentaur nicht wirklich sehe, sondern nur „gleichsam“ sehe, so vollziehe ich nicht ein wirkliches Urteilen, das den Charakter eines Wahrnehmungsurteils hätte, sondern gleichsam ein Wahrnehmungsurteil. Und es ist auch kein Erinnerungsurteil, es enthält im „gleichsam“ nichts von einem den Sachverhalt „setzenden“ Glauben. Eine andere Einstellung und damit eine Sinnesmodifikation liegt vor, wenn ich etwa zunächst setze, eventuell ausdrücklich urteile: Ich habe jetzt eine Phantasie, mir erscheint in der Phantasie ein Zentaur, dieser Zentaur tut das und das etc. Hier ist nicht der Zentaur, aber der erscheinende Zentaur als solcher gesetzt, das ist kein Reales, aber ein wahrhaft Seiendes, und sein wahrhaftes Sein ist unselbständig. Es ist mein Phantasieren das Phantasie-Erscheinen, und es ist „in“ ihm phantasiert eben das Phantasierte als solches, das „immanente Objekt“, das kein Zentaur ist, sondern ZentaurErscheinendes ist. Vollziehe ich nun die Veränderungen meinender, prädikativer Fassung, so verändere ich damit eigentlich nicht die Phantasie, obschon ich ihr eine formende Neugestaltung gebe, ein Gewand, das sie noch in sich birgt: als Substrat. Tue ich das, ohne das Erscheinende als solches aktuell zu setzen (somit auch das Erscheinen mitzusetzen), so ist das neue Gebilde wieder eine Phantasie und wieder ein Phänomen, das seine Qualität hat, die hier Qualität in Inaktualitätsmodifikation ist (die alsbald übergeht in negative wirkliche Qualität, so wie ich eine Beziehung zur Wirklichkeit und Gegenwart in Ansetzung bringe), und seine Materie: diesen bestimmten propositionalen und so und so erfüllten Gehalt. S e t z e i c h a b e r d a s Er s ch e i ne n de a l s sol c h es, so kann ich von ihm, in gewisser Weise aufgrund dieser ausdrückende, aussagende Denken dazu nehmen. Sachverhalt ist Korrelat des synthetischen Meinens − Bedeutungsinhalt der Aussage, also er hat mit Ausdruck zunächst nichts zu tun.

text nr. 16

5

10

15

20

25

30

35

319

Urteilsphantasie, w ir kl ic h e Au ssa gen machen. Das Erscheinende erscheint als Zentaur, und dieser erscheint als tanzend, sich die Hufe beschlagen lassend etc. E s geh ö r t z um We sen d er gegeb e ne n P han t as ie , da s s sic h a uf i hr em Gr u nd di e u nd d ie Q ua si - Pr äd i ka tio n en v ol l z ie h en l as sen u nd and ere n ic h t v ol lzi e he n l a ss en. Es gehört zum Wesen des Erscheinenden als solchen, dass es die und die prädikativen Formen annehmen kann, eingehen kann in eine Urteilsphantasie (Sachverhaltsphantasie), und das findet Verwendung zur Bestimmung des Erscheinenden als solchen. Es ist damit etwas wirklich festgestellt, dass ich aufgrund der schlichten Zentaur-Phantasie die Prädikations-Phantasie oder vielmehr die Zentaur-SachverhaltsPhantasie ausführe und durch sie das Wesen des Zentaur-Erscheinenden als solchem charakterisiere. Ich kann ja nicht die Zentaur-Phantasie, das ganze Phantasie-Substrat, festhalten und eine beliebige andere Sachverhalts-Phantasie vollziehen, die „denselben“ Zentaur angeht. Wie im Fall der Aktualität, etwa der Wahrnehmung und Erinnerung, das Wesen des Wahrgenommenen und Erinnerten (bzw. das Wesen der Wahrnehmungsapparenz in phansischer Interpretation) Möglichkeiten wirklicher Urteile vorzeichnet, so hier die Phantasie Möglichkeiten von Phantasieurteilen. Das sagt aber, di e Ma t er ie d e s S u bst r a t s i s t be s t i m m e nd f ür d i e M at er i e a l le r pr äd ik a t i v e n M e i n u n g e n (soweit diese nicht Substratmaterie und Substratqualität selbst objektivieren und in Bezug zueinander setzen), während andererseits d i e Qu a l i t ä t e n d e r P r ä di ka t io n f un kt io ne ll a b hä ngi g s i n d v o n d e n Qu a l i t ä te n de r Su bs tr a t e. Der oben analysierte Fall, der von der Bestimmung des Erscheinenden als solchem durch Quasi-Prädikationen handelt, ist kompliziert insofern, als das Substrat, wie es scheint, nicht einfach die Zentaur-Erscheinung ist, sondern das innere Bewusstsein von dieser Erscheinung; nicht der Zentaur, sondern die Zentaur-Erscheinung ist ihr „primäres“ Objekt (das, was aus ihr in schlichter Zuwendung erfassbar ist), und die Zentaur-Erscheinung wieder hat immanent die Beziehung auf das Erscheinende als solches; deutlicher gesprochen: Aus dem Erlebnis des Zentaur-Erscheinens ist durch eine Art Explikation das Erscheinende als solches zu entnehmen (eventuell dasselbe als Idee zu konstituieren). F re i li c h i s t d i e s e E x p l i k at io n , in d er da s „ i mma n e n t e “ Ob j e k t e nt nom m e n wi r d, ei ne

320

zur analyse der stellungnahmen

w esent lic h an der e als e in e s ol c h e, in de r r e e ll e M om e n te d es E rlebn iss es zu r E r fa ss u ng k o mm en.

§ 4. Explikation und Exhibition. Die Scheidung der Qualifizierung im Substrat von der Qualifizierung der Meinung. Das durch das denkende Meinen erzeugte synthetische Gebilde als Erscheinung höherer Stufe mit eigener belief-Qualität kann zum Substrat neuer theoretischer Meinungen werden

5

10

15

20

25

30

Es ist auch zu bemerken, dass das Wort „Explikation“ auch in der Art zweideutig ist, dass einmal damit gemeint sein kann das Herauserfassen aus einem Erfassten und das andere Mal das Herauserfassen aus einem Nichterfassten bzw. nach der Erfassung nicht Festgehaltenen. Es wäre da gut, zwischen E xp l i kat i on und etwa Ex h i bi t i o n zu unterscheiden. Wenn wir aus dem Erlebnis der betreffenden Wahrnehmung oder Phantasie das Erscheinende als solches entnehmen, so exhibieren wir, denn es ist nicht notwendig, dass wir das Erlebnis als solches immerfort setzen. Aber freilich, Substrat ist es doch in dem Sinn, in dem die Hauserscheinung Substrat ist, wenn wir bloß der Farbe zugewendet sind: Sie ist in gewisser Weise gegeben mit ihrem Gesamtbestand; sie liegt zugrunde und muss zugrunde liegen (oder eine andere, Gleiches leistende konkrete Erscheinung, falls es nur auf die Idee Farbe ankommt). Und ebenso muss in unserem Fall das innere Bewusstsein von der Erscheinung seine Hebung besitzen und als Substrat fungieren. Es ist ferner für die Analyse des besprochenen Falls auch zu beachten, dass natürlich die wirklichen Setzungen und Setzungsformen, die sich auf das Erscheinende als solches beziehen (wobei dieses das theoretische Objekt ist), nicht zu verwechseln sind mit den wirklichen oder modifizierten Setzungen, die zu den Urteilen oder Quasi-Urteilen gehören, welche zum Erscheinenden gehören und dazu dienen, durch die Beziehung, in der das Erscheinende als solches zu ihnen gesetzt wird, dieses zu bestimmen, ihm Reflexionsprädikate zu verschaffen.1 So zum Beispiel, wenn ich den erscheinenden 1

Ich nehme hier gleich zusammen Bestimmung des Phantasierten als solchen, aber

text nr. 16

5

10

15

20

25

30

321

Zentaur als solchen bestimme durch „als tanzend“, d. h. als tanzend erscheinenden; hier haben wir die Formen des Phantasieurteils bzw. dieses selbst: „Dieser Zentaur tanzt“; und andererseits haben wir die Formen des wirklichen Urteils: Die Erscheinung hat als immanentes Objekt ein Zentaur-Erscheinendes (sie ist, kürzer gesprochen, Erscheinung von einem Zentaur) und ein so Erscheinendes, dass es in der Urteilsphantasie „Dieser Zentaur tanzt“ (bzw. durch das zugehörige Erscheinende als solches) seine Bestimmung erfahren kann als tanzend Erscheinendes usw. Ist diese Analyse hinreichend tief und breit ausgeführt, dass wir nun den Satz wagen können, dass jedes prädikative Meinen, jedes Meinen einfacher wie komplizierter Gestalt, sowohl nach M a t er ie wie nach b e l ie f- Q ual it ä t f un kt io nel l du rc ha us a b h äng i g is t v on s e i n e m Su b st ra t (b z w . sei ne n S ub st r a ten)?1 Dem Allgemeinen nach vielleicht, aber es ist klar, dass es nun sorgsamster Einzelanalyse bedarf, um die sehr verschiedenen funktionellen Abhängigkeiten, die Materie und Qualität hierbei eingehen, im Einzelnen zu charakterisieren. Schon der flüchtigste Blick lehrt, dass manche „Formen“ von theoretischen Setzungen und Urteilen nur e i n Substrat voraussetzen (bzw. ein Ursubstrat, das alle anderen Substrate, wie sie sich auf die Schritte der Setzung verteilen, umfasst), bald mehrere Substrate, die nicht von vornherein zu einem Substrat sich zusammenschließen, so z. B. die pluralen Setzungen, ferner die Urteile, in denen sich Vergleichungsrelationen als Sachverhalte konstituieren. Also das spielt schon in der Urteilslehre eine wichtige Rolle. Als sicher festhalten werde ich auch müssen, dass, wenn jede theoretische Meinung Substrat voraussetzen sollte (was wir noch nicht bewiesen haben, da wir bloß vom Faktum der auf Anschauungen sich gründenden Meinungen ausgegangen sind und uns darauf beschränkt haben), dann jedenfalls unterschieden bleiben muss die Q u a l if i z i er u ng i m S u b s t r a t und die Q ua l i f i z i er ung d e r

auch des Wahrgenommenen als solchen usw. durch Phantasieurteile, durch Wahrnehmungsurteile etc. 1 Das theoretische Meinen: Das ist das thetische und synthetische Erfassen und eventuell das prädikativ ausdrückende Urteilen. Das Substrat, das ist das intentionale Erlebnis vor der Zuwendung, vor dem Fassen.

322

5

10

15

20

25

zur analyse der stellungnahmen

M ein un g. Freilich, die Meinung ist nichts neben dem Substrat, sie ist etwas auf Substraten Gebautes, aber in seiner Konkretion sie auch Umspannendes. Aber gleichwohl: Die Qualität der prädikativen Meinung und aller Teilmeinungen ist zu scheiden von den Qualitäten der Substrate, sosehr die Abhängigkeit klar ist. D i e S ub je k ts e tzu ng g ehö r t z ur t he o re t i sc h en M e in un g, und ih re Q u al i tä t is t Q u ali t ät d e r Me i n un g un d n ic h t Q ua li tä t der S u bs t ra te rsc he in u ng, die etwa dem „Dieses Haus …“ zugrunde liegt.1 Sagt man, die Wahrnehmung ist auch ein Vermeinen, sie vermeint als seiend, was sich eventuell herausstellt als nichtig, und das Nichtigkeitsbewusstsein der mit der Charakterisierung als nichtig bewussten Erscheinung ist ein Vermeinen, es kann eine falsche Charakteristik sein usw., dann antworten wir natürlich: Eine Wesensgemeinsamkeit besteht offenbar darin, dass die betreffenden Charaktere bei der schlichten und passiven Erscheinung wesentlich gleichartig sind mit denen bei der theoretischen Meinung. Andererseits ist der Unterschied evident zwischen dem spontanen theoretischen Akt und seinen Gebilden und der nicht-spontanen Erscheinung; und wenn wir beides Vermeinen nennen, nun dann bräuchten wir ein anderes Wort für das, was wir als theoretische Meinung bezeichnen. Es ist auch zu überlegen, ob dann nicht die Rede vom Vermeinen auf die Frage der Wahrheit, auf Norm und Gesetz zurückführt und ob es nicht sein Richtiges hat, zu sagen „Alle Wahrheit liegt im Urteil,“ obschon das Urteil seinem Wahrheitswert nach wesentlich bestimmt ist durch das unterliegende Substrat, wie es seinem Gehalt nach als Urteil wesentlich abhängig ist vom unterliegenden Substrat.2 Wahrnehmungen vermeinen etwas, und sie haben ihre Wahrheit und Falschheit, sofern sie eben so geartet sind, dass die nach ihnen sich

1 Ja, wenn es sich um die Sphäre des Aussagens, des Aussagesubjekts handelt! Wenn aber kein Ausdruck mit seinem Denkbedeuten in Frage ist, dann haben wir die schlichte Thesis, die schlichte Zuwendung zum Gegenständlichen der vordem seelenlosen Erscheinung, und nun haben wir die Erscheinung in einem anderen Modus. Wir „vollziehen“ den „Akt“ der Wahrnehmung, und wenn nun Explikation und Synthese statthaben, so erfährt die Thesis nur die Modifikation, dass sie zur Subjektthesis wird, aber sonst geht sie in die Synthesis ein. 2 Ja, wenn wir gegenüberstellen die Schicht des Denkens und denkenden Aussagens, Für-wahr-Haltens, Für-wahrscheinlich-Haltens, etc. und das, was darunter liegt: wohin auch die Synthesis gehört. Also da steckt ein Doppelsinn von Substrat.

text nr. 16

5

10

15

20

25

30

35

323

„richtenden“ Urteile als wahr zu begründen sind oder nicht. Doch das sei hier nur hingeworfen. Es steht auch nichts im Wege zu sagen: Indem sich a uf ein em S u bs t rat, gedacht als substruierte Zuständlichkeit der ursprünglichen Rezeptivität, e i n s ynt h eti s c h es u nd da nn w ei t er ei n d enk en des t he or e ti s c h e s M ei nen g rü nd et, s o ha t di es es t heo ret i sc h e M e in e n in se i n em ko n kr ete n G es am tbe st and se lb s t wi ede r de n C h ar a kt er ein er „ E r sc he i nu n g “ , e in er s o l c h e n höh ere r St uf e, di e w i e j ede „ E r sch ei nu ng “, wie jeder Akt im weitesten Sinn seine Materie und s e in e be lie f-Q u ali t ät h a t.1 Als Erscheinung erscheint in ihr eine Gegenständlichkeit, konstituiert sich in ihr eine solche, und diese Gegenständlichkeit kann, wie jede Gegenständlichkeit, zum Objekt einer schlichten Erfassung, zum Gegenstand einer schlicht setzenden Meinung, dann Subjektsetzung etc. werden. D as b e sag t , d as s ein er se i t s auf d e m G ru nd e i ne s zu s t ä ndl i ch e n, u rsp rün gl ic h r ez e pti v en S u bst r ats s i ch i n S pon ta n e it ä t d er Set z un gen e in sy nt he ti s ch e s G eb i l d e e r z e ug e n k a n n, da s s d a nn a ber i n g ew is s er We is e d as Ge b i l d e t e s e l bs t wi e d e r z u m Su bst r at ne ue r t he o re ti s ch er Me i n u ng e n w e r de n k a nn. Das freilich erfordert eine Modifikation des Gebildes: Es wird zu einer s e k un dä re n R ez ep t iv i tä t, sich dem Charakter der ursprünglich rezeptiven Erscheinung in gewisser Weise annähernd. Nota. Nicht Rechnung getragen habe ich auch folgender Art der Gründung der synthetischen Meinungen auf Erscheinungen (und dann weiter der auf Synthesis beruhenden prädikativen Akte). Ich habe eine kontinuierliche Erscheinung, eventuell eine kontinuierlich sich ändernde Erscheinung. Darauf gründet sich eine Einheit der Meinung, ich erfasse die Einheit des ruhenden oder sich verändernden Gegenstandes. Und nun erfasse ich die einzelnen Abschnitte der kontinuierlich erscheinenden Gegenständlichkeit, den Teilmeinungen entsprechend, die kontinuierlich in die Einheit der Meinung eingeordnet sind, die Zeitabschnitte, das Objekt in dem Jetzt und im Vorher etc. Das kann ich dann vergleichen etc. Hier fungiert die einheitliche Meinung als Substrat, ähnlich wie ein einheitliches Urteil

1

Nota bene. Gut.

324

zur analyse der stellungnahmen

(in dem Modus, den es nach dem Ablaufen hat) als Substrat fungiert für die theoretische Setzung des Subjekts als Glied des Sachverhalts usw., um dann etwa Relationen zu konstituieren zu dem ganzen Sachverhalt und seinen Gliedern, Formen etc. oder diesen Sachverhalt mit 5 einem anderen in Bezug zu setzen.

§ 5. Gemüts- und Willensakte als Substrate theoretischer Meinungen. Die Gemütserscheinungen selbst haben belief-Charakter. Die Modalitäten des belief als zu allen intentionalen Erlebnissen in gleicher Weise gehörig 10

15

20

25

30

A l s S u bs t r at syn t h et i sc he r u nd th eor e ti s ch er M ei n ung e n kö n ne n nu n ab er au c h Wu n sc ha kt e, F r eu de n, Wil le ns a k t e e t c . f un g i e re n. Diese selbst können in bloßen ursprünglichen Rezeptivitäten, in sinnlichen Erscheinungen, fundiert sein und zu ihnen bloß neue Charaktere hinzutun (Sinnlichkeit höherer Stufe), oder sie können als Akte im höheren Sinn in Meinungen fundiert sein. Zum Beispiel, ich sehe ein Ding und betrachte es mit Gefallen. Ich esse eine Frucht und sie schmeckt mir. Wir haben da eine Einheit sinnlicher Erscheinungen und damit eins eine Einheit des Gefühls. Wir können essend mit anderen sprechen, ihren Reden zugewendet sein, dabei theoretische Akte verschiedener Art vollziehen etc. Wir haben dabei immerfort die Erscheinungen der Speise, des Essens, die darauf bezogenen Gefühle. Wir können dem Erscheinenden und der Lust an ihm auch hingegeben sein. Die Zuwendung richtet sich auf das Erscheinende, etwa auf die wohlgefällige Speise auf dem Tisch oder Teller, während das Gefallenserlebnis aber nicht Objekt der Zuwendung ist, und auch nicht das Gefälligsein.1 Wir können aber auch auf das Gefälligsein hinsehen: ähnlich wie wir statt auf den Inhalt des Erscheinenden auf sein Dasein „hinsehen“ können. Wir können dann auch theoretische Setzungen höherer Stufe vollziehen: „Das ist eine schöne Speise“ etc.

1

Aber da heißt es vorsichtig sein. Im Gefallen leben ist auf das Objekt in seiner Gefälligkeit gerichtet sein. Aber das wieder sagt nicht, dass das „gefällig“ für sich abgehoben und als Charakter auf das Substrat der Gefälligkeit bezogen ist.

text nr. 16

5

10

15

20

25

325

Ebenso wenn uns in der Phantasie etwas Schönes vorschwebt: Wir betrachten es mit Wohlgefallen, es ist ein aktuelles Wohlgefallen aufgrund des Erlebnisses der Phantasie und zugleich Wohlgefallen am Phantasierten als solchen etc. Es kann dabei in all diesen Beispielen die bloß sinnliche Erscheinung (sinnlich im engeren Sinn) als Substrat fungieren, es kann aber auch die Gefühlserscheinung, die ganze fundierte, zum Substrat werden.1 Und so überall. Die „Gemütsakte“ oder Gemütscharaktere, die sich auf den unterliegenden Substraten bauen, bilden mit diesen zusammen sozusagen Erscheinungen höherer Stufe, eben neue mögliche Substrate für eine erfassende Zuwendung und theoretische Setzung. Aber nun ergibt sich ein w i ch ti ge s Pro bl em : W ona ch „ ri ch t e t “ s i c h di e Q ual it ät d er th eo r et is ch en S et z ung en , di e s i ch , w e nn s o zu sag en E r sc hei nu n ge n do xi sc he r Si nn l ic hk e i t zu g r un de l i e gen (Erscheinungen, die unmittelbar als Seinserscheinungen charakterisiert sind und in ihrer Materie nichts mehr von Qualität enthalten), e b e n n a ch d er t he ore t is c he n Q ua li tä t r i c h t e n? H a be n e t w a di e G em ü ts ers ch e i nun ge n s el b st w i ede r b el i ef- C h a ra k t e r, also neben dem neuen Gemütscharakter noch einen sozusagen theoretischen Charakter (oder sagen wir lieber intellektiven)?2 Wir stoßen hier auf einen P unk t v on fu nd am e n ta l e r Be d e u t u n g. Wir versuchten oben3 die nächstliegende Auffassung, wonach die sinnliche Erscheinung, die wir uns als u nmi t te lb a re Q ua li fi zi e ru ng ei n er qu a l i t ä t s l os e n Ma t e r i e dachten, in dieser Qualität (bzw. in der Reihe modaler Abwandlungen, die wir alle als Qualitäten bezeichneten) etwas aufweise, was ganz ebenso in der sich ihr „anpassenden“ theoretischen Meinung, wie immer ihre Gestaltungen seien, auftrete. D ie t h e or e t i s c he Me i nu ng i s t zw ar ei n

1 Die ganze Rede von Substrat ist, scheint mir jetzt, irreführend. In der Wahrnehmung bin ich zugewendet dem Wahrgenommenen. Lebe ich im Gefallen, so habe ich ein auf Vorstellung fundiertes Fühlen und zugewendet bin ich da dem Gegenstand in seinem Gefühlsmoment. Ich nehme das sozusagen wahr. Wie ich dann eine spezielle Erfassung vollziehe, ist eine Sache für sich. – Das aber geht nicht hervor, dass „seiend“ und „schön“ einander gleichstehen. 2 Vgl. dazu viele Ausführungen unten, z. B. „η“ siehe Text Nr. 17: Zuwendung und Setzung. Richtungen der Aufmerksamkeit (S. 340). 3 Zum Beispiel 14 = S. 321,27–323,23.

326

5

10

15

20

25

30

35

zur analyse der stellungnahmen

ac tu s der Sp on t a nei t ät , ab er n ic ht sie se lb s t i st Q ua l i tä t, son d ern in i h ren G eb ild en , w ie sie sp o nt an zu tag e t re te n a ls „ E rs ch ei nu nge n h ö her er S t u f e “, tre te n di e Q u ali t ät en a uf: diesen Gestaltungen ganz ähnlich immanent und eine Materie qualifizierend wie in der niederen Stufe. Wie selbstverständlich dachten wir uns diese Erscheinungen und die höheren fundierten Erscheinungen, die wir „t h eo re t is c he M einun ge n“ nannten, zusammengenommen und so überhaupt eine ga ttu ng sm äß ig e E i nh ei t geb i l det d u rc h al le n ie d er e n u nd höh er en E rs ch e in ung en , d i e die g l ei c h en Q u al it ät e n, di e glei che n m od a l en Ab wa n d l un gen z ei gt en. In den Logischen Untersuchungen war daher die Rede von „o b j ekt i vi e re n d en Ak t en“. Und nun scheint es sich evident herauszustellen, dass jedes „i nt ent i ona l e E r le bn i s“, so jedes Gemütserlebnis, dieselben modalen Abwandlungen zeige, also o bj e k t i v i e r e n d e s genannt werden müsste! Dass also der „belief“ und all die Modalitäten gar nicht gattungsbildend fungieren können. Es scheint sich herauszustellen, dass, wenn wir modale Abwandlungen bei allen Akten in gleicher Weise finden, nicht sie, sondern das, was wir „Materien“ nannten, allein für die Gattungsbildung in Frage kommen könnte, und dass wir somit nicht sinnvoll in eine Reihe stellen können „Charakter des belief“ und Charakter des Gefällig. Was würde in eine Reihe kommen? Nun, in niederer Stufe, in der der Zuständlichkeiten, Perzeptionen (als allgemeiner Klassenterminus) und was ihnen irgendwie gleichstehen mag, und eventuell parallel damit in höherer Stufe: I nt e l l e k t i o ne n (Urteilsmeinung, Meinung in allen Modalitäten), E mo t i one n (Gefallensverhalten, mit seinen Unterlagen natürlich und in allen Modalitäten), V ol i ti on e n (wieder in allen Modalitäten). Di e Mod a l i tä t e n de s b el ie f s i nd M od a l i tä te n , d i e z u a l l e n m ö gl i c he n Sub s tr a te n , z u a ll e n in t en t io na l e n E r l e b ni s s e n ( d as b e s ag t o ff e nb a r d a s s e l b e ) i n g le i c he r W ei s e g e hö re n. Die Intellektionen können sich auf alle intentionalen Erlebnisse als Substrate gründen und ihnen ein Sein entnehmen, eben vermöge der Seinsmodalität, die in ihnen wohnt, die ihnen unaufhebbar in irgendeiner Abwandlung zugehört. Demnach wäre auch die Bezeichnung der belief-Modalitäten a l s Q u ali t ä ten u n b ra u ch b a r. Wir müssten besser eben sagen „Modalitäten“ und hätten dann weiter zu sagen, dass die Modalitäten der fundierten Akte in verschiedenen funktionellen Abhängigkeiten ste-

text nr. 16

327

20

hen zu den Modalitäten der fundierenden. Wenn das theoretische Meinen einer Perzeption einen Gegenstand-worüber entnimmt, so hat diese die Modalität der Gewissheit und das theoretische Meinen ebenfalls. Wenn jeder Akt als Substrat fungieren kann, so wird, wenn er die Modalität der Gewissheit hat, der entnommene Gegenstand theoretisch als seiend gesetzt, die theoretische Subjektsetzung hat den Charakter (Modalität) der Gewissheit, und der entspricht eine mögliche existenziale Beurteilung. In theoretischer Setzung erfasse ich den Gegenstand als gefällig seienden, wenn eben ein Gefallen im Modus der Gefallensgewissheit sich auf ihn richtet.1 Ein Sachverhalt wird gesetzt als praktisch seinsollender (im Sinn des praktischen, im Befehlswillen etwa liegenden „Das soll sein!“), wenn ein Entschlusswille im Modus der Willensgewissheit vollzogen ist. Es wäre auch zu bemerken: Ein Urteil bezieht sich auf einen Gegenstand-worüber, nämlich die theoretische Meinung erfasst ihn, sich ihm zuwendend, formt ihn und macht ihn zum Subjekt. Die Gewissheit „richtet“ sich auf nichts, und auch von der bloß schlichten Perzeption können wir nicht sagen, sie richte sich auf etwas, in dem Sinn wie eine Spontaneität sich richtet, in der Zuwendung und theoretische oder anderweitige Setzung statthat.

25

§ 6. Sind emotionale und volitionale Setzungen Analoga der theoretischen Setzung? Besteht die Struktur des Bewusstseins in einer genauen Entsprechung zwischen niederem und höherem Bewusstsein in Intellekt, Gemüt und Wille?

5

10

15

Doch da bleiben noch Schwierigkeiten übrig: Nämlich die Frage, ob das genaue Analogon der theoretischen Setzung, Meinung, mit all ihren Gestaltungen die praktische (volitionale) Setzung ist mit eigens zu ihr gehörenden Gestaltungen und wieder, ob nicht auch 30 das Gefallen und das Wünschen als „Setzungen“ anzusehen sind mit eigenen Formen und analog dem theoretischen Meinen.

1 Das ist doch nicht korrekt. Ich muss die im Gefallen liegende Doxa vollziehen und nicht das Gefallen!

328

5

10

15

20

25

30

35

zur analyse der stellungnahmen

Eine weitere Schwierigkeit liegt in den ursprünglichen Gemütszuständlichkeiten im Verhältnis zu den spontanen Gemütsakten, den Gemütssetzungen (Stellungnahmen), die ihrerseits wieder in abgeleitete Zuständlichkeiten übergehen können. Von der Beantwortung dieser Fragen hängt es ab, ob wir uns die St r u kt ur des B ew uss t sei n s so denken dürfen, dass niederes und höheres Bewusstsein sich in seinen Grundgestaltungen (in seinen echten Qualitäten) genau entspricht, ob also die verbreitete Auffassung, die Perzeptionen (sinnliche Erscheinungen schlichtester Art) in eine Klasse rechnet mit den Urteilen, sagen wir allgemeiner, mit den theoretischen Meinungen, nicht doch ein Recht hat, wenn auch das grundfalsch ist und bleibt, das modale Moment des belief als klassenbildend und klassenscheidend anzusehen (Letzteres B re nta n o, Ersteres ich in den Logischen Untersuchungen). Dann wäre 1) die Perzeption die ursprüngliche intellektive Zuständlichkeit, die ursprüngliche intellektive (verstandesmäßige) Rezeptivität, und die intellektive (verstandesmäßige) Spontaneität setzte dann solche Rezeptivität voraus, wenn sie in der reinen Verstandessphäre sich bewegen will (jedenfalls mittelbar oder unmittelbar ist intellektive Rezeptivität für Spontaneität vorausgesetzt). Fürs 2te) entspräche der Gemütsspontaneität, dem Gemütsstellungnehmen, den Gemütssetzungen, Gemütsmeinungen ebenfalls eine Gemütsrezeptivität, das ist die Gemütssinnlichkeit, die notwendig fundiert ist in einer intellektiven Sinnlichkeit. Muss man nun nicht auch sagen, dass die höhere Stufe der Gemütsmeinungen der Gemütsvernunft ihrerseits wieder voraussetze die höhere Stufe der intellektiven Meinung, also das verstandesmäßige Beziehen etc.? 3) Dann würde der Willensvernunft, dem volitionalen Stellungnehmen, dem volitionalen Meinen ebenfalls eine Rezeptivität entsprechen, die volitionale Sinnlichkeit, der sinnliche Trieb, der notwendig fundiert ist in Gemütssinnlichkeit (in Gefühlen), also in weiterer Folge auch in sinnlicher Empfindung bzw. sinnlicher Auffassung (intellektiver Sinnlichkeit). Muss man dann nicht wieder sagen, die höhere Stufe, die volitionale Vernunftstufe, setze die entsprechende Gemütsvernunft (emotionale) und intellektive Vernunft voraus, also bei „eigentlichem“ Vollzug der Akte die Willenssetzung eine emotionale Setzung und schließlich eine theoretische Setzung, ebenso bei beziehenden Akten der Vernunft und des Verstandes?

text nr. 16

5

10

15

20

25

329

Eine Folge der vorgetragenen Auffassungen wäre, dass wie bei theoretischen, so bei emotionalen und praktischen Setzungen (Meinungen) zu sagen wäre: Jede theoretische, emotionale, volitionale Setzung hat ein Setzungssubstrat, und es wären dabei wohl unmittelbare und mittelbare Substrate zu unterscheiden. 1) Jedes theoretische Substrat führt zuletzt auch (unmittelbar oder mittelbar) auf rein intellektive Akte als Substrat und ganz zuletzt also auf rein intellektive „Sinnlichkeit“ zurück. Im Übrigen kann als theoretisches Substrat jeder Akt fungieren, nicht nur Akte jeder Grundklasse, sondern jede besondere Gestaltung solcher Akte. Darin besteht die Universalität des Verstandes, des Intellekts. 2) Auch jede emotionale „Meinung“ (Setzung) hat ein Substrat, und mittelbar oder unmittelbar liegen im Substrat auch emotionalsinnliche Zuständlichkeiten als Substrate und natürlich auch eine intellektive Sinnlichkeit. Akte jeder Grundklasse, niedere und höhere, können als emotionales Substrat auftreten. Andererseits, wird man sagen können, dass jedweder bestimmte Akt als emotionales Substrat fungieren kann? Das ist erst zu überlegen. 3) Ähnliches für volitionale Substrate. Es ist zu überlegen, ob nicht auch Wollungen (sei es positive oder negative, überhaupt Modalitäten irgendwelcher Art) universell Beziehung haben können auf Substrate beliebiger Art und Form, beliebiger Aktklassen und Besonderungen. Es wird hier darauf ankommen, ob zum Beispiel das „Ich kann nicht wollen, wenn ich einsehe oder glaube, es sei das zu Wollende ‚unrealisierbar‘ “ als eine Willensmodalität anzusehen ist, wie etwa das „Ich kann nicht glauben (positiv Meinen), es sei S p, wenn ich sehe, es ist nicht S p“ oder „Ich kann nicht wollen, was ich nicht um seiner selbst willen oder um anderes willen positiv werthalte“ etc.

330

Beilage XXIII Die Scheidung der Akte in Grundklassen (Regionen). Die Qualität als Grundklassencharakter. Die modalen Besonderungen der Gewissheit als zu jeder Grundklasse gehörig1

5

10

15

20

25

30

35

zur analyse der stellungnahmen

Nach den Untersuchungen O1 16 ff. = S. 325,16 ff. scheiden sich die Akte in Grundklassen, und in jeder Grundklasse als Region von Akten finden wir die modalen Unterschiede der Gewissheit und außerdem den polaren Unterschied der Positivität und Negativität.2 Die Frage ist, ob der Ausdruck „Qualität“, den ich zusammen mit dem Ausdruck „Materie“, und zwar zunächst in der Sphäre der Verstandesregion (der theoretischen Akte) eingeführt habe, noch verwendbar ist. Dies dürfte so angehen und einen immerfort notwendigen Begriff von Qualität (und Materie) ergeben: „Q u a l i t ä t“ eines Aktes nennen wir seinen Grundklassencharakter (regionalen Charakter) in seiner m oda le n und p o la ren Besonderung (die keine Differenzierung ist!). (Das dürfte empfehlenswerter sein, als der Analogie der traditionellen Logik folgend bloß die modalen Besonderungen in den Begriff der Qualität aufzunehmen und dann zwischen positiver und negativer Qualität zu unterscheiden.) Es wäre dann alles zusammengefasst, was für die Konstitution der korrelativen Idee der „Bedeutung“ und des Verhaltes (Sachverhalt, Wunschverhalt etc.) in Betracht käme, während Unterschiede der Lebendigkeit und Unlebendigkeit (zuständliche Modifikation des Aktes) und dergleichen ausgeschieden blieben. „Verhalt“ klingt nicht gut. Wir könnten sagen „Geltungsverhalt“, der je nachdem ein thetischer oder synthetischer wäre. Z u je d er Ak t re g i on ( zu jed e r G r un da rt de r V e r n un f t) h ab e n w i r ei ne ei g e n e R eg i on v o n Ge lt un g s ver h al ten. Und zwar scheiden sich die Geltungsverhalte in G e lt ung s g e wis s h ei ten der betreffenden Region (ontisch verstanden) als die Ur f o rm e n von Geltungsverhalten und in deren modale Abwandlungen. Natürlich sind die Modalitäten keine Differenzen der Aktgattung bzw. ihrer regionalen Gattungs- und Artungscharakteristik. Dem entspricht es auf ontischer Seite, dass sich die Korrelate des Regionalen und Modalen sondern. Dem Regionalen entspricht das Geltungsprädikat (Wahres (Seiendes), Schönes, Gutes usw.), dem Modalen eben die Modalität, in der dieses Prädikat der Materie zugehört. In phansischer Hinsicht fungiert der Akt mit seiner Aktmaterie und seiner Qualität eben als „Erscheinung“, aus der ein theoretisches Meinen 1 2

Wohl Oktober/November 1911. – Anm. der Hrsg. „polar“ als Terminus für Positivität und Negativität.

beilage xxiv

331

entnehmen kann einen prädikativen Sachverhalt, dessen Subjekt die Materie ist des Erscheinenden, dessen Prädikat das Geltungsprädikat ist und dessen Polarität und Urteilsmodalität eben je nachdem Gewissheit, Vermutlichkeit etc. bzw. Affirmation und Negation ist. Im Übrigen haben wir die zuerst 5 im Verstandesgebiet gewonnenen und geklärten Unterscheidungen auf alle Regionen zu übertragen. Wir haben t h e t is c he G e l t u ng s v e r h a l te (z. B. in jeder Untersetzung) und b ez ie he n de G e lt u n g s v e r ha lt e, synthetische, und wir haben die G el t u n gs g em e in t h ei t (G e l t u ng s b e d eu t u n g) und den G e ltu n gs ve r 10 h a lt s el bst, z. B. den wirklichen Gegenstand selbst, zu unterscheiden. Im G e g e n s t a nd haben wir G e ge n st an d s in h al t und die r eg io n a le S ei n sf o r m; i m w ah r e n S a c hv e rha lt die Ma t er ie und die B es tan d s f or m usw. Wie Inhalt des Gegenständlichen und Materie der Bedeutung zueinander stehen (denn beides fällt nicht zusammen), ist dann weiter zu untersuchen.

Beilage XXIV Zur Klärung der Begriffe Aktqualität, Aktmaterie und Setzungssubstrat1

15

1) Theoretische „ Se tz u ng “ a l s „ S t ell un g n ah m e “ steht gleich mit den Stellungnahmen (den „Setzungen“) der Freude, des Wunsches, des Willens, 20 und zwar sind es la u t er „ G ew i ss he ite n “. T h eo r et is c h e S etz u n g is t d ie t he o r e t is ch e G e wis s h ei t, und ihr entsprechen theoretische Modifikationen der Ungewissheit. Ebenso haben Freude etc., die Gemüts- und Willensakte neben der Gewissheit ihre Modifikationen der Ungewissheit. 2) Alle diese Unterschiede sind Unterschiede der Aktqualitäten, „Akt25 intentionen“, und wir denken dabei ausschließlich an sich zuwendende, „sich richtende Erlebnisse“, an Urteile, Freuden etc., in denen wir „leben“ (wahrnehmend, urteilend, wünschend, wollend „gerichtet“ sein auf etwas, ihm zugewendet sein). In einem Akt können wir leben, die Aktintention „vollziehen“, ohne dass sein gegenständliches Korrelat gesetzt, Gegen-stand 30 im besonderen Sinn ist: ausgenommen natürlich den setzenden Akt. 3) Jede Setzung und jede Aktintention überhaupt (Aktqualität) fordert ein Was. Aktintention ist etwas Unselbständiges (wie es scheint). Sagen wir phansische Aktmaterie für das gesamte Ergänzende (es ist das, was ich bei den objektivierenden Akten der Logischen Untersuchungen als Re-

1

Wohl 1910/11. – Anm. der Hrsg.

332

5

10

15

20

25

30

35

zur analyse der stellungnahmen

präsentation bezeichnet habe), dann gehört zur Materie das, was ich in den Logischen Untersuchungen Materie und andererseits die Fülle genannt habe. Verschiedene Akte gleicher Qualität können von gleicher Materie sein und unterscheiden sich dann durch die Weise der Fülle. Wir können sagen: Verschiedene Akte können in der Weise des Bedeutens (im Wesen des Bedeutens) übereinstimmen, aber Unterschiede im Bedeutungsstoff zeigen. Ich habe von Auffassungssinn und von Repräsentanten der „objektivierenden Akte“ gesprochen. Aber die Terminologie ist unklar. In der Materie vollzieht sich das Sinngeben und dadurch die Beziehung auf den Gegenstand, die eben immer „in bestimmtem Sinn erfolgt“. Die gegenständliche Beziehung gründet rein im Sinngeben. Versuchen wir zu sagen: Zum Wesen der Aktmaterie gehört d a s M o me n t Si nn g ab e, und wir verstehen das nicht im allgemeinsten Gattungssinn (Sinngabe überhaupt), sondern, wenn wir von einer Sinngabe des Aktes sprechen, im bestimmten Sinn, auf den bestimmten Sinn bezogen. Bei identischer Sinngabe können die Materien noch verschieden sein. Das Unterscheidende: die Füllweise. Das befasst die Unterschiede der Verworrenheit und Deutlichkeit, der Klarheit und Unklarheit, die Weise der Vollkommenheit, in der der Gegenstand in der Weise seiner Auffassung, seines Sinnes angeschaut ist (auch der Unterschied zwischen hinzutretender, illustrierender Anschauung, Anschauung durch Bilder etc., und schlicht anschaulicher Sinngebung usw.). Wir stellen die Frage zurück: Haben solche Unterscheidungen über die Urteile hinaus einen Sinn, über die Setzungen hinaus? Nicht zu verwechseln:1 1) Substrat als Aktmaterie (gleich Materie). Also ein urteilendes Meinen: seine Qualität und sein gesamtes Was. Ein vermutendes Meinen: Qualität und gemeintes Was (immer vollkommen genommen, nicht bloß der Sinn). Ein Wünschen: Qualität und Was des Wunsches, Was des Wollens und „Qualität“ des Willensaktes. Wir vollziehen hier also eine Abstraktion eigentümlicher Art. Mehrere Urteile können gleiche Qualität haben (als Positionen) und dabei auch gleichen Sinn, aber doch noch Verschiedenheit haben. Zum Beispiel „das“ Urteil „2 × 2 = 4“ einmal klar, das andere Mal unklar. Mehrere Urteile können sich bei gleicher Qualität „Urteil“ auch unterscheiden durch den Sinn. Ebenso, mehrere Wünsche haben dieselbe Qualität Wunsch. Sie haben denselben Sinn: Dasselbe ist gewünscht. „Der“ Wunsch ist derselbe (Qualität mit Sinn), aber es sind doch noch starke phänomenologische Unterschiede. Dabei ist Qualität eigentlich nicht das Gattungsmässige der konkreten Phä1

Vgl. Ms: die Untersuchungen über Substrate und die Begründung aller zugehörigen Unterschiede vgl. zu den Texten mit der Signatur „Ms“ die Angaben im Textkritischen Anhang, S. 366.

beilage xxv

333

nomene überhaupt, da verschiedene Sinnesbestimmung und Füllweise nicht als Differenzierung der Qualität anzusehen ist. 2) Setzung und Setzungssubstrat. Da haben wir einmal das Verhältnis zwischen Setzungsqualität und Setzungsmaterie als Aktmaterie nach 1). An5 dererseits, fordert nicht jede meinende Setzung in anderem Sinn ein Substrat, nämlich eine Unterlage, eine Erscheinung, aus der die Meinung ihr Subjekt entnimmt und durch deren „theoretische Formung“ (spontane Gestaltung eines prädikativen Meinens aufgrund der Erscheinung) das prädikative Urteil erwächst?

Beilage XXV Meinen als Setzung und Meinen als Aufmerken. Die Frage nach dem Begriff des Urteils1

10

15

20

25

30

Was ist das Meinen? Im Unglauben kann ich leben, z. B. wenn ich höre, mein Papier da sei grün. Ich kann aber auch „meinen“, das ist nicht wahr, das ist nicht so, das Papier ist nicht grün. Jetzt vollziehe ich ein „Urteil“, ich glaube und lebe nicht mehr im Unglauben, sondern in einem „aufgrund“ dieses Unglaubens etablierten Meinen oder Glauben. Im Wünschen kann ich leben, und abermals kann ich im „negativen“ Wünschen, im Un-Wunsch leben; in der Freude kann ich leben, und wieder kann ich in der Unfreude leben, im Billigen und Missbilligen. Ich kann nun aber ein Meinen hier etablieren, aufgrund all dieser Akte. Ich wünsche nicht nur, ich meine auch, das und das sei erwünscht. Ich miss-wünsche nicht nur, ich meine auch, das und das sei unerwünscht. Ebenso meine ich, das und das sei un-erfreulich oder erfreulich, zu missbilligen oder zu billigen.2 Da scheint nun das positive Glauben eine Ausnahmestellung einzunehmen. Für das Unglauben wäre es so wie mit den anderen Akten, sie können von einem Meinen beseelt sein oder nicht. Gibt es etwas Klareres? Und es ist in der Tat so. Nun könnte man aber einwenden: Gibt es denn nicht auch ein Glauben, das nicht von einem „Meinen“ beseelt ist? Da könnte man denken an das Übergehen von Akt in Akt im Bewusstsein der Einheit, sozusagen einer Identifizierung, die aber noch kein Meinen ist, kein meinender Akt der Identifizierung, oder an das Wahrnehmen, in dem ich in gewisser Weise lebe,

1

Wohl 1910/11. – Anm. der Hrsg. Zunächst scheint es, als wollte ich Meinung als Doxa und Meinung als „Zuwendung“ verwechseln. Das wird dann aber aufgeklärt. 2

334

5

10

15

20

25

30

35

zur analyse der stellungnahmen

während ich das Wahrgenommene nicht meine.1 Speziell etwa das Empfinden und das Sich-ins-Empfinden-Hineinmeinen. (Der Ausdruck der Logischen Untersuchungen „in etwas leben“ für „meinen“ wäre also zu verwerfen.) Es taucht ein Gedanke auf, ein Satzgedanke, ein Urteilsgedanke, ich bin dabei „überzeugt“, sofern es schon das Glaubensartige hat. Aber mein Meinen geht in eine andere Richtung; es lebt sich nicht in den Akt ein. Wir hätten dann Fälle 1) von „Akten“, in die gar nichts von Meinen hineinleuchtet, und 2) andere Fälle, wo auf meinende Akte sich neue Aktcharaktere bauen, in die das Meinen sein Licht nicht hineingeworfen hat. Also wäre die Ordnung hergestellt? Indessen, hier heißt es, das M ein e n a ls δξα und das Me i ne n a l s A uf m e rk e n zu unterscheiden. Zunächst frage ich: Ist Wahrnehmen an sich schon urteilend Glauben, also auch, wenn der „meinende“ Blick fehlt? Und ist der meinende Blick wieder nur ein Blick, ein Wahrnehmen? Ist nicht das Meinen, d u rc h d as d as W a h r ne h m e n zu e ine m „ G la u be n “ w ir d, vielmehr eben ein Setzen, einen Gegenstand erfassen, als Dies ansetzen, an ihm etwas setzen oder finden etc., kurzum, schlicht vorstellende Setzung und Urteilssynthesis? Wir hätten also zu sagen: A) Meinen als Setzen, Subjekt-Setzen und Prädikat-Setzen, In-Bezug-Setzen und In-Verbindung-Setzen usw., kurzum, Meinen als Urteilen, das ist etwas, das sich in allem Bewusstsein, das nicht Setzen in diesem Sinn ist, etablieren lässt. Das ist Meinen als δξα.2 B) Das lässt freilich noch Unterschiede zu: Diese Meinung als Glaube, als Überzeugung kann Unterschiede der „Aufmerksamkeit“ haben, wie wenn ich nebenbei auf eine Rede achte und dabei Setzung vollziehe, während mein „Hauptinteresse“ in anderer Richtung liegt. Ebenso wird man eventuell sagen können, dass schon ein Gedanke als eine Einheit der Setzung bewusst ist, uns bewegt, während wir doch noch einem anderen zugewendet sind. Diese Unterschiede der Aufmerksamkeit etc. verbinden sich also mit der Setzung. Es wäre hier zu sagen, dass der Unterschied des „identifizierenden“ Einheitsbewusstseins, etwa des der Erfüllung, und des „synthetischen“ Identifizierens als der Urteilssynthesis eben der ist, dass sich „aufgrund“ des Einheitsbewusstseins eine beziehende Setzung etabliert hat. Freilich, es ist die Frage, ob Aufmerksamkeit als primäre Bevorzugung möglich ist ohne Setzung, ob man z. B. sagen soll, wir seien auf den in gewisser 1 Ich bin dem Wahrgenommenen nicht zugewendet, z. B. der Umgebung des Objekts der wahrnehmenden Zuwendung. 2 Vorher aber doch das schlichte Setzen der Wahrnehmung (mit Zuwendung), der Erinnerung etc., ferner der betrachtenden, explizierenden Wahrnehmung: Das muss sub A auseinandergehalten werden.

beilage xxv

5

10

15

20

25

30

335

Art doch bevorzugten Empfindungsinhalt eines setzungsmäßig gemeinten Merkmals „aufmerksam“, obschon wir ihn nicht „meinten“. Oder wir seien wünschend oder vom Wunsch „erfüllt“ oder uns lebendig freuend auf Erfreulichkeit etc. aufmerksam, nur dass wir es nicht „meinten“ und urteilsmäßig setzten?1 Aufmerksamkeit wäre dann aber kein Akt, wohl aber das Setzen. Und wie jeder Akt lässt auch das Setzen seine Modifikationen des Aufhebens, des Zusammenstimmens, des Anmutens, des Zweifelns etc. zu. Und dabei besteht das Gesetz, dass jeder nicht-setzende Akt „Grundlage“ eines Setzens werden kann, der ihm eine „Gegenständlichkeit entnimmt“, also auch jede jener Modifikationen des setzenden Aktes selbst. Einiges sah ich davon jedenfalls in den Logischen Untersuchungen. Ich stellte nun gegenüber Setzen und Nichtsetzen, das Nichtsetzen verstanden als die Modifikation der Inaktualität. Aber das ist eine Modifikation, die jeder Akt erfahren kann. Wir haben für das Setzen die Modifikationen Setzen (= doxische Gewissheit), Anmuten, Vermuten, Zweifeln etc.2 und für jede dieser die Inaktualitätsmodifikation. Wir haben für jede Grundklasse von Akten die Modifikationen Gewissheit, Anmutung, Vermutung, Zweifel, Übereinstimmung etc., auch nichtiges Bewusstsein, das aber eine Modifikation aller dieser Modi ist. Also eine eigene Dimension und zu jeder gehörig ein Unterschied der Aktualität und Inaktualität. Wir haben das allgemeine Gesetz, dass jeder Akt, der nicht von einem Aufmerken beseelt ist, in die Aufmerksamkeitsmodifikation übergeführt werden kann;3 ferner, dass jeder Akt, der nicht doxisch ist, in die δóξα durch eine gewisse Modifikation übergeführt werden kann: Aus jedem Akt kann das (in Gewissheit) urteilende Meinen eine Urteilsgegenständlichkeit entnehmen; j e de r Ak t is t ob j e k t iv i er en d , so fe r n er e in e in te n tio n al e G ege ns t än d li ch k e it „ i n s ic h b ir gt “.4 Aber nicht jeder Akt ist im eigentlichen Sinn objektivierend. Nämlich das „Meinen“, das Objektsetzen, die δóξα ist derjenige Akt, der die einzigartige Funktion hat, irgendetwas als Gegenstand bewusst zu machen, Gegenstände-worüber und Sachverhalte zu setzen. Und i m pr äg n a nt e s t e n S i n n is t bl o ß d ie G ew is s he it d er Se t z un g de r o bj ek t ivi e r e nd e Akt. 1 Ebenso: In der identifizierenden Deckung lebend, wir seien da auf die Identität aufmerksam, aber wir meinen sie nicht? 2 Gattung δξα bezeichnet durch ihre Gewissheit. 3 Aufmerksamkeit = Zuwendung 4 Das Urteil im prägnanten Sinn hat einen ganz einzigartigen Vorzug, und Urteil im prägnanten Sinn besagt ausschließlich das Für-doxisch-gewiss-, das Für-wahr-Halten; also der Urakt in der obigen Reihe der doxisch setzenden Akte (nur Gewissheit ist eigentliche Setzung).

336

5

10

15

20

zur analyse der stellungnahmen

Es bleibt nun die Frage nach dem B e g ri f f d es U r t eil s. Sprechen wir von Urteil schlechthin, so meinen wir ein Für-wahr-Halten, nicht ein Fürvermutlich-, Für-möglich-und-wahrscheinlich-, Für-zweifelhaft-Halten etc. Das sind Modifikationen, die das Für-wahr-Halten erfahren kann, wie sie ähnlich jeder andere „Akt“ erfahren kann, jede andere „Stellungnahme“. Im Gewoge der intentionalen Erlebnisse heben sich die „Stellungnahmen“, die Akte im besonderen Sinn, heraus: die „Gewissheiten“, die Stellungnahmen schlechthin, die Urakte. Wenn ich von Setzung in den Logischen Untersuchungen spreche und von Urteil, ist immer ein doxisches Gewissheitsbewusstsein, ein Für-gewiss-, Für-wahr-, Für-seiend-Halten gemeint. Für-wahrscheinlichHalten ist nicht Urteilen, sondern eine Urteilsmodifikation (modale Abwandlung). Zu diesen gehört auch das Nichtigkeitsbewusstsein. Jedes Urteil ist eo ipso „affirmativ“ oder besser positiv.1 D er Be g ri f f d e s U r t eils he bt al s o e in d ur c h d ie o b en b e ze ic h n et e G e se t zm äß i g k ei t a u sg e z e ic h n et e s G lie d a us d e r i m w e it er en S in n d o xi sc h en S p h är e , d e r Sp hä r e d e r lo gi sc h en E rl eb n is se h e r a us. Es ist der Grundbegriff der reinen Logik, auf den alle anderen logischen Begriffe zurückbezogen sind. Auf ihn bezieht sich der Begriff der Wahrheit, der fundamentaler ist als der Begriff der Wahrscheinlichkeit etc., einfach darum, weil das Urteil es ist, das dem Für-wahrscheinlich-Halten die Wahrscheinlichkeit „entnimmt“, sie setzt, sie urteilsmäßig objektiviert usw. Eben darum ist die apophantische Logik die fundamentalste.

1 Zu bemerken ist, dass das Nichtigkeitsbewusstsein nicht einfach in eine Reihe zu stellen ist mit Gewissheit und Ungewissheit, oder besser: mit den Modi der Ungewissheit, denen allen „Gewissheit“ gegenübersteht als „Setzung“. Vielmehr bildet das Nichtigkeitsbewusstsein eine eigene Dimension. Wir haben für alle Grundklassen die Unterschiede: Gewissheit (feste Stellungnahme, Position) und Negation (Nichtigkeitsbewusstsein); demgegenüber die Abwandlungen der Ungewissheit, zu jeder Abwandlung eine eigene „Negation“ gehörig. Zu bemerken ist es, dass alle diese Modifikationen nicht möglich sind überall, in jedem Fall. Beim inneren Bewusstsein z. B. sind sie insgesamt nicht möglich, da gibt es nur den Urakt.

beilage xxvi

337

Beilage XXVI Stehen das Wünschen und Werten dem Setzen der Doxa gleich? Gibt es vor dem sich richtenden Wünschen und Werten schon ein blindes, sich nicht richtendes? Die elektive gegenüber der schöpferischen Funktion der Akte. Inwiefern haben Phänomene in der Sphäre der Vorgemeintheit Wesensgemeinschaft mit setzenden Phänomenen?1

5

Das Meinen als theoretisches, setzendes (doxisches) Meinen und sein 10 Substrat. Hier liegen große Schwierigkeiten.

15

20

25

30

35

Es scheint so beim ersten Anblick, als ob man sagen könnte: Wir haben Erscheinungen, etwa Dingerscheinungen, vor der setzenden Zuwendung, und dann kommt das Setzen entnehmend nach und „entnimmt“ der Erscheinung den Gegenstand, macht die Erscheinung zum Substrat etwa einer schlichten Setzung. Aber da ist die Schwierigkeit: Aufgrund derselben Erscheinung kann sich das setzende Meinen verschieden „richten“. Es kann sich auf einzelne Teile und Momente richten, es kann sich auf den Empfindungsgehalt, auf die „Auffassung“ richten usw. Das Meinen meint heraus, es gliedert, es gründet sich Meinen auf Meinen, wobei immerfort dasselbe Substrat zugrunde liegt und sich seinem Inhalt nach doch wieder verteilt etc. Wie eine sinnliche Erscheinung, so kann ein „sich richtender“ Akt des Wünschens, des Wollens oder ein latentes Wünschen, Wollen zum „Substrat“ werden für ein Setzen und für eine Synthese von Setzungen, für ein Explizieren, Prädizieren etc. Andererseits ist es unverkennbar, dass p h än o m e n o l o g i s c h do c h ni ch t e in e u n ve r än d e rt e Er s c he in u n g b loß e in en S tr a hl d e s „ M ei n e ns “ in s ic h a u fn im m t, dass nicht etwa die bloße Qualität des Setzens inhaltsleer, als ein leerer Strahl, hineinleuchtet in die „Erscheinung“. Ebenso ist es klar, dass die Sachlage doch charakteristisch unterschieden ist, ob ich „vollbewusst“ wünsche, wünschend zugewendet bin einem Erwünschten, und dann den setzenden Akt auf den Wunsch richte, prädiziere und dgl., oder ob ich das Setzen auf einen wahrgenommenen, aber noch nicht erfassten Gegenstand richte; also ob mir jener Wunsch oder diese latente Wahrnehmung als Substrat dient. Auch das ist ein P ro b le m , ob d as Wü n s c he n , d a s W o lle n , d as S ic hFr e uen , W e r te n gl e ic h st eh en d e m „ S etz e n “ d er D o x a (ob dem theoretischen Setzen ein wünschendes, wertendes, wollendes Setzen parallel

1

Oktober 1911.

338

5

10

15

20

25

30

35

40

zur analyse der stellungnahmen

geht) und ob, wie das theoretische Setzen eine „blinde“ Erscheinung beseelen kann, in ähnlicher Weise das wünschende etc. Setzen dies zu tun vermag. Wir haben ein setzendes Wahrnehmen. Vor dem Setzen haben wir aber auch schon ein „Wahrnehmen“, haben da in der Weise der „Zuständlichkeit“ schon den „Glauben“, der sich in der Zuwendung aus Zuständlichem in spontanen Glauben, in theoretisches Setzen verwandelt? Oder haben wir etwas anderes, wonach sich das theoretische Setzen „richtet“? Ebenso können wir dann fragen: Gibt es vor dem sich richtenden Werten, Wünschen, Wollen etwa schon ein „blindes“, ein sich nicht richtendes, das aber doch ein „verborgener“ Wunsch, ein verborgenes Werterscheinen, ein verborgenes Wollen (als „dunkler Trieb“) ist? Und richtet sich bei der „Zuwendung“ das spontane Wertsetzen, Wunschsetzen etc. (sich richtende Werten etc.) nach dem blinden und seinem Charakter? Nicht jedes „sehende“ Wahrnehmen, setzende, zuwendende, ist Zuwendung, der vorausgegangen ist ein blindes. So z. B. spielt sich jetzt vor meinen Augen ein Vorgang ab, den ich mir ansehe, den ich sehend erfasse. Ebenso natürlich auch bei den anderen Akten. All das ist das Thema des Verhältnisses von Spontaneität und Rezeptivität. Es ist die Frage, wie Denken, betrachtend, auswählend, bestimmend, einerseits sich als e le k tiv e F u n kt io n, andererseits als s c h öp f er is c h u n d a b er m a l s G eg en s t än d li c h k eit en k on st i tu ier e n d geben kann. Und ebenso für alle Akte. Auch sie haben elektiven Charakter, sie zeichnen aus, dem Betrachten entspricht das Be-fühlen, dem Bestimmen, was eine Sache in sich ist und in Bezug auf anderes ist, entspricht das befühlende Werten der Sache an sich und in Gefühlsbeziehung zu anderem usw. Im Übrigen ist das Reden von Elektion ein Bild, das Reden von Zuwendung, Setzung, Erfassung ebenso (ich könnte ja auch davon sprechen, dass ich eine Gegenständlichkeit mit dem Gefühl erfasse, mich mit ihm befasse etc.). Was kann also Richtiges daran sein, wenn ich von th eo r e tis c h e r S et z u ng un d ih r e m „ S u b st r a t “ sprach und so redete, al s o b S etz u n g e in A k t wä r e, d er si c h a u f e in e n z we it e n Akt , d en s u b s tr u ie re nd e n , d en Sub st r at ak t b ezi e ht, w ob e i d a s S ubs tr a t au c h s e in kö n n t e „ o hne S et z un g “? Natürlich kann das nicht ernst genommen werden. Es handelt sich um gesetzmäßig zusammenhängende Modifikationen von Phänomenen. Ich wende den Blick auf eine Sache, die mir erscheint schon vor diesem Blick. Da hätten wir eine Hintergrunderscheinung. In dem wahrnehmenden Erfassen habe ich Zuwendung, Gerichtetsein auf und Erfassen von Wirklichkeit. Das Phänomen, die Erscheinung, die ich jetzt habe, ist etwas anderes als die vorhin. Und was ist jetzt Erscheinung, was gehört zu ihr? Ich wende mich dem Empfindungsgehalt zu und sage dabei, die „Erscheinung“ sei noch immer da und im Wesen dieselbe etc. Was da für Modifikationen

beilage xxvi

5

10

15

20

25

339

vorliegen, das zu beschreiben ist das Problem und die Schwierigkeit. Auch wird man doch sagen, dass mit der Zuwendung die etwa schon vor ihr anzunehmende „Auffassung“, „Erscheinung von“ Bereicherung, ja völlige Veränderung – auch qualitativ – erfahren könnte. Also richtet sich die jetzige Setzung doch nicht so ohne weiteres nach der blinden Erscheinung. Es ist nach all dem sehr wichtig z u s tu d i er en: 1) was man von der Sphäre der Vorgemeintheit, der Sphäre von angeblichen Erscheinungen vor der Setzung aussagen kann, inwiefern man da Phänomene annehmen kann, die Wesensgemeinschaft haben mit setzenden Phänomenen, und inwiefern geschieden werden kann in den setzenden Phänomenen ein Kern, ein „Substrat“, eine „Materie“, die speziell diese Gemeinschaft hat, inwiefern Charaktere wie Sein, Wirklichkeit sich schon vor der spontanen Zuwendung konstituieren, wie Charakter des Seins sich konstituiert, wie Zuwendung und theoretische Setzung als Setzung eines Seins zueinander stehen. 2) Insbesonders ist auch zu studieren, inwiefern in der Sphäre der Vorgemeintheit schon Wertcharaktere, Sollenscharaktere und dgl. sich darbieten und wie sich diese konstituieren. 3) Es ist genau zu studieren die Art von Modifikationen und die verschiedenen möglichen Modifikationen, die dem Übergang von Ungemeintheit in Gemeintheit entsprechen, und zwar dem Übergang von dunklem Gefühl, Bestreben etc. in Gefühlsakt, Strebensakt, dem Übergang von dunklem Seinserscheinen in Seinssetzung, in Seinserfassung, dem Übergang vom Gefühlsakt, Freudenakt, Willensakt in Seinserfassung von Erfreulichem in seiner Erfreulichkeit, von Wertem, von Seinsollendem und Bildung von prädikativen Urteilen über Werte etc.

Nr. 17 Z u we nd u ng u nd S et z ung. Ric ht un gen d er Z uw en d un g 1

§ 1. Bloße Zuwendung zu einem Erscheinenden gegenüber der theoretischen Setzung. In den Urteilsfunktionen der Setzung erwachsen neue Erscheinungen

5

10

15

20

25

Zuwenden, Erfassen, Glauben, Setzen, Meinen. Unglauben: Im Bewusstsein des Unglaubens bin ich in gewisser Weise zugewendet dem „Inhalt“ „S ist p“, im Unglauben ist mir das „S ist p“ „bewusst“.2 Im Glauben bin ich mir wieder bewusst des „S ist p“ – „S ist p!“ –, ein anderes Mal des „S ist nicht p!“. Im Unglauben „erscheint mir“ zwar das Nichtsein, aber i c h „ se tze “ e s n i c ht, ich habe es nicht ins Glauben aufgenommen, eine Setzung etabliert, die das „Erscheinende“ setzt. Die Setzung ist der theoretische „Glaube“ als Urteil im gewöhnlichen Sinn. Ihr steht gegenüber die Anti-Setzung, der Unglaube, in der das Nichtsein erscheint, aber nicht als das zur positiven Setzung kommt, eventuell auch als „Dass S p ist, das ist nicht so!“. Ich vermute, dass S p sei. In gewisser Weise habe ich dabei die „Erscheinung“ der Vermutlichkeit, der Wahrscheinlichkeit. In der Vermutung selbst habe ich die Qualität, theoretische Meinung im Modus Vermutung, und die Materie; ich könnte sagen, ich habe in ihr die „Erscheinung“ „S ist p“ qualifiziert in der Weise der theoretischen Vermutung. Zugewendet bin ich in der Weise der Vermutung dem „S ist p“, dem erscheinenden Inhalt. In der Weise der Vermutung zugewendet sein, das macht eine qualifizierte Erscheinung, und nun kann sich eine setzende Zuwendung, eine „meinende“, auf das Erscheinende, auf das „Vermutlich ist S p“ richten.

Oktober 1911. – Nota bene. – Vgl. O1 p. 16 = S. 325,16–327,8. Da geht Substrat und Materie durcheinander und wieder Qualität und Modus. Aber gleichwohl sind die Blätter wichtig. 1 2

text nr. 17

5

10

15

20

25

30

35

341

Nun ist aber zu überlegen: Ich habe 1) das „S ist p“, die Materie; 2) seine Vermutungsmodalität, und das macht das Ganze einer „modalisierten Erscheinung“. Und diese qualifizierte Erscheinung ist „Impression“ bzw. Aktualität. Ist nun die Erscheinung, die qualifizierte Erscheinung (theoretisch qualifiziert, und zwar mit dem Modus Vermutung), schon im Voraus mit dem Charakter des Glaubens da und korrelativ das Wahrscheinlichsein mit dem Charakter des Seins, und die „Z uw en d un g“ richtet sich einfach darauf? Natürlich ist das Unsinn. Wir haben zunächst die qualifizierte „Erscheinung“. Was ist da das Zugewendetsein? Indem ich vermute, bin ich dem Vermuteten zugewendet. Ich kann auch sagen, mit dem Vermuten wende ich mich dem Vermuteten zu. Was besagt das aber wieder? Es steht doch das Vermutlichsein des „S ist p“ da, das ist „bewusst“, dem bin ich zugewendet. Zugewendet heißt aber nicht, das ist „theoretisch gesetzt“, und theoretische Setzung ist nicht dasselbe wie Glaube, obschon sie selbst den Modus Gewissheit hat. V i elm ehr is t e s et w a s N e ues , das s i c h d i e t he o r e t i s c he S e t z ung vo llz i eh e. Was tue ich da? I ch ko n st i t ui e r e e i n e ne u e Ge g en s t änd l i ch kei t , i ch erz e uge e i n e n e ue E r s c he i n ung , i n d er n u n ei n and er e s er sc he i nt. Nicht steht einfach das „S ist p“ im Charakter des „wahrscheinlich“ da, nämlich ich vermute nicht bloß, sondern es steht das Wahrscheinlichsein des „S ist p“ als Sein da, das Sein der Wahrscheinlichkeit des Inhalts „S ist p“. Bei jedem Bewusstsein kann ich auf den Inhalt reflektieren und den Charakter des Inhalts auf diesen beziehen. Nehmen wir eine schlichte sinnliche Erscheinung. Sie hat den Charakter des „wirklich“ oder des „nichtig“ oder des „zweifelhaft“ etc. Ich bin ihrem Gegenständlichen zugewendet und habe dann in der Zuwendung das Bewusstsein eines Wirklichen oder eines Nichtigen oder eines Vermutlichen etc. Ich kann auch sagen: Ich halte das für wirklich, für nichtig, für vermutlich; ich vermute sein Sein etc. (ich vermute es nicht selbst); ich halte dafür, dass es nicht ist (ich vernichte es nicht) usw. Und wenn ich nicht zugewendet bin, halte ich auch für seiend, halte ich für zweifelhaft, ob es ist, halte ich dafür, dass es nicht ist usw.?1 Oder sollen wir sagen: E s s i nd 1

Nein. Die Erscheinung ist thetische Zuständlichkeit und hat ihren Modus Gewiss-

342

5

10

15

20

25

30

35

zur analyse der stellungnahmen

d a versc h ied en m o dal isi er te E rsc hei nu n ge n, b a ld in d e r Z u w end u n g, b ald o hn e Z uw en d un g? D i e Z u we nd u ng g e h t au f d as „ E r sc h ei nen d e “, a uf den „ G e ge ns ta nd “, der charakterisiert (in korrelativem Sinn) ist, si e „ s e tz t “ n ich t , s ie h at n ic h t s vo n Qu ali f iz ie ru ng. Geht so der Strahl der Zuwendung, so ist die Erscheinung Erlebnis, es erscheint etwas, und es hat seinen Charakter, seine Wertprädikate, in bestimmter Modalität, seinen „Wertcharakter“ und nichts weiter. Etwas anderes ist es, zu urteilen und U rt eil s fu nk ti on en d e r S e t z un g z u  vo l lz ie hen, die Dies-Setzung, Darauf-Seztung etc. Und dabei erw ac h s en n e ue „ Er sc h ei nun ge n “, d i e s el b st wi e de r v ers ch ie den b ew ert e t sei n kö n ne n. Das Wesen der unteren Bewertungen kann die neuen bestimmen und tut es; sie richten sich nach ihnen. Steht etwas für wirklich da in einer Wirklichkeitserscheinung, so setze ich dies und expliziere die Erscheinung, wie sie es ihrem Wesen nach zulässt, und das Ganze hat wieder den Charakter des „wirklich“, des Seins. Oder wir haben die Bewertung des „zweifelhaft“, und nun hat das explizierte Ganze, hat das „Dies ist p“ etc. auch den Charakter und je nachdem. Der Wert des „Zweifels“ kann in Unterstufe das Phänomen betreffen, aber in verschiedener Weise: derart, dass z. B. das Sein des ganzen Gegenstandes nicht als zweifelhaft bewusst ist, sondern nur irgendein Moment (der Zweifel auf das Ganze nur um des Moments willen bezogen); in der Explikation sondert sich das speziell Zweifelhafte, Nichtige etc. Da n a c h s c h ei d e t s i ch da s b l o ße Zu we n de n , da s b loß e E rfa sse n v o n de m n e u e „ Er s ch e i nu ng “ , ne ue G e ge n stä n dlic hke i t K o n s t i tu i e r e nd e n ; und d i e Zu we n du ng zu ei n em E rsc hei n e n de n i s t ni c h t z u v er w e ch s e l n m i t de r D ie s - Set z un g u n d je d e r A r t p r ä d i k a t i v e r , ü be r ha u pt t he o r e ti sc he r S etz u ng, d i e da s e r s c h e i ne nd e Se i n, N i cht s e i n, d a s e rs ch ei ne n d e Z we i f e l ha f t - , W a h rs c he i nl i c hs e i n i n de r U r te i ls f or m o bj e k t iv i e r t: als dies – dies, dass S existiert, oder dies Ding da (diese Wirklichkeit), diese Fiktion, oder dass S p ist (dieser bloße „Inhalt“), ist wirklich so, ist wahrscheinlich etc. D a s t he or e ti s c he, p r äd i k at i v e M e in e n i st f e r ne r ni ch t oh ne w e i te r e s heit etc., aber Für-seiend-Halten etc., das sagt, thetische Spontaneität der Setzung vollziehen.

text nr. 17

343

G l au b en, Unglauben, Zweifeln etc., sondern eben t he o re ti s c h e s Glauben, theoretisches Meinen etc. Das sagt, dass diese durch Glauben etc. bezeichneten angeblichen Qualitäten nicht theoretische Qualitäten, sondern Modalitäten sind, 5 und dass das Theoretische nicht darin liegt, sondern in dem Eigentümlichen des „Erscheinens“, in dem Eigentümlichen, das sich im Dies, den ganzen Formen der Prädikation bekundet. In dieser Hinsicht steht das Eigentümliche des theoretischen Meinens auf einer Stufe mit dem Eigentümlichen des sinnlichen Erscheinens, aber auch 10 des Wünschens, des Wollens, des Gefallens etc.

§ 2. Lust und Unlust als Erscheinungscharaktere. Verschiedene Richtungen der Zuwendung bei einer qualifizierten Erscheinung. Jede Zuwendung als Erfassung kann zur theoretischen Setzung werden Nun fragt es sich aber, wie ist es dann: Hat also das sinnliche Erscheinen mit dem theoretischen Meinen nicht doch gemein, dass wir bei jenem die „Qualitäten“ Glaube, Unglaube etc. finden und bei diesem wiederfinden?1 Und wie ist es mit Gefallen, Missfallen, Wünschen und Widerwünschen, Wollen? Wir haben sinnliche Erscheinun20 gen, sie haben ihre Modalität des Glaubens etc. (das Erscheinende hat den Charakter des „wirklich“, der Fiktion, des „zweifelhaft“ etc., mag der Charakter dabei fundiert sein oder nicht usw.),2 und das sinnlich Erscheinende steht auch als gefällig da (im Modus der Gewissheit, Anmutlichkeit etc.), erfreulich, erwünscht etc., oder es 25 steht als Handlung, als Tat da. Wir haben neue „Erscheinungen“, die alten Erscheinungen haben neue Qualifizierungen. Hat nicht schon der Empfindungsinhalt (auch die Empfundenheit im weiteren Sinn) seinen Lustcharakter oder Unlustcharakter? Kann man nach dem auf dem vorigen Blatt3 Gesagten 15

1 Also gehören sie darum zusammen als Objektivationen? Darum nicht, da dieselben Modalitäten sich bei allen Akten finden; aber aus anderem Grund gehören sie zusammen: Es entsprechen sich Zuständlichkeiten und Akte in jeder Klasse. 2 Sie haben aber einheitlich die Qualität der theoretischen Zuständlichkeit. 3 Siehe S. 341,34–343,18. – Anm. der Hrsg.

344

5

10

15

20

25

30

zur analyse der stellungnahmen

noch behaupten: D em b e li ef st eht g lei c h d er L ust ch ara k te r, als Lustzuständlichkeit vor der Zuwendung? Lust (Gefallen) charakterisiert in demselben Sinn wie Glaube! Und wie Glaube ein Charakter ist, der seine Modifikation hat in Negation, in Anmutung, Zweifel etc., so auch Lust (Lustgewissheit, -anmutung, -zweifel, -aufhebung: Negation).1 Wie aber steht es mit Folgendem: Indem sich das Erscheinende als lustvoll charakterisiert, erscheint es als Angenehmes, ob in der Zuwendung oder vor ihr. Wende ich mich nun zu, so betrachte ich das Ding mit Wohlgefallen oder genieße die Lust an ihm. Was ist das? Ich habe nun Zuwendung zu dem Erscheinenden, und das ist als daseiend und als angenehm, schön etc. charakterisiert. Ich kann dabei Urteilssetzung üben, ich setze dieses Ding da, und urteile „Dies ist ein Haus“, ich kann auch urteilen „dieses angenehme Haus“, „Dieses Haus ist angenehm“ etc., „dieses existierende Haus …“. G i b t e s v e r s c hi ed e ne R ic ht u n gen de r Z u we nd u ng? Ich wende mich dem „Gegenstand“ zu, dem Substrat für die Qualifizierungen, dem Erscheinenden als solchen. Ich wende mich seinen Teilen zu; ich vollziehe Explikation, das führt auf konstituierende Bestimmtheiten etc. Ich expliziere aber nicht, indem ich auf den Charakter der Wirklichkeit und dgl. achte. W or a u f d e r B l i ck d e r Zu we n d u n g f äl lt , d a s k ann al s ei n D i e s g e s e t z t u n d s o mi t t h e or e t i s c h ob j ekt i vi e rt w er de n. D i e Zu w en d u ng s e l bs t e r f a s s t, s e tz t a be r ni ch t th eo re t is ch. Wie erfolgt diese theoretische Objektivierung? Wie steht sie zur unterliegenden Erscheinung? Wie ist es nun mit der Dies-Setzung eines bloß „Erscheinenden als solchen“, dessen Qualifizierung etwa „nichtig“ ist, wenn ich sage „Dies, dass S p ist, das besteht nicht“? Da ist der „propositionale Inhalt“ als seiend gesetzt. Sage ich „Dieses Haus!“, so habe ich die in Seinsqualität qualifizierte Hauserscheinung, und aus ihr „entnimmt“ das Dies den Gegenstand-worüber. Ich bin dem Erscheinenden zugewendet. Die Zuwendung geht durch

1 Ist es nicht besser zu sagen: „Nicht belief, sondern Urteilssetzung als synthetische Setzung und prädikative Setzung!“? Und weiter: Der bloße belief sei der bloße Modus der Vorstellung, des Gefühls, des Prädizierens etc. Seine Charakterisierung liegt in einer anderen Dimension als die Charakterisierung als gefällig, die ein neues Prädikat ist.

text nr. 17

5

10

15

20

25

30

345

eine qualifizierte Erscheinung. W enn i c h m i c h nun abe r e i n ma l dem „ In h al t “ un d d as an d ere M al d er „ Q ual i tät “ zu we nd e , h abe i c h da e ine z wei t e Er s ch ein u ng, d i e S ei n ser sc he i nun g vom bl oße n In h al t ist , u nd wi ede r e in e , di e Se i nse rs che in u n g v om S e in i s t? Ebenso wenn ich wünsche, dass S p sei: Dass S p ist, ist erwünscht. Ich blicke auf den propositionalen Inhalt hin und auf die Qualifizierung, und jedes wird „gesetzt“. Das ist eine bedenkliche Schwierigkeit. Eines ist sicher: W enn w i r e in e q u ali f iz i er te E r sc he i nu ng h a b en , so kan n s ic h di e Z uw end u n g v er s ch ie de n „ r ic ht e n “ ; ich kann aufmerksam sein, mich speziell einstellen auf den Inhalt der Erscheinung und irgendein Moment des Inhalts, z. B. auf die Farbe dieses Hauses, seine Form. Dann schneide ich gleichsam aus der Gesamterscheinung eine Teilerscheinung zugleich heraus.1 Der Strahl der Zuwendung geht durch die Gesamterscheinung, sofern sie aus sich diese Teilerscheinung entlässt. Ich kann aber auch gerichtet sein auf das Moment der „Qualität“, auf die „Wirklichkeit“. Das liegt freilich in einer anderen Dimension, aber die „Wirklichkeit“ erscheint auch, wenn schon in einem anderen Sinn; ebenso die Nichtigkeit, die Vermutlichkeit „erscheint“. Einmal expliziere ich den Inhalt des Gegenstandes, das erscheinende Haus als solches, das andere Mal in ganz anderer Weise das Sein, das Nichtsein, das Vermutlichsein etc. Sollen wir nun so darstellen: J e d e r Zuw en dun g m u ss ei ne E rsc hei n u n g z u g r u nd e l i e g e n, und zwar kann die Zuwendung sich richten auf die gesamte qualifizierte bzw. modalisierte Erscheinung (oder vielmehr auf das gesamte Erscheinende in seinem Wertcharakter) oder sich richten auf die Erscheinungskomponenten, auf Inhalt und Wertcharakter, in erster Linie auf Teile des Inhalts und Momente, eventuell auch auf bewertete Komponenten, auf Teile in ihrem Wertcharakter etc.? Jede Zuwendung ist Erfassung und kann zu theoretischer Setzung werden. Diese theoretische Setzung bringt ihre Modalität mit sich,

1 Das Problem ist hier, wie die Zuwendung sich zur qualifizierten Erscheinung verhält und wie Zuwendung zu Inhalt und Charakter, wie Zuwendung zu Teilen und Momenten des qualifizierten Gegenstandes möglich ist und phänomenologisch statthat.

346

5

10

15

20

25

30

zur analyse der stellungnahmen

wenn eben die Setzung das Erfasste theoretisch setzt. Habe ich als Erscheinung die Hauswahrnehmung, so kann ich sagen „dieses Haus“ und „Dieses Haus ist fest gebaut“, und dann ist selbstverständlich gesetzt die Wirklichkeit des Hauses, deutlicher das wirkliche Haus in seiner Wirklichkeit, und das wirkliche Haus ist (in Wirklichkeit) fest gebaut, oder in Wirklichkeit ist das Haus fest gebaut. Achte ich auf den „bloßen Inhalt“ Haus, so mag dazu explikativ (analytisch) gehören das Festgebautsein, aber nun heißt es: „In der ‚Vorstellung‘ (im Inhalt) ist das Haus fest gebaut“, und auch das hat seine Wahrheit. Und wieder kann ich vom Inhalt aussagen, dass er Inhalt einer Wirklichkeit ist; ich kann das „wirklich“ als Prädikat des Inhalts setzen, den ich ebenfalls als