Biographisch-Literarisches Handwörterbuch der exakten Naturwissenschaften: Band 7b, Teil 4 Lieferung 2 [Reprint 2021 ed.] 9783112525401, 9783112525395

Citation preview

J.C.POGGEIVDORFF BIOGRAPHISCH-LITERARISCHES HANDWÖRTERBUCH DER EXAKTEN NATURWISSENSCHAFTEN

Unter Mitwirkung der Akademien der Wissenschaften zu Berlin, Göttingen, Heidelberg, München und Wien herausgegeben von der Sächsischen Akademie

der Wissenschaften

zu

Leipzig

Band Vllb • Teil 4 2. Lieferung

Leitung der Redaktion

PROF. DR. H A N S S A L l E

AKADEMIE-VERLAG 1972

•

BERLIN

Redaktionsschluß: 31. 12.1969 Erschienen im Akademie-Verlag GmbH, 108 Berlin, Leipziger Straße 3—4 Copyright 1972 by Akademie-Verlag GmbH Lizenznummer: 202 . 100/425/72 Gesamtherstellung: VEB Druckerei „Thomas Müntzer", 582 Bad Langensalza/DDR Bestellnummer: 761597 7 (3050/IV/2) • ES 18 A 24,-

Hulthin - Humason conference on optical instruments, 1950 (London '51, New York '52) 97-: Diffraction gratings and the plane mirror, some new mountings»). W . Die Entwicklung der Wissenschaften in Schweden (Stockholm '42) 61 S. (Nachtrag zu „Schweden 1941"). Arkiy Fysik Reports from the conference of the Swedish National Committee for Physics in 1948 11 ): 1 ('50) 533-54; ~ 1949 11 ): 2 ('50/51) 211-32; ~ 1951 11 ): 5 ('52) 109-33. Diffraction gratings and the plane mirror 9 ): 2 ('50/51) 253-70. — Refraction gratings: 43941. — Examination of the resolving power of the diffraction grating 16 ): 3 ('51/52) 393-405. -T Spectroscopic intensity modulation: 4 ('52) 399-406. — Diffraction gratings in immersion 10 ): 8 ('54) 343-53. - On the absorption spectrum of iodine chloride, l 8 ) 14 ): 14 ('58) 31-48; ~ 2: Chlorine isotopes in iodine chloride 6 ) 8 ): 18 ('61) 479-512. Arkiv Mat., Astron. och Fysik Prädissoziationserscheinungen in den Hydridspektren der Hohlkathode: 27B (*40) Nr. 5, 3 S. - Reports from the conference of the Swedish National Committee for Physics in 1947 13 ): 34A ('48) Nr. 29, 20 S. Boll. sei. Fac. Chim. industr. Bologna Intensity modulated spectra and a new grating interferometer: 10 ('52). Kosmos [Stockholm] Nyare undersökningar över atomkärnans konstitution: 10 ('32) 69-. — Den tunga väteisotopen: 11 ('33) 128-. Nyare problem inom isotopforskningen: 17 ('39) 123-50. - Pieter Zeeman: 22 ('44) 14-. - Nobelpriset i fysik 1955: 33 ('55) 5-15. Nature [London] Nuclear spin and hyperfine structure in band spectra: 129 ('32) 56f. — Spectrum of bismuth hydride 3 ): 399. — Predissociation and pressure effects in the band spectrum of aluminium hydride 18 ): 131 ('33) 470f. — Pine structure and predissociation in the spectrum of calcium hydride 2 ): 132 ('33) 241 f. — Band spectrum of aluminium deuteride 4 ): 133 ('34) 496. - Isotope effect in the band spectrum of aluminium hydride 4 ): 796f. — Diffraction gratings in immersion 10 ): 173 ('54) 442 f. Naturwissenschaften Bandenspektroskopischer Nachweis der ungeraden Kadmiumisotopen: 24 ('36) 377. Physical Rev. Magnetic hyperfine structure in bismuth hydride and deuteride 10 ): 102 ('56) 1415f. Z. Physik Eine Untersuchung über die Bandenspektra des Aluminiumhydrides und Aluminiumdeuterides 4 ): 90 ('34) 712-27. Über die Dissoziationsschemata der zweiatomigen Hydride und Deuteride: 113 ('39) 12633. — Prädissoziationserscheinungen im Spekt r u m des Aluminiumhydrides 1 ): 114 ('39) 47077. 134 Poggendortf

2109

Mit: ') B. Grabe; •) B. Grundstrom; •) A. Heimer; «) W. Hoist; ') N. Jarls&ter; •) N. Johansson; ') E. Knave; •) L. Kofiman; *) E. Lind; ") H. Neuhaus; ") E. Rudberg; ») R. Rydberg; ") M. Siegbahn; ») U. Pilsater; ») U. Uhler. VI

HUMASON, Milton Lasell (La Salle). Astron. — 1917-48 Assist. Astronomer, Mount Wilson Observat., '48-54 Assist. Astronomer and Secretary, '54-57 Astronomer and Secretary, Mount Wilson and Palomar Observatories, Pasadena, Calif. - '50 Dr. phil. h. c. (Univ. Lund). *1891, Aug. 19, Dodge Center, Minn. Zur Biogr. P. J . T a y l o r , Explorer of outer space: Reader's Digest 69 ('56) 155-59. — Nature [London] 180 ('57) 360.

S. Vistas in astronomy (A. Beer) 2 (London-NewYork '56) (J. atmospher. and terrestr. Physics, Suppl. 4) 1620-28: Red-shifts in the spectra of extragalactic nebulae. — Planets and satellites (G. P. Kuiper, B. M. Middlehurst) (Chicago, 111. '61) (The solar system, 3) 572: Photographs of planets with the 200-inch telescope [m. 15 Abbildungen]. — Encyclopaedic dictionary of physics (J. Thewlis) 3 (Oxford-London-NewYork '62) 354f.: Recession of galaxies. — Encyclopaedia Britannica. A new survey of universal knowledge 11 (Chicago-London-Toronto . . . '65) 802f.: Edwin Powell Hubble (1889-1953). Astronomical J . Red-shifts in faint clusters of extragalactic nebulae: 69 ('54) 185f. — Solar motion with respect to the local group of nebulae 18 ): 60 ('55) 254-59. - Red-shifts and magnitudes of extragalactic nebulae 13 ) 16 ): 61 ('56) 97-162. - Report on supernovae 20 ) 5 ): 65 ('60) 504. Astrophysical J . Discovery and observations of stars of class Be, 2 14 ) 4 ): 76 ('32) 15683. — Spectral types of faint stars in Kapteyn's selected areas 1-115: 224-74. — The spectroscopic absolute magnitudes and parallaxes of 4179 stars 1 ) 10 ) 3 ): 81 ('35) 187-291. The apparent radial velocities of 100 extragalactic nebulae: 83 ('36) 10-22. — Revised spectral types of a group of stars in Kapteyn area 98: 86 ('37) 14-17. — The present spectral characteristics of sixteen old novae: 88 ('38) 228-43. — A search for faint blue stars 2 0 ): 105 ('47) 85-91. — Spectra and other characteristics of interconnected galaxies and of galaxies in groups and in clusters, l 2 0 ): 132 ('60) 627-39; ~ 2 2 0 ) : 133 ('61) 794-813; ~ 3 2 0 ) : 139 ('64) 269-83, 1393f. Gazette astron. Supernova Humason 8 ) 2 )') ): 42 ('60) 32f. J . astron. Soc. Victoria Supernova in NGC 4303: 14 ('61) 68. Leaflet, Astron. Soc. Pacific Supernovae: Nr. 88 ('36) 4 S. — Is the universe expanding ?:

18

2110

Humason — Humbert

search 6 ): 72 Nr. 91 ('36) 4 S. — Recent advances in astro- The 1959 Palomar supernova ('60) 208f.; ~ I960 —«) 11 ): 73 ('61) 175-81; nomical photography: Nr. 154 ('41) 6 S. ~ 1961 - 1 1 ) 0 ) : 74 ('62) 215-18. - Progress Monthly Notices roy. astron. Soc. E. P. report on supernovae 20 ) 6 ): 73 ('61) 351-54. Hubble, 1889-1953: 114 ('53/54) 291-95. Revista astron. Se expande el universo ? : 9 Naehrichtenbl. astron. Zentralstelle, Karls- ('37) 117-20. ruhe Supernova in sehr kleinem Nebel und in Scientific Monthly Evidence for an expandNGC 7331: Vorläufige Mitt. Nr. 419 ('59). ing universe: 43 ('36) 80-83. Nature [London] Supernova in Canes: 156 Außerdem Supernova-Beobachtungen aus ('45) 777. d. Jahren 1959-1961, veröffentlicht in: CircuNordisk astron. Tidsskr. Supernovae: 18 laire, Union astron. int. ; Harvard Announce('37) 18-22. ment Card; Yamamoto Cire. Proc. nation. Acad. Sei. USA The velocity- Mit: ') W. S. A d a m s ; ') S. Archer; •) A. M. Braydistance relation for isolated extragalactic t o n ; 4) C. G. B u r w e l l ; ') H. S. Gates; •) A. M. Gom e s ; ') E. P. H u b b l e ; •) H. H u t h ; •) A. F. J o n e s ; nebulae'): 20 ('34) 264-68. 10 ) A. H. J o y ; ") C. E. K e a r n s ; ") A. van Maanen; a y a l l ; ») P. W. Merrill; ») R. MinPubl., Amer. astron. Soc. The spectrum of ») N. U. M M the nebulosity emitted by Nova Persei No. 2: k o w s k i ; ) A. R. S a n d a g e ; ») R. F. S a n f o r d ; ") P. T e m p e s t i ; ») H. D. W a h l q u i s t ; ") F. 8 ('35) 115f. Z w i c k y ; s l ) R. E . W i l s o n . Publ. astron. Soc. Pacific A bright line of ionized helium, A 4686, in three stellar spectra VI HUMBERT, P i e r r e Marie. Math., with titanium bands 14 ): 44 ('32) 56f. - The emission spectrum of the extragalactic nebula Astron., Gesch. d. Astron. — 1919 Maître NGC 1275: 267 f. - The spectra of two novae de Conférences math., '21-53 Prof. tit. in the Andromeda nebula (M31): 381-85. — Math, pures, Univ. de Montpellier. — '34 The spectrum of the nebulosity emitted by Nova Persei No. 2: 46 ('34) 229-31. - The Prix Bordin (Acad. Sei. Paris). apparent velocity of a nebula in the Bootes *1891, Juni 13, Paris; cluster No. 1: 290-92. — The radial velocities fl953, Nov. 17, Montpellier. of three globular clusters: 357. — The spectra Sohn von Georges H u m b e r t I V _ V I of four white dwarf stars 1 ): 47 ('35) 52f. — The aluminizing of the 100-inch and 60-inch Nekr. B. R o c h o t , Revue Hist. Sci. et reflectors of the Mount Wilson Observatory: Appi. 7 ('54) 79f. - L'Astronomie (BSAF)68 81-83. — New velocities of extragalactic ('53) 85. - Tijdschr. Philos. 16 ('54) 363. nebulae: 223. — Red-shift in the spectrum of MH. Œuvres de G. Humbert 2 (Paris '36). NGC 4151 observed with a grating spectrograph 1 ): 48 ('36) 107 f. - The spectrum of a Ue. E. T. W h i t t a k e r , Le commencement supernova in NGC 4273: 110-13. - The par- et la fin du monde, suivi de: Hasard, libre 12 allax and spectral type of Ross 627 ): 179. — arbitre et nécessité dans la conception scienThe velocity of the spiral nebula, NGC 1003: tifique de l'univers (Paris '53) 186 S. (Sciences 50 ('38) 55. — The diffuse stationary line A d'aujourd'hui). 4430 in the spectrum of a binary star 1 4 ): 212 f. W . Pierre Duhem (Paris '32) 147 S. (Les - Velocity of NGC 4636: 51 ('39) 121. - The maîtres d'une génération). — Un amateur: new aluminum coat of the 100-inch reflector Peiresc, 1580-1637 (Paris '33) 325 S. (Temps a t Mount Wilson: 52 ('40) 145f. — A super- et visages, 5). — Exercices numériques d'astronova in NGC5907 16 ): 146 f. — The spectrum nomie (Paris '33) 6 + 9 0 S. — Le calcul symof Nova Herculis 1934: 389-92. - The spec- bolique (Paris '34) 32 S. (Actualités scientit r u m of the supernova in NGC 4559 16 ): 53 ('41) fiques et industrielles, 147. Exposés de phy130-32, 194. — Dwarf stars with emission sique théorique, 12). — L'œuvre astronolines of hydrogen and calcium 10 ): 296. — The mique de Gassendi (Paris '36) 31 S. ( ~ 378. proper-motion star Ross 766 21 ): 54 ('42) 156. Exposés d'histoire des sciences, 6). — Poten— Nova Puppis 1942"): 256 f. - Spectro- tiels et prépotentiels (Paris '36) 8 + 8 4 S. (Cag r a p h s observations of the nebula surround- hiers scientifiques, 15). — Cours d'astronomie ing Nova Herculis 1934: 55 ('43) 74-78. - 1: Astronomie de position; 2: Erreurs et corSupernova in NGC 5195: 57 ('45) 174f. - rections; 3 : Mécanique céleste (Paris '37) Frequency of emission lines in extragalactic 117 S. [daktylogr.] (Cours de l'Université de nebulae as a function of nebular type: 59 ('47) Montpellier. Certificats d'études supérieures 180 f. — Observations of the faint dwarf star d'astronomie et d'astronomie approfondie). L726-8 1 0 ): 61 ('49) 133f. - Novae in two — De Mercure à Pluton. Planètes et satellites extragalactic nebulae: 62 ('50) 116-18. - (Paris '37) 181 S. (Sciences d'aujourd'hui); Mercurio a Plutone (Milano '39) Apparent velocities of extragalactic nebulae ital.: Da 3 in four faint clusters: 63 ('51) 232f. - Spec- 213 S., ('43) 207 S. (Avventure del pensiero, troscopic investigations of multiple galaxies 30). — Histoire des sciences (Pau '43) 83 S. and clusters of galaxies 20 ): 71 ('59) 392f. - (Initiations, 5). — L'œuvre scientifique de

Humbert Blaise Pascal (Paris '47) 264 S. — Histoire des découvertes astronomiques (Paris '48) 272 S. — Introduction mathématique à l'étude des théories électromagnétiques 1: Analyse vectorielle, transformation conforme, théorie du potentiel (m. S. Colombo) (Paris '49) 3 + 149 S. — L'astronomie en France au dix-septième siècle (Alençon '52) 16 S. (Université de Paris. Les conférences du Palais de la Découverte, Sér. D, Nr. 8, 2 février 1952). — Philosophes et savants (Paris '53) 224 S. (Bibliothèque de philosophie scientifique). Annales Soc. sci. Bruxelles, Sér. A Sur les comètes de 389 et 390: 52 ('32) 41-47. - Sur les potentiels du troisième ordre : 293-305. — Les fonctions hypergéométriques et le calcul symbolique: 63 ('33) 103-12. — Le calcul symbolique à deux variables: 56 ('36) 26-43. Annales Soc. sci. Bruxelles, Sér. I Sur une solution particulière de l'équation A3 U = 0: 57 ('37) 142-45. - Sur une formule de M. Nielsen: 60 ('40) 61-63. - Formules trigonométriques dans le plan et l'espace attachés à l'opérateur Az: 196-99. — Sur l'équation différentielle de la fonction de Bessel du troisième ordre, d'indices nuls 3 ) : 64 ('50) 160-63. — Fonction de Bessel et calcul symbolique, 2 : 65 ('51) 93-95. — A propos des fonctions de Bessel à deux variables: 67 ('53) 19-22.

2111

Bull. Soc. math. France Formules nouvelles pour le calcul symbolique: 65 ('37) 119-31. Ciel et Terre La détermination des coordonnées géographiques au début du X V I I e siècle : 54 ('38) 233-38. — La détermination des latitudes à la fin du X V I I e siècle: 55 ('39) 81-86. — A propos de Mira Ceti: 379f.; 56 ('40)77-79. — Une lettre inédite de Gassendi: 14-17. — La découverte de la lumière cendrée de Vénus: 41-43. - Galilée: 85-87. - M. Moye, 18731939: 126-29. - 1642-1942 - Galilée et Newton : 58 ('42) 95-97. — La parallaxe solaire au début du X V I I e siècle: 177-80. - Sur l'éclipsé lunaire du 8 novembre 1631: 60 ('44) 42 f. — Pascal et l'astronomie: 122-25. — Le Saint Patron des astronomiers : 215f. — L'année astronomique 1647: 63 ('47) 160; ~ 1648: 64 ('48) 8 0 ; ~ 1649: 65 ('49) 80; ~ 1650: 66 ('50) 41 f.; ~ 1651: 67 ('51) 15; ~ 1652: 204f. Commentarli math, helvet. Sur les nombres des classes de certains corps quadratiques: 12 ('40) 233-45; 18 ('40) 67. - Théorie de la réduction des formes quadratiques définies positives dans un corps algébrique K fini : 12 ('40) 263-306. — Einseitige Polyeder nach Boy, 2: Polyèdre sans singularités topologiques homéomorphe au plan projectif dans l'espace à 3 dimensions: 14 ('42) 137-40. — Réduction de formes quadratiques dans un corps algébrique fini: 23 ('49) 50-63.

Annales Univ. Lyon, Sci., Sect. A Quelques C.B. Congr. Soc. savantes Paris et Dép. séquences symboliques: (3) 4 ('41) 85-92. — Sur une formule du calcul symbolique: Nice Sur la géométrie plane dans l'espace attaché 1938, 19-21. à l'opérateur A3: 93. C.B. hebd. Séances Acad. Sci., Paris Sur Archives int. Hist. Sci. Le problème des une généralisation du potentiel: 194 ('32) longitudes entre 1610 et 1666: 1 ('48) 383-87. 1549 f. — Sur les fonctions de Bessel-inté— D. Anthelme, chartreux et astronome: 2 grales: 195 ('32) 854f. — Le calcul symbolique à deux variables: 199 ('34) 657-60. — La ('49) 303-11. découverte des phases de Mercure: 202 ('36) L'Astronomie (BSAF) Observation d'un 395 f. — Extension aux prépotentiels du halo solaire: 64 ('50) 451. — Sur les traces de théorème de Kelvin: 203 ('36) 977f. - Sur Galilée: 66 ('52) 381-88. l'espace attaché à la forme A3: 208 ('39) 1965f. Atti Accad. pontificia nuovi Lincei Nou- — Sur les courbes planes de l'espace attaché velles remarques sur les fonctions de Bessel à l'opérateur A3: 209 ('39) 590f. - Sur du troisième ordre: 87 ('34) 323-31. — Sur une certaines figures planes de l'espace attaché équation aux dérivées partielles: 88 ('35) 154- à l'opérateur A„: 211 ('40) 530f. — Solution graphique de l'équation de Képler: 213 ('41) 58. Buletinul Soc. Çti. Cluj, Eomânia Sur les 343. — Sur une extension de la notion d'angle: angles d'un faisceau de trois droites: 970f. — intégrales de Fresnel: 7 ('34) 530-34. Solution nouvelle de l'équation A S U = U: Bull. math. Fac. Sci. et grandes Ecoles Exer- 216 ('43) 657-59. — Une nouvelle correscices sur la théorie des courbes: 3 ('37) 10-12, pondance symbolique: 218 ('44) 99f. — Sur Bull. Sci. math. Sur certaines figures planes les formules opératoires du calcul symbolique: de 1 'espace attaché à l'opérateur (2) 66 221 ('45) 398-401. — Images des fonctions de ('42) 145-54. — Bitétraèdre de l'espace at- Mathieu: 225 ('47) 715f. - Lentille électronitaché à l'opérateur A3: 68 ('44) 50-59. - Sur que corrigée de l'aberration de sphéricité: 228 certaines transcendantes liées au calcul sym- ('49) 233-35. — Lentille magnétique à axe bolique 6 ) : 204-14. — Nouvelles correspon- curviligne: 302-04. — Image nouvelle pour la dances symboliques: 69 ('45) 121-29. — Les fonction de Bessel: 230 ('50) 504f. - Une fonctions de Mathieu et le calcul symbolique : nouvelle formule opératoire: 232 ('51) 1397f. 72 ('48) 23-32. - Sur la fonction de Mittag- — Nouvelles images pour la fonction de Gauss : Leffler et quelques unes de ses généralisations 233 ('51) 1567-69. — Quelques résultats *): 77 ('53) 180-85. relatifs à la fonction de Mittag-Leffler: 236 134*

2112

Humbert — Hume-Rothery

(•53) 1467 f. — Sur une extension à deux variables de la fonction de Mittag-Leffler 3 ) : 237 ('53) 1059 f. Enseignement math. Sur le centre de courbure: 32 ('33) 162-65. — Application de la formule de Salmon: 37 ('38) 49f.

VI

HUME, John. Chem. - 1921-29 Demonstrator, '29-42 Lecturer, '42-55 Senior Lecturer, '47-55 Superintendent of Laboratories, '55-61 Buildings Liaison Officer, Univ. of Leeds. *1890, März 17, Edinburgh.

J. Math, pures et appl. Géométrie plane dans l'espace attaché à l'opérateur A 3 : (9) 21 ('42) Zum 65. Geb.tag E. G. C o x , University 141-53. Leeds Rev. 4 ('55) 379. Biographical Mem. Fellows roy. Soc. Robert J. Observateurs Quelques erreurs dans les Whytlaw-Gray, 1877-1958 5 ): 4 ('58) 327-39. Annales célestes de Pingré: 26 ('43) 51 f. Mathematica [Cluj, Timisoara] Sur les intégrales de Fresnel: 10 ('35) 32-36. Solutions nouvelles de l'équation A3U = 0: 11 ('35) 257-63. - Sur les fonctions K de Bessel: 17 ('41) 59-64. Mémorial Sci. math. Formulaire pour le calcul symbolique 4 ): 100 ('41) 65 S., 2 ('50) 67 S.; Suppl. au Formulaire ~ 4 ) 6 ) : 113 ('50) 62 S. — Le calcul symbolique et ses applications à la physique mathématique 2 ) : 105 ('47) 52 S.; 158 ('65) 74 S. Philosophical Mag. On Bessel product functions: (7) 24 ('37) 888-90. Proc. Edinburgh math. Soc. On Appell's function P (&, $ ) : (2) 3 ('32/33) 53-55. Bessel integral functions: 276-85. — Some new operational representations: 4 ('36) 23237. Publ. Observât, astron. Univ. Belgrade, Mém. Sur l'équation de Képler pour les orbites hyperboliques: 2 ('34) 11-18. Send. Semin. mat. R. Univ. Padova Quelques généralisations de l'équation de Laplace : 6 ('35) 121-31. Revue Ciel Les premiers essais de nomenclature lunaire: (3) 24 ('39) 24-26. Revue Hist. Sci. et Àppl. Joseph Gaultier de La Valette, astronome provençal (15641647): 1 ('48) 314-22. - A propos du passage de Mercure en 1631: 3 ('50) 27-31. ' Revue Questions sci. La détermination des distances stellaires: (4) 23 ('33) 5-22. - La correspondance du P. Mersenne : 24 ('33) 79-84. — L'astronomie au X I I I e siècle dans la France méditerranéenne: 28 ('35) 201-15. - Sur les pas de Galilée: (5) 2 ('37) 321. Maurice d'Ocagne, 1862-1938: 5 ('39) 17-27. — Correspondances astronomiques: 6 ('39) 62-65. — Le baptême des satellites de J u p i t e r : 7 (*40) 171-79. Sciences [Paris] Les observations astronomiques de Gassendi à Digne: 74 ('47) 336-49. Sphinx [Bruxelles] Les premiers essais de nomenclature lunaire: 8 ('38) 93f. — La mesure de la méridienne de France: 9 ('39) 151 f. Mit: ») R. P. A g a r w a l ; ») S . C o l o m b o ; *) P. Del e r u e ; •) N. W. M c L a e h l a n ; ') L. P o l i .

Chemistry and Industry An air thermoregulatory 2 ) : 10 ('32) 140. — Constant temperature cells for microscopic observations 4 ) 2 ): 700f. - A gas burette: 12 ('34) 37. J. chem. Soc., London William Lowson f : 1951, 2806. J. sci. Instruments P u m p for circulating gases: 36 ('59) 375. Philosophical Mag. and J. Sci. On reactions in solids: A comparison of the methods of deriving the energy of activation 1 ) 2 ): (7) 14 ('32) 1102-14. Proc. roy. Soc., London, Ser. A On the mass rate of reactions in solids 1 ) 2 ): 137 ('32) 531-41. Trans. Faraday Soc. Dehydration of copper sulphate trihydrate 3 ) 2 ): 29 ('33) 576-83. The dehydration of salt hydrates 2 ): 34 ('38) 969-76. University Leeds Rev. William Lowson, 1875-1951: 2 ('51) 370-. - The Staff House: 3 ('53) 350-. - Henry Whitaker: 5 ('57) 394-. - Clarence G. Durdey: 6 ('59) 339-. Mit: ») R. S. B r a d l e y ; ») J. C o l v i n ; •) M. M. Cooper; *) J. B. M. Coppock;») E. G. Cox. VI

HUME-ROTHERY, William. Metallurgie (physik.). - 1921 B. A., '26 M. A., '35 D. Sc., Univ. of Oxford; '25 Ph. D., Univ. of London; '29-32 Research Fellow in Metallurgy, Armourers' and Braziers' Company, Oxford; '32-55 Research Fellow, Roy. Soc.; '38-43 Fellow of Magdalen College, 38-55 Lecturer in Metallurg. Chemistry, '55-57 Reader in Metallurgy, '57-66 Prof., '66 Prof. Emer., Univ. of Oxford. - Hon. D. Sc. (Univ. of Manchester); '66 Hon. D. Met. (Univ. of Sheffield). - '34 Sir George Beilby Memorial Award (Soc. of Chemical Industry); '49 Platinum Medal (Inst, of Metals, London); '49 Francis J. Clamer Medal (Franklin Inst., Philadelphia, Pa.); '50 Bakhuis Roozeboom Gold Medaille (Koninkl. Akad. Wetensch. Amsterdam);

Hume-Rothery

'51 Officer of the Order of British Empire ; '55 Medaglia Luigi Losana (Soc. Italiana di Metallurgia). *1899, Mai 15, Worcester Park, Surrey; fl968, Sept. 27, Oxford.

2113

Annual Rep. Progr. Chem. Metals and alloys. The Pauling hypothesis: 46 ('49) 42-56. British J . appl. Physics A note on temperature control during lattice spacing measurements 4 ) 34 ) 53 ): 4 ('53) 188f.

Zur Biogr. Chemistry and Industry 12 ('34) Canadian J . Physics The valence state of 984. - Nature [London] 137 ('36) 81; 164 metallic lead: 37 ('59) 1565. ('49) 562; 180 ('57) 1321. Contemporary Physics Some notes on the Nekr. Biographical Mem. Fellows roy. Soc. structures of alloys of iron: 6 ('64) 321-47. 15 ('69) 109-39 (m. Bildn., Faks., Schr.verz.). Iron and Steel [London] Lattice spacing — Nature [London] 220 ('68) 517. and crystal structure of cementite 56 ) 40 ) : 15 th S.Proc. 4 Empire mining and metallurgical ('42) 318-20. congress, London 1949 (F. Higham) (London J . Inst. Metals A graphical method for '51): The theory of metals and alloys. — converting the weight percentage composiEncyclopaedia Britannica. A new survey tions of ternary systems into atomic or molecof universal knowledge 1 (Chicago-London- ular percentages: 52 ('33) Advance copy Toronto . . . '65) 649-53: Alloys. Nr. 643, 5 S. — The control of composition W . The structure of metals and alloys in the application of the Debye-Scherrer x-ray crystal analysis to the study (London '36) 120 S.; (ab 2. Aufl. m. G. V. method of 68 Raynor) 2 ('44), 3 ('54), 4 ('62) 8 + 380 S. of alloys ): 60 ('37) ~ 751, 10 S. - The of silver and gold in solid magnesium (Institute of Metals: Monograph and report solubility 12 of silverseries, 1). — Atomic theory for students of ) : ~ 752, 6 S. — The constitution 58 metallurgy (London '46) 8 + 286 S.; 2 ('47); rich antimony-silver alloys ) : — 758, 10 S. — s ('48), Neudrucke: ('52), ('55), ('60), ('62) The constitution of the copper-gallium alloys 8 + 419 S. ( ~ 3). - Elements of structural in the 56region 18 to 32 atomic per cent of metallurgy (London '61) 8 + 174 S. ( ~ 26). gallium ): 61 ('37) ~ 782, 18 S. - The constitution of the magnesium-rich alloys in the — Researches on the structure of alloys systems aluminium-magnesium, gallium-mag(London '41) 20 S. (British Non-ferrous nesium, indium-magnesium, and thalliumAssociation, Research reports, Association magnesium 66 ) : 63 ('38) ~ 804, 26 S. — Factors series, 562). — On the nursery floor [children's affecting the liquidus, solidus, and solidverse] (Oxford '41) 48 S. — Electrons, atoms, solubility curves in some alloys of magnesium metals and alloys (London '48) 377 S., 2 (New 56) : ~ 805, 16 S. — A technique for the x-ray York '55) 387 S., 3 ('63) 387 S.; franz.: Elec- powder photography of reactive metals and trons, atomes, métaux et alliages (Paris '59) alloys, with special reference to the lattice 8 + 456 S. — Metallurgical equilibrium spacings of magnesium a t high temperatures diagrams (m. J . W. Christian, W. B. Pearson) 66) : 65 ('39) ~ 851, 9 S. - Factors affecting (London '52) 312 S. (Physics in industry the formation of 3/2 electron compounds in series); russ.: (Moskva '56) 399 S. — The alloys of copper, silver, and gold58)66) : 66 ('40) structures of alloys of iron; an elementary introduction (Oxford-London '66) 10 + 350 S. — 875,17 S. — The constitution and structure of alloys of intermediate composition in the Acta crystallogr. The structure of an tx/ß systems copper-indium, copper-aluminium, brass 21 ) 19 ) : 5 ('52) 36-38. copper-germanium, silver-aluminium, and Acta metallurg. A note on the freezing silver-germanium 6 ») 68 ) 47 ): ~ 876, 31 S. — 18 range of the equiatomic Ag-Au alloy ): 9 The lattice spacing and thermal expansion of ('61) 982. — The constitution and structure of copper 3 ): 68 ('42) 19-26. - The equilibrium gold-cadmium alloys 59 ) 63 ): 10 ('62) 1143-50. diagram of the system silver-gallium, 1 : The — Note on the self-diffusion in iron: 11 ('63) a phase region 3 ): 133-43, 215f. — Deter630. — The bearing of neutron scattering mination of equilibrium diagrams by x-ray data on the Pauling theories of transition methods, 2: Application of x-ray methods to metals: 12 ('64) 1462f. — A note on the Engel- determination of phase boundaries in metalBrewer theory of metallic structures: 13 ('65) lurgical equilibrium diagrams: 69 ('43) 8-12. 1039-42. — Atomic diameters, atomic vol- — The constitution of magnesium-manganumes, and solid solubility relations in alloys: ese-zinc-aluminium alloys in the range 0 14 ('66) 17-20. — Note on the close-packed 5 per cent magnesium, 0-2 per cent manganhexagonal phases in the later transition series : ese, 0 - 8 per cent zinc, 1: The liquidus 12 ) 56 ): 560-62. — Comments on papers resulting 209-28; ~ 2: The composition of the MnAl from the Hume-Rothery Note - 1965: 16 phase 66 ): 415-21; ~ 3: The 500 °C and 400 ?C6 ('67) 567-69. isothermals 40 ) 66 ) : 423-40; ~ 4: The equilib40 6e Advances Physics The transition metals rium diagram below 400 °C ) ) : 467-84. rThe constitution of silver-magnesium alloys and their alloys 17 ): 3 ('54) 149-243.

2114

Hume-Rothery

in the region 0-40 atomic per cent magnesium 18. — The electrolytic migration of carbon 3 ): 485-93. — Modern views on alloys and in steels: 188 ('58) 113. - The constitution of their possible application: 70 ('44) 229-53. — alloys of iron with ruthenium, rhodium, The constitution of aluminium-copper-mag- palladium, and silver 29 ) : 189 ('58) 243-50. nesium alloys at 460 °C 40 ) 6e ): 491-506. - Liquidus and solidus relations in iron-rich The solubility of manganese in aluminium 12 ): iron-platinum alloys 10 ): 193 ('59) 61 f. 71 ('45) 87-91. — On the constitution of Liquidus and solidus relations in iron-rich aluminium-magnesium-manganese-zinc al- iron-carbon alloys 10 ): 196 ('60) 403-06. loys: The solidus 12 ): 291-311. — Equilibrium Liquidus-solidus relations in iron-rich ironrelations and some properties of magnesium- niobium and iron-molybdenum alloys 29 ) 38 ): lithium and magnesium-silver-lithium alloys 198 ('61) 64-66. — Liquidus ^ solidus re56 12 ) ): 589-601. - A new aluminium-rich lations in iron-rich alloys of the systems F e phase in the alloys of aluminium and mangan- Tc, Fe-Os, F e - I r , and Fe-Au 10) : 201 ('63) ese 41 ) 56 ): 78 ('46/47) 83-90, 747-49. - The 121-24. — The liquid ^ solid and ô ^ y constitution of aluminium-copper-magne- equilibria in iron-rich alloys 10 ): 227-32. — sium-zinc alloys at 460 °C 66 ) 40 ): 74 ('47/48) Liquidus ^ solidus relations in iron alloys: 191-225. - The effect of 1% silicon on the ideal solutions 10 ): 202 ('64) 531-33. - Liqconstitution of aluminium-magnesium-man- uidus ^ solidus relations in the system ironganese-zinc alloys at 460 °C 4 ): 315-29. — manganese 10 ) : 534. — Liquidus and solidus The effect of 1% silicon on the melting points relations in iron-rich iron-carbon-nickel alloys of aluminium-magnesium-manganese-zinc al- 10 ): 895-98. — Intermetallic chemistry of loys 4 ) 12 ) : 330-44. — A note on the aluminium- iron: 203 ('65) 1181-93. - Constitution of manganese G phase 41 ): 521-24. — The con- certain austenitic stainless steels with particstitution of aluminium-magnesium-zinc- ular reference to the effect of aluminium 3 7 ): chromium alloys at 460 °C 41 ) 4 ): 75 ('48/49) 39-50. — The equilibrium diagram of the 204 ('66) 1-7. 31— Constitution of certain system chromium-manganese 13 ) 16 ): 76 ('49) austenitic steels ): 683-701. — Equilibrium 64 10 169-94. — A note on the effect of nitrogen on diagram of the iron-molybdenum system ) ) : 205 ('67) 191-95. — The iron-tantalum system t h e structures of certain alloys of chromium 64 ): 671-73. — The iron-tungsten system 64 ): and manganese, and on the existence of an 13 1145-49. intermediate nitride phase ): 195-200. — The equilibrium diagram of the system nickelJ . Iess-eommon Metals [Amsterdam] The manganese 1 '): 80 ('51/52) 85-92. The diagram of the system bismuthequilibrium diagram of the system copper- equilibrium 8 ) : 1 ('59) 157-64. - The compound gallium in the region 30-100 atomic per cent palladium 62 6 gallium ): 459-68. — The factors affecting the Bi 4 Rh ) : 304-08. - The equilibrium2 diagram formation of 21/13 electron compounds in of the system molybdenum-rhodium ) : 2 ('60) of the alloys of copper and of silver 6 ) 6 '): 609-16. — 19-28. — The equilibrium diagram 2 The equilibrium diagram of the system copper- system molybdenum-ruthenium ) : 443-50. — indium in t h e region 25-35 atomic per cent The effect of electronegativity on solid and indium 5 ')'®): 637-40. - The constitution and liquid miscibility: 4 ('62) 390-92. - On the diagram of the system bismuthstructure of nickel-vanadium alloys in the equilibrium 62 region 0-60 atomic per cent vanadium 6 0 ): 641- rhodium ) : 454-59. 62 — High temperature 52. — The constitution of chromium-mangan- x-ray metallography ), 1: A new Debyeese alloys below 1000 °C 6 0 ): 81 ('52/53) 311- Scherrer camera for use at very high tem14. — Methods for determining the liquidus peratures; ~ 2: A new parafocusing camera; points of titanium-rich alloys 53 ): 82 ('53/54) — 3 : Applications to the study of chromium, 490-92. — The equilibrium diagram of the hafnium, molybdenum, rhodium, ruthenium, system nickel-titanium 63 ) : 83 ('54/55) 473-80. and tungsten: 5 ('63) 258-70. — The equidiagram of the system molybdenum— The equilibrium diagram of the system librium 66 copper-germanium 5 '): 85 ('56/57) 119-27. — cobalt ): 314-24. — A note on the interThe constitution of molybdenum-rhodium metallic chemistry of t h e later transition and molybdenum-palladium alloys 32 ): 87 elements: 7 ('64) 152-58. — The equilibrium 14 ('58/59) 265-72. - The theory of the alloys diagram of the system molybdenum-nickel ) : 212-21. — The equilibrium diagram of the of copper: 90 ('61/62) 42-51. system gold-gallium 18 ): 10 ('66) 42-51. Structures of copper, silver and gold alloys 18 ) : 52-56. — The equilibrium diagram of the J. Iron and Steel Inst. On the carbide and system niobium-nickel 23 ): 11 ('66) 381-87. 56 40 nitride particles in titanium steels ) ): 145 Constitution of niobium-cobalt alloys 48 ): 12 ('42) 129P-141P; 146 ('42) 481P-488P (m. ('67) 366-74. — Constitution of alloys of gold Diskuss.-Beitr.). — The lattice spacings and and mercury 61 ): 13 ('67) 1-10. crystal structure of cementite 56 ) 40 ): 145 ('42) 143P-151P. - The liquidus ^ solidus relations in the system iron-cobalt in the range J . physic. Chem. The liquid state of t h e 0-30 atomic per cent cobalt 30 ): 174 ('53) 212- elements: 44 ('40) 808-23.

Hume-Rothery J. sci. Instruments The application of x-ray methods to the determination of phaseboundaries in metallurgical equilibrium diagrams66): 18 ('41) 74-81. - Film-contraction errors in lattice-spacing measurements66)40): 239 f. — The preparation of filings for DebyeScherrer diffraction photographs: 24 ('47) 75-, — A general-purpose Debye-Scherrer camera and 66 its application to work at low temperatures ) :4489-. — An adjustable stand for x-ray cameras ): 25 ('48) 322. Metal Industry [London] Determination of phase boundaries in metallurgical equilibrium diagrams56): 60 ('42) 412-16. - Electrons and metals: 68 ('46); 69 ('46). Metal Treatment and Drop Forging The theory of metals and alloys: 17 ('50) 15-22. Metallurgia ital. The transition metals: 47 ('55) 299-304 [ ]. Metallurgical Soc. Conf. The development of the theory of alloys: 27 ('63) 331-46. Metallurgist Some electron theories of allovs: 3 ('64) 11-. Monthly J., Inst. Metals Equilibrium diagrams: 1947, News Section, Juni-Nr., XLI-. — The equilibrium diagram of the system chromium-manganese: a correction16): 1950, News Section, Mai-Nr., 152-. Nature [London] Lattice parameters of solid solutions in silver: 135 ('35) 1038. - New sigma-phases in binary alloys of the60transition elements of the first long period )16): 167 ('51) 110. — Spectrographically pure metals: 184 ('59) 1794. - A determination of 2 the melting point of element 43 (technetium) ) 10 ) 34 ): 188 ('60) 48f. Philosophical Mag. (and J. Sci.) The electronic energy levels of the elements with special reference to their connexion with the sizes and electronic states of atoms in metallic crystals. A correction: (7) 13 ('32) 196f. — On the theory of equilibrium in alloys, 1: 22 ('36) 1013-47. - On the nature of intermetallic compounds of the type Mg 2 Sn 66 ): 25 ('38) 335-39. - Atomic and ionic radii, 1: Numerical values and their bearing on the compressibilities of metals66): 26 ('38) 129-43; — 2: Application to the theory of solid solubility in alloys66): 143-52. — The latent heats of sublimation and evaporation of certain substances: 28 ('39) 465-80. — Contact potentials 16 ): 34 ('43) 213. - The lattice spacings of lithium at 20 °C and —183 °C 42 ): 36 ('45) 799-801. — The equilibrium diagrams of certain alloys of iron 16 ): 835-42. — The lattice spacing42 of rubidium between —183 °C and + 1 9 °C ): 842-45. - The effect of manganese, iron, and nickel on the a//J brass equilibrium: 39 ('48) 89-97. — The coefficients of expansion of some solid solutions in aluminium'): 40 ('49) 71-80. - The effect of four

2115

transition metals on the ) S. L. A l t m a n n ; « ) E. A n d e r s o n ; ») K. W. A n d r e w s ; •) H. J. A x o n ; ' ) Z. S. B a s i n s k i ; •) J. O. B e t t e r t o n ; ')10 T. H. B o u l t b e e ; ') J. B r a s i e r ; •) P. J. B r o w n ; ) R. A. B u c k l e y ; ") J. B u r n s ; ") E. B u t c h e r s ; ")S. J. Carlile; ") R. E. W. Casselt o n ; ") J. A. Chalmers; ") J. W. C h r i s t i a n ; ") B . R . C o l e s ; ") C . J . C o o k e ; M) C. A. Coulson; ") H. E. D a v i e s ; ") R. J. D a v i s ; ") C. D a s a r a t h y ; ") L. J. D u e r d e n ; ") G. A. E a d e ; ") - ; ") K. M. C. E v a n s ; ")M J. B. F o r s y t h ; »•) J. H. F r y e ; ") W. S. G i b s o n ; ) G . B . H a r r i s ; ") B. H a t t e r s l e y ; «") C. W. H a w o r t h ; »«) J. B. H a w o r t h ; ") A. H e l l a w e l l ; ••) S. E. R. H i s c o c k s ; '*) H . M . I r v i n g ; •») J. D. J o n e s ; ") J. R. Lee; »•) G. F. L e w i n ; ») A. T. L i t t l e ; ") K. L i t t l e ; ") K . L o n s d a l e ; ") G. W. M a b b o t t ; ") C. M a c l n t y r e ; ") H . P . M y e r s ; ••) C. R. Oswin; ") H. K. P a c k e r ; «•) J. K. P a r g e t e r ; ") R. P e a r o e ; ••) W. B. P e a r s o n ; «) - ; " ) - ; ") D. M. P o o l e ; ") H. M. P o w e l l ; ») T. J. Quinn;

M

) G. V. R a y n o r ; «*) J. R e y n o l d s ; •') P. W. R e y n o l d s ; ") V. G. R i v l i n ; M )D. J. R o a f ; ")C. R o l f e ; •») R . G . R o s s ; ••) B . R y d e r ; ••) A. K. S i n h a ; ») A. L. S u t t o n ; ••) D. J. S t r a w b r i d g e ; ") W. H. T a y l o r ; ") - ; •») R. J. P. W i l l i a m s ; *>) W. A. W i s e m a n ; «) M. R. J. W y l l i e .

iv-vi HUMPHREYS, W i l l i a m Jackson. Physik, Meteorol. 1905-35 Prof. Meteorol. Physics, Weather Bureau, U.S. Departm. of Agriculture, Washington, D.C.; '11-34 Prof. Meteorol. Physics, '34 Prof. Emeritus, George Washington Univ., Washington, D.C.; '19 Pres., Philos. Soc,, Washington, D.C.; '20-23 Vice-Pres., '2829 Pres., Amer. Meteorol. Soc. ; '22 Pres., Washington Acad. Sci. *1862, Febr. 3, Gap Mills, W. Va.; fl949, Nov. 10, Washington, D.C. Autobiogr. Of me - W. J . Humphreys (Washington, D.C. '47) 7 + 375 S. Nckr. S. A. M i t c h e l l , Science [USA] 112 ('50) 74f. - R. T. Z o c h , J . Washington Acàd. Sci. 40 ('50) 95 f. - Annalen Meteorol. 3 ('50) 41. HZ. Monthly Weather Rev. 60 ('32)-63 ('35). S. Encyclopaedia Britannica. A new survey of universal knowledge 15 (Chicago-LondonToronto . . . '65) 565: Mirage. W. Snow crystals (m. W. A. Bentley) (London '32) 237 S., (New York '62, '64) 226 S. — Weather proverbs and paradoxes 2 (Baltimore, Md.-London '34) 12 + 126 S. Weather rambles (London '37) 265 S. — Physics of the air 3 (New York-London '40) 16 + 676 S.; ('64) 16 + 676 S. - Ways of the weather. A cultural survey of meteorology (Lancaster, Pa. '42) 5 + 400 S. (Humanizing science series). — Fogs, clouds, and aviation (Baltimore, Md. '43) 12 + 200 S. J. Franklin Inst. Evolution of rain: 241 ('46) 391-96. J. Washington Acad. Sci. Some episodes along the meteorological highwav: 26 ('36) 435-52. Monthly Weather Rev. The colder the air the thinner the ice: 60 ('32) 60f. — A contrast in thunderstorms : 148. — The change of humidity incident to a thunderstorm: 246. — Conservation of angular momentum, or areas, as applied to an airplane en route to the pole : 61 ('33) 83. — On the occasions, or incidental causes, of extratropical cyclones: 112. — Nacreous and noctilucent clouds: 228f. — Remarks on the theory of the Psychrometer: 300-02. — Supersaturation again: 303f. — The Mount Washington (New Hampshire) halo of October 4, 1933: 328 f. — Rime caps and snow cocks: 62 ('34) 97. - The "sinking" of lake and river ice: 133f. — An unusual

Humphreys — Hunter, Andrew snowstorm in southeastern West Virginia: 295. - Snow-garlands: 68 ('35) 162. - Snowgarlands on tree limbs: 315. — Charles Fitzhugh Talman, 1874-1936: 64 ('36) 227. The greenhouse effect of volcanic dust: 65 ('37) 261 f. — A curious photographic cloud effect: 387. — Springs that mysteriously ebb and flow: 66 ('38) 35. - Wind and radiation: 67 ('39) 89. — On the origin and distribution of thunderstorm electricity: 321. Proc. amer. philos. Soc. Ball lightning: 76 ('36) 613-26. — A review of papers on meteorology and climatology published by the American Philosophical Society prior to the twentieth century: 86 ('43) 29-33. Science [USA] Obituary Robert De Courcy Ward: 75 ('32) 183f. - Wilson Alwyn Bentley: 374. — The "sinking" of lake and river ice: 79 ('34) 562f. - Laurence: 86('37) 613. Willis Bay Gregg: 88 ('38) 318f. - Why we seldom see a lunar rainbow: 496-98. — Equinoxes and solstices: 92 ('40) 429. Science News-Letter Do glaciers melt of their own weight ?: 20 ('31) 173. Scientific Monthly On the research work of the U.S. Weather Bureau: 36 ('33) 419-28. VI

HUND, A u g u s t . Physik (Hochfrequenztechn.). — 1903 Assist., Techn. Hochsch. Karlsruhe; '11 Designing Engineer, Bartelnus and Donat, Moravia, N . Y . ; '12-14 Research Engineer, Switchboard Departm., Dr. Steinmetz's Labor., General Electric Co., Schenectady, N . Y . ; '15-17 Assistant Prof., then Assoc. Prof. Physics and Electr. Engineering, Univ. of Southern California, Los Angeles, Calif.; '18-22 Consulting Research Engineer, Berkeley, Calif.; '22-29 Electr. Engineer and Senior Physicist, U.S. Bureau of Standards, Washington, D.C.; '29-34 Special Research and Consulting Engineer, Wired Radio, Inc., New Jersey; '34-42 Consulting Engineer, '42-45Techn. Consultant, U.S. N a v y Radio and Sound Labor., San Diego, Calif.; '45- Consulting Electr. Engineer. *1887, Dez. 17, Offenburg; •¡•1952, Febr. 11, Santa Monica, Calif. W. High-frequency measurements (New York-London '33) 11 + 491 S.; 2('51) 11 + 676 S. (International series in pure and applied physics). — Phenomena in high-frequency systems (New York '36) 15 + 642 S. ( ~ ) . Frequency modulation (New York '42) 10 + 375 S. (Radio communication series). — Short-

2117

wave radiation phenomena 1.2 (New York '52) 1382 S. ( ~ ) . Electronics Tubes with cold cathodes: 6 ('33) 6, 22. VI

HUNTER, A n d r e w . Chem. (physiol., pathol.), Biochem. - 1915-29, '35-47 Prof., '45-47 Dean of the School of Graduate Studies, '47 Prof. Emeritus, Univ. of Toronto, Can.; '29-35 Prof., '30-35 Dean of the Fac. of Med., Univ. of Glasgow; '47- Assoc., Research Inst., Hospital for Sick Children, Toronto, Can. — '03 Gunning Prize in Physiol. (Univ. of Edinburgh); '46 Commander of the Order of the British Empire. *1876, Sept. 28, Edinburgh. Biochemical J . The action of arginase upon carbamidoarginine: 32 ('38) 826-36. — Enzymic methods for the preparation of arginine and ornithine: 33 ('39) 27-35. — L-(+)Citrulline 4 ): 170-72. — The behaviour of some uramido-acids in the nitrous acid method for the determination of amino-nitrogen 4 ): 34 ('40) 192-97. — A colorimetric method for the determination of citrulline4) : 35 ('41) 650-58. — The specificity of arginase: action upon argininic acid8) : 1298-306. Canadian med. Assoc. J . Modifications of Marshall's clinical method for the determination of urinary urea: 36 ('37) 616-18. Clinica chim. Acta [Amsterdam] The application to urine of a bromine method for the determination of histidine: 12 ('65) 2-16. Enzymologia A manometric method for the enzymatic determination of arginine7) : 1 ('37) 341-52. J. MoL Chemistry Synthesis of urea in liver. Citrulline as an intermediary in ornithine cycle4): 147 ('43) 593-615. - Measurement of arginase activity 2 ): 155 ('44) 173-81. — Inhibition of arginase by amino-acids2) : 157 ('45) 427-46. — Inactivation of arginase by protein dénaturants 2 ): 173 ('48) 31-39. — A method of histidine determination based upon a modified Knoop reaction, 1: 196 ('52) 589-98; ~ 2: 216 ('55) 391-94. New England J . Med. A familial disturbance of histidine metabolism 3 ) 6 ): 285 ('61) 221-24. Pediatrics Inborn error of histidine metabolism3)6): 29 ('62) 714-28. Quarterly J. exper. Physiol. Arginase studies, 1: The relation between the activity of the enzyme and the concentration of hydrogen ions5): 23 ('33) 89-117; ~ 2: The influence of hydrogen-ion concentration upon the stability of the enzyme 1 ): 119-26. — The temperature coefficient and the apparent energy of activa-

2118

Hunter, Andrew —• Hunter, Robert

tion of t h e enzymatic hydrolysis of arginine; •with additional observations upon the stability of arginase under various conditions: 24 ('34) 177-88. Ferner 2 kurze Mitteilungen i n : Federat. Proc., Amer. Soc. exper. Biol. 1951 u n d 1959. Mit: l ) J. A.4 Dauphinee; 2) C. E. Downs; ') H. Ghadimi; ) A. G. Gornall; ') J. A. Morroll; •) M.W.Partington; ') J. B. Pettigrew; ') H. E. Woodward. VI

HUNTER, R o b e r t Fergus. Chem. (org.). - 1926 Ph.D., '26-29 Ramsay Fellow, '30 D. Sc., Imperial College of Sci. and Technol., Univ. of London; '2930 Lecturer, Brighton College of Technol.; '30-36 Prof., Aligarh Univ., Aligarh, Prov. of Agra and Oudh, Brit.-India; '36-37 Lecturer, Univ. of Manchester; '38-39 Research Biochemist, London School of Hyg. and Tropical Med.; '39-46 Senior Organic Research Chemist and Section Manager, Lever Bros, and Unilever Ltd., London; '46-58 Research Manager, '58-63 Research Co-ordinator, Bakelite Ltd., London. *1904, Marz 18, Beckenham, Kent; |1963, Mai 2, Solihull, Warwickshire.

5: Transition of one form of linkage into another: 395f.; — 6: Parachor a n d t h e existence of singlet linkages: 406-08; ~ 7: Problem of aromatic substitution: 144 ('32) 3f. Chemistry and Industry The single electron linkage: 10 ('32) 939. - The problem of valency 3 9 ): 13 ('35) 31-36, 467f. - The development of chemistry in India during t h e last twenty-five years: 442f. — Some f u r t h e r remarks on the problem of valency 3 9 ): 63537. — The transition of covalency t o electrovalencv 39 ) : 14 ('36) 733-40. - The isomerism of 1-carboxy-methylcyclohexane-l-acetic acids ll ) : 16 ('38) 1059 f. - Vitamin-A a n d the biologically active carotenoids: 20 ('42) 89-94. — The thiazoles and their uses in industry a n d medicine: 1943, 118-21. — Recent advances in t h e structure of phenoplasts: 1954, 26265. — Rational synthesis of cyclic tetranuclear p-cresol novolak 2 1 ): 1956, 193f. — Rational synthesis of a cyclic octanuclear novolak a n d of a cross-linked decanuclear novolak 4 4 ): 1957, 72 f. — The copolymer composition of polyester resins 21 ): 559. — Infrared spectra of polyvinyl chloride samples prepared a t temperatures between — 80°C a n d + 4 5 °C 1 8 ): 1958, 719f. — I n f r a r e d spectra of reduction products from polyvinyl chloride 16 ) 18 ): 1114. — Carbon-chlorine stretching modes of polyvinyl chloride 18 ): 1959, 433.

Current Sci. Electronic theory of t r i a d Nekr. N. J . L. M e g s o n , Proc. chem. Soc., mobility: 1 ('32) 69. London 1964, 33f. J . appl. Chem. Synthesis of molecular units S. Chemistry of carbon compounds (E. H . for rational synthesis of phenol-formaldehyde Rodd) I I A (Amsterdam-Houston, Tex.-Lon- a n d allied resins, 1: Synthesis of resols, did o n - N e w Y o r k '53) 352-90: The carotenoid hydroxydiphenylethanes, a n d dihydroxydigroup. phenylpropanes«): 1 ('51) 217-26; Phenolformaldehyde a n d allied resins, 2: Trinuclear W. The electronic theory of chemistry: an and hexanuclear novolaks 1 0 ) 2 1 ): 3 ('53) 312introductory account (London '34) 7 + 125 S. 17; — 3: F u r t h e r syntheses of resol molecules Biochemical J . P a l m oil carotenoids, 1: The 6 ): 486-95; ~ 4 : Rational synthesis of hexaisolation of lipoid pigments from a " S h e r b r o " nuclear a n d heptanuclear novolaks 1 0 ) 2 1 ): 7 palm oil 40 ): 35 ('41) 31-38; ~ 2 : The isolation ('57) 521-28; ~ 5: Synthesis of a bridged of lipoid pigments from a West African plan- decanuclear novolak a n d a case of hardening tation oil and some remarks on t h e isomeriza- b y way of meta-substitution 4 4 ): 528-32; — 6: tion of carotenoids 4 0 ) 1 4 ): 36 ('42) 697-702; Rational synthesis of a "cyclic" tetranuclear — 3 : Examination of t h e lipoid pigments p-cresol novolak 2 1 ): 8 ('58) 743-48. - x - R a y present in " M a l a y " a n d "Bissao" palm oils investigation of 2,2'-dihydroxy-5,5'-dimethyl40 47 ) ): 88 ('44) 209-11; ~ 4 : The proportion diphenylmethane a n d its 3-, 4- a n d 5-ring of a - to ^-carotene in unripe a n d ripe p a l m polymers and of p-cresol novolak resins 45 ): 1 oils a n d a t t e m p t e d interconversion of a - and ('51) 298-300. — The infra-red absorption ^-carotenes 4 0 ): 211-13; — 5 : Examination of spectra of some novolak a n d resol molecules "Sese" palm oils 29 ): 40 ('46) 492f. - The 18 ): 6 ('56) 324-29. - The polymerization of "cyclization" of vitamin-A and allied com- acetylene derivatives, 1: The polymerization pounds 2 0 ) : 38 ('44) 34-37. - The preparation of some monomers derived f r o m vinylacetylof /9-carotene of a high degree of purity 1 2 ) 4 7 ): ene 1 0 ): 9 ('59) 137-41; ~ 2: Polymerization 39 ('45) 5 f . of pentenynyl, hexenynyl a n d pentadienyl esters of dibasic acids 1 0 ): 364-68; ~ 3 : PolyChemical News Some applications of t h e merization of a dimer of 4-penten-2-yn-l-ol electronic theory of valency, 3 : Lower a n d a n d a t t e m p t e d polymerization a n d copolyhigher valencies of elements: 143 ('31/32) merization with styrene of 1,1,3,3,6-penta326-27; ~ 4 : Distinctive properties of di- methyl-4-isopropenylisocoumaran, 1,4-di-pelectrovalencies a n d covalencies: 357-59; ~

Hunter, Robert

2119

chlorophenoxy-2-butyne, and 2-methyl-2-iso- and benzene 2 ) 11 ) 34 ): 1987, 1013-16. - Vitamin-A aldehyde (axerophthal) 20 ): 1944, 411. propenyl-4-methyloldioxolan 10 ): 660-65. — Oxidation of ^-carotene in solution by J . chem. Soe. Condensation of 4i) 516-20; ~ 6: Stereoisomeric forms of 4- and 3-methylcyclohexane-l,l-dicarboxylic acid, and conclusive chemical evidence for the multiplanar cyclohexane ring 11 ) M ) : 16 ('42) 168-72. Proc. Muslim Assoc. Advancement Sci. Tautomerism in the light of recent investigations: 2 ('32) 1-41. Recueil Trav. chim. Pays-Bas The effect of substituents on the bromination of diaryl-/?thiohydantoins. An application of the theory of singlet linkages to the formation of polybromide complexes by heterocyclic compounds 8 )") 4 2 ): 52 ('33) 853-61. - The interaction of s-phenylmethylthiocarbamide and s-phenyln-butylthiocarbamide with bromine 8 ): 53 ('34) 1-6. — The nature of the bromo-addition compounds of dehydrothio-p-toluidine and its acetyl derivatives, and the synthesis of 4'-acetylamino-l-phenyl-5-methyl-benzthiazole and of 3'-bromo-4'-acetylamino-l-phenyl5-methyl-benzthiazole 3 ) 11 ): 7-12. — Some remarks on the interpretation of the parachor 3 9 ): 54 ('35) 114-17. - The condensation of thiocarbamides with monochloroacetic acid and the conversion of arylformamidinethiolacetic acids into y-thiohydantoin derivatives 11 ) 28 ): 118-21. — The directive effect of cyano and iodo substituents on the thiazole cyclization of p-p'-disubstituted thiocarbanilides by bromine 16 ): 122-28. Research Carotenoids and vitamin A: 3 ('50) 453-61.

VI

HUNTER, William Hammett. Cher», (org.). — 1910 Ph. D., Harvard Univ., Cambridge, Mass.; '09-13 Instructor, '13-16 Assist. Prof., '16-20 Assoc. Prof., '20-31 Prof., '22-31 Chief of the Departru. of Org. Chem., Univ. of Minnesota, Minneapolis, Minn. *1882, Sept. 3, Boston, Mass.; fl931, Aug. 19, Minneapolis, Minn. J . amer. chem. Soc. A catalytic decomposition of certain phenol silver salts, 6: Intermediate stages 18 ): 54 ('32) 1167-73; ~ 7: Synthesis of 4-hydroxy-3,5-dibromo-2',6'-diiodo-4'-chlorodiphenyl ether and the decomposition of its metallic salts 4 ): 2456-63. — The constitution of abnormal ammonium salts 3 ): 1948-57. — Carbon tetrabromide as a brominating agent 6 ): 2025-28. — The action of halogens and of alkyl halides upon the salts of tribromothiophenol 8 ): 2425-32. — An optical method for the study of reversible organic oxidation-reduction systems, 1: pBenzoquinones 9 ): 2869-81. — The oxidation of symmetrical tribromoaniline by chromic anhydride in acid solution, 2: Mechanism 18 ): 3348-53. — Reduction of aliphatic sulfonic acid salts with phosphorus pentabromide and phosphorus tribromide 16 ): 3364-67. - The mechanism of the reduction of sulfonyl bromides with phosphorus tribromide 16 ): 3368-74. — The polymerization of some unsaturated hydrocarbons. The catalytic action of aluminum chloride 20 ): 55 ('33) 1248-52. - The iodination of phenol under anhydrous conditions 2 ) : 2122-25. — The action of phosphorus pentachloride on 1,3-dioxoindane 7 ): 2567-70. — The oxidation of sym-triiodophenol 11 ): 3701-05. — Note on the oxidation products of benzophenone oxime 5 ): 5053-55. — Some derivatives of 1,3-diketohydrindene 19 ): 58 ('36) 1395 f. J . physic. Chem. The absorption spectra: of a series of organic molecular compounds 12 ): 37

Hunter, William — Huntington

2121

Annals Math. The inter-deducibility of the ('33) 875-87. — Studies on organic depolarnew Hilbert-Bernays theory and Principia izers"): 89 ('35) 1139-47. 2.. obäfiej Chim. Die thermische und kata- Mathematica: (2) 86 ('35) 313-24. lytische Zersetzung der Phenolate, 8: BeobAnnals math. Statistics Frequency distriachtungen über den Einfluß der Methoxyl- bution of product and quotient: 10 ('39) 195gruppe; Darstellung und Eigenschaften der 98. Natrium-, Kalium- und Silberphenolate der Biometrika Stirling's formula with rehalogenierten p-Methoxyphenole 14 ): 7 ('37) 2202-05; ~ 9: Beobachtungen über den Ein- mainder: 31 ('40) 390-. Bull. amer. math. Soc. Independent postufluß der Methoxylgruppe; Einfluß der o-Methoxylgruppe 14 ): 2206-08; ~ 10: Beobach- lates for the "informal" part of Principia Matungen über den Einfluß der Methylgruppe; thematica: 40 ('34) 127-36. — Independent Herstellung und Eigenschaften der Natrium- postulates for an "informal Principia system und Kaliumphenolate einiger p- und o-Kre- with equality": 137-42. — The relation besole 14 ): 2226-29; ~ 11: Herstellung und tween Lewis's strict implication and Boolean Vergleich der Eigenschaften einiger Silber- algebra: 729-35. 14 phenolate ): 2230-34. — - Alle Arbeiten Econometrica [USA] On the mathematical russ. hypotheses underlying Carl Snyder's tradeMit: ') - ; ») T. T. Budrow; 3) G. D. Byrkit; «) credit ratio theorem: 6 ('38) 177-79. M.A.Dahlen; •) W. S. Dyer; ') D.E.Edgar; ') Fundamenta Math. [Warszawa] The mathR. E. Jackman; •) A. H. Kohlhase; •) D.E. Kvalnes; ») - ; ") M.L.Morse; ») E. H. Nor- ematical structure of Lewis's theorv of strict they; ") - ; ") F. H. Rat[h]man[n]; ") C.Sly; mplication: 25 ('35) 147-56. ») B. E. Sorenson; ") L. F. Stone; ») R. B. WhitJ. amer. statist. Assoc. An improved equalney; ") E. C. Yackel; !0) R. V. Yohe. frequency map of the normal correlation surIV-VI HUNTINGTON, E d w a r d Ver- face, using circles instead of ellipses: 27 ('32) milye. Math., Mech. — 1901-05 Instruc- 251-55. J. Engng. Educat. Teaching the calculus: tor, '05-15 Assist. Prof., '15-19 Assoc. Prof., '19-41 Prof., '41 Prof. Emeritus, 22 ('32) 485-521. J . Parapsychol. A rating table for cardHarvard Univ., Cambridge, Mass.; '18 matching experiments: 1 ('37) 292-94. Pres., Math. Assoc. of America; '26 ViceJ . symbol. Logic Note on a recent set of Pres., American Assoc. for the Advance- postulates for the calculus of propositions: 4 ment of Sei. — '25 Hon. Sc. D. (Univ. ('39) 10-14. Nacion. de San Marcos de Lima, Perü). Mind A simplification of Lewis and Langford's postulates for Boolean algebra: 42 ('33) *1874, Apr. 26, Clinton, N.Y.; 203-07. — Independent postulates related to •j-1952, Nov. 25, Cambridge, Mass. C. I. Lewis's theory of strict implication: 43 Nekr. J . H. van V l e c k , Yearb., Amer. ('34) 181-98. philos. Soc. 1952 ('53) 321-24. - Bull. amer. Philosophy Sci. The method of postulates: math. Soc. 59 ('53) 399. 4 ('37) 482-95. S. Monographs on topics of modern mathProc. amer. Acad. Arts and Sci. Postulates ematics relevant to the elementary field for separation of point-pairs (Reversible order (J. W. A. Young) [Neuauflage] (New York on a closed line) 1 ): G7 ('32) 61-145. - Postu'55) 149-207: The fundamental propositions lates for assertion, conjunction, negation, and equality: 72 ('37) 1-44. of algebra. , W. Handbook of mathematics; with tables Proc. nation. Acad. Sci. USA A new set of of weights and measures by H. W. Bearce; independent postulates for the algebra of reprint of sections 1 and 2 of L. S. Marks's logic, with special reference to Whitehead and "Mechanical engineers' handbook" 2 (New Russell's Principia Mathematica: 18 ('32) York-London '34) 7 + 193 S.; »{'43) 7 + 193 S. 179 f. — An improved equal-frequency map of — Methods of apportionment in congress. A the normal correlation surface, using circles survey (Washington, D. C. '40) 5 + 4 1 S. (U. S. instead of ellipses: 465-67. — Effective equalSenate documents. 76 t h Congress, 3 r d ses- ity and effective implication in formal logic: sion, Nr. 304). — The continuum, and other 2 i ('35) 266-71. — Mathematical postulates types of serial order; with an introduction to for the logical operations of assertion, conCantor's transfinite numbers 2 (New York '55) junction, negation, and equality: 22 ('36) 7 + 8 2 S. 291-96. American math. Monthly Air resistance to Science [USA] The attraction of a sphere: falling spheres: 40 ('33) 451-55. — The postu- 77 ('33) 489. — Exact probabilities in certain lational method in mathematics: 41 ('34) 84- card-matching problems: 86 ('37) 499f. — A paradox in the scoring of competing teams: 88 92.

2122

Huntington — Huntress

('38) 287 f. — The method of congressional apportionment under the law of 1941: 95 ('42) 477 f. Scripta math. [USA] The duplicity of logic: 5 ('38) 149-57, 233-38. Trans, amer. math. Soc. New sets of independent postulates for the algebra of logic, with special reference to Whitehead and Russell's Principia Mathematica: 35 ('33) 274-304. — Boolean algebra. A correction: 557f., 971. — Interrelations among the four principal types of order: 38 ('35) 1-9. Mit: *) E. E. Rosinger. w

HUNTRESS, E r n e s t Hamlin. Chem. (org.). - 1929-35 Assist. Prof., '35-41 Assoc. Prof., '41-63 Prof., '63 Prof. Emeritus, '50-53 Deputy Dean and '5363 Secretary of Graduate School, '52-56 Dir. of the Summer Session, Massachusetts Inst, of Technol., Cambridge, Mass. *1898, Mai 9, Laconia, N.H. Bildnis Technology Rev. 65 ('63) Nr. 5. W . Brief introduction to the use of Beilstein's Handbuch der organischen Chemie "(New York '38) 1 0 + 4 4 S. - Problems in organic chemistry (New York-London '38) 1 1 + 2 7 0 S. (International chemical series). — Identification of pure organic compounds: Tables of data on selected compounds of order I (compounds of carbon with hydrogen or with hydrogen and oxygen) (m. S. P. Mulliken) (New York '41) 1 7 + 6 9 1 S. - The preparation, properties, chemical behavior and identification of organic chlorine compounds: Tables of data on selected compounds of order III (New York-London '48) 25 + 1443 S.; u. d. T.: Organic chlorine compounds (New York '49) 2 5 + 1 4 4 3 S. Advances Chem. Scr. Influence of nomenclature evolution upon comprehensive literature searches: 4 ('51) 10-18; 30 ('61) 47-57. Chemical and Engng. News Methods for rapid location of data on organic compounds: 27 ('49) 76-80. Industrial and Engng. Chem. The philosophy of classification of chemical literature: 40 ('47) 473-76. Industrial and Engng. Chem., Analyt. Edit. A precision sodium cutter 1 2 ): 4 ('32) lOOf. — An automatic pressure-regulating unit for vacuum distillation [, l] 1 2 ): 6 ('33) 144-46; ~ 2: Sulfuric acid as a manostat fluid 12 ): 344-46. J. amer. chem. Soc. [Fluorenones and diphenic acids, 2:] The preparation of substituted fluorenones«): 64 ('32) 826-28; 3:] The preparation of certain disubstituted fluorenones by the action of heat upon the corresponding substituted diphenic acids or their

derivatives«): 55 ('33) 2559-67; [ ~ 4 : ] The occurrence of a new case of isomerism in the fluorenone carboxylic acid series: isomeric products from the action of sulfuric acid upon 3,3'-dichlorodiphenic acid«)1): 4262-71; 5:] The constitution of the isomeric dichlorofluorenone carboxylic acids formed by the action of sulfuric acid on 3.3'-dichlorodiphenic acid 1 ): 58 ('36) 1514-18; ~ 6: Ring cleavage of 2-chloro-, 2-hydroxy-, 2-amino- and 2-sulfofluorenones with potassium hydroxide in diphenyl ether 2 3 ): 61 ('39) 816-22: ~ 7: Ring cleavage of 1,8-, 1,6- and 3,6-dichlorofluorenones with potassium hydroxide in diphenyl ether 23 ): 1066-71; ~ 8: Ring cleavage of fluorenone-4-carboxylic acids 23 ): 1358-64; ~ 9: Establishment of authentic 1-bromo- and 4-bromofluorenones 1 ') 18 ): 64 ('42) 2845-49. Preparation of 3-aminophthalhydrazide for use in the demonstration of chemiluminescence 27 16 ) ): 56 ('34) 241 f. - The constitution of the so-called "phenoldiphenein" 1 1 ): 61 ('39) 526f. —Identification of organic compounds,1: Chlorosulfonic acid as a reagent for the identification of aryl halides 6 ): 62 ('40) 511-14; ~ 3: Chlorosulfonic acid as a reagent for the characterization of aromatic ethers 5 ): 603f.; ~ 4 : Trityl ethers of cellosolves, carbitols and related glycols 23 ): 63 ('41) 593-95; ~ 5: Chlorosulfonic acid as a reagent for the identification of alkylbenzenes 2 ): 3446-48; — 6: The preparation of p-nitrobenzylpyridinium salts of aromatic sulfonic acids 8 ): 64 ('42) 1017-20. — The synthesis of the cyclohydrazides of coumarone-, thionaphthene- and indole-2,3-dicarboxylic acids « ) : 68 ('41) 276266. — The synthesis of 5-aminocoumarone2,3-dicarboxylic acid cyclohydrazide. A heterocyclic analog of 4-aminophthalhydrazide 11 ): 64 ('42) 86-90. - The synthesis of aminobenzoyleneureas and of dihydroxyquirioxalines isomeric with "luminol" 9 ): 2644-49. — The conversion of 2-phenyl-4-chloromethylthiazole to 2-phenvl-4-hydroxymethyl-5chlorothiazole 17 ): 65 ('43) 1667-70. - 2-Phenylthiazole-4,5-dicarboxvlic acid derivatives 17 ): 2167-69. — The preparation of 1,2-dichloropropene-1 21 ): 70 ('48) 2813f. - Preparation of triethylacetonitrile and triethylacetic acid 22 ): 2824f. - Ethyl 3-halocoumarin-4-carboxylates 16 ): 2831. — Diethyl oxalo-phenoxyacetate, diethyl oxalo-(S-phenylmercapto)-acetateandrelated compounds 16 ): 2856-59. — Dichromate salts of 2-benzyl- and 4-benzylpyridine 29 ): 3523. — Beckmann rearrangement of t h e oximes of phenyl-2-pyridylketone (2-benzoylpyridine) 29 ): 3702-07. — Alkane-choleic acids. Compounds of paraffin hydrocarbons with desoxycholic acid 19 ): 71 ('49) 458-60. — A new synthesis of 2,4-dihydroxyquinoline 4 ): 745f. — The Schmidt reaction, 1: Conditions and reaction mechanism with primary, secondary and tertiary aliphatic acids 22 ): 2233-37; ~ 2: A new re-

Huntress - Hurd arrangement observed during degradation of triethylacetic acid 22 ): 2238-40. — 1-Nitrofluorenone 1 ) 10 ) 28 ): 75 ('53) 743f. - A new route to 1-arylpyrroles 13 ) 11 ): 78 ('56) 419-23. — An extension of the Diels-Reese reaction 4 ) » ) : 2225-28.

2123

California, Los Angeles, Calif.; '3960 Member, '54-60 Chairman, Organic Nomenclature Committee, National Research Council. — '43 Hon. D. Sc. (Syracuse Univ., Syracuse, N. Y.). — '58 Midwest Gold Medal Award (Amer. Chem. Soc., St. Louis Sect.). *1897, Mai 7, Utica, N.Y.

J. chem. Educat. Oxidation of 3-aminophthalhydrazide as a lecture demonstration of chemiluminescence 2 ') 16 ): 11 ('34) 142-45. — Daily chemical anniversaries, historical and contemporary (with a chemical anniversary Zur Biogr. Chemical and Engng. News 36 calendar for the entire year): 14 ('37) 328-44. ('58) 96 (m. Bildn.). — 100 th Anniversary of the birth of Friedrich HZ. (Editor-in-chief) Chemical Bull. 1931K o n r a d Beilstein 3 ): 15 ('38) 51; 303-09. 1933. J. org. Chemistry 4-Benzyl-2,6-dimethylS. Organic chemistry (H. Gilman) (New pyridine, 1-benzylisoquinoline, 9-benzylacri- York'38) Kap. 7: Open chain nitrogen com24 dine, and certain relatives ): IB ('48) 674-81. pounds. — Laboratory design (H. S. Coleman) — The benzoylation of 2-aminopyridine 29 ): (New York '51) Kap. 6, 2: The organic chem735-37. istry laboratory. — Encyclopedia of chemical technology (R. E. Kirk, D. P. Othmer) 2 (New Nucleus [Cambridge, Mass.] America and York '48), 4 2 ('64) 132-48: Carbohydrates; 11 t h e chemical literature: 20 ('43) 161-63, 164. ('53): Pyrolysis. — Encyclopedia of chemistry Organic Syntheses Preparation of 4-nitro- (G. L. Clarku.a.) (New York-London '57): Kephthalic acid 26 )'): 16 ('36) 56f. - Preparation tenes; Pyrolysis. — Encyclopaedia Britannica. of 4-nitrophthalimide 2 5 )'): 58 f. — Preparation A new survey of universal knowledge 7 (Chiof beta-chloropropionic acid 12 ): 17 ('37) 95f. cago-London-Toronto . . . '65) 371-73: Diazo — Dimethyl acetylenedicarboxylate 13 ) 4 ): 32 compounds 111 ); 22 ('65) 135: Thiophene. ('52) 55-57. Analytical Chem. Automatically and continOrganic Syntheses, Collective Vol. /¡-Chloro- uously recording flow refractometer 113 ) 82 ): 22 propionic acid from trimethylene chlorohy- ('50) 1221-23. - Purification of methyl acedrin 20 ) 12 ): 1 2 ('41) 168f. - 4-Nitrophthal- t a t e and ethyl acetate 1 0 9 ): 23 ('51) 542. imide 26 ): 2 ('43) 459. Chromatographic separations of acetylated Proc. amer. Acad. Arts and Sci. [Biographi- sugars' 6 ): 36 ('64) 1375-78. cal digest, 1:] Centennials, sesquicentennials, Annual Rev. Biochem. The chemistry of the and bicentennials of chemical interest during carbohydrates: 14 ('45) 91-112. 1949: 77 ('49) 33-54; 2:] Centennials and Carbohydrate Res. [Amsterdam] Acetylenic polycentennials of chemical interest during 64 1950: 78 ('50) 1-35; [ ~ 3 : ] Centennials and sugar derivatives from glycals ): 2 f'66) 24050. sesquicentennials during 1951 with interest Chemical Bull. Erich von Gebauer-Fuelfor chemists and physicists: 79 ('51) 1-44; — 4 : Centennials and polycentennials during negg 46 ): 21 ('34) 255f. 1952 with interest for chemists and physicists: Industrial and Engng. Chem. Pyrolysis of 81 ('52) 35-99. unsaturated hydrocarbons: 26 ('34) 50-55. — 26 Technology Rev. M. I. T. summer session: Pyrolysis studies ): 776-80. 56 ('53/54) 191-94, 218-20, 222. Inorganic Syntheses Hydroxylamine 126 ) 12 '): Mit: ») E. R. A t k i n s o n ; «) J. S. A u t e n r i e t h ; ») s 1 ('39) 87-89. E. Berl; -nitrostyrene, furylnitroethylene and nitroolefins86) : 75 ('53) 285-88. - Infrared spectra of synthetic polypeptides prepared by the Lossen rearrangement 6 ) 61 ): 624-26. — Vapor phase halogenation of thiophene and 2-methylthiophene 2 ): 3517-20. - 2-Thienol 2 ): 5124f. — The Friedel-Crafts alkylation of methyl 2-furoate 83 ): 76 ('54) 50f. - Allyl ethers in the thiophene series 2 ): 1267f. — A novel rearrangement of hydroxamic acids using sulfonyl chlorides 6 ): 2791 f. — Chromanones, thiochromanones and 2,3-dihydro-4(lH)-quinolones 46 ): 5065-69. — Reaction of propiolactone with arylamines and with sulfonamides 4 *) : 5562f. - Carboxy-^-lactones 46 ) : 5563f. Reaction of propiolactone with heterocyclic amines 46 ): 77 ('55) 117-21. — The reaction of aromatic nitro compounds with polynuclear hydrocarbons at elevated temperatures 6 7 ): 601-06. — Reactions of 2,3-dihydropyran 76 ) 10 °): 2793-96. — Pyridine mercurials 80 ): 465860. — On acylhydrazones and 1,2,3-thiadiazoles 79 ): 5359-64. — Vinylation and the formation of acylals 97 ) 61 ): 78 ('56) 104-06. - The Browning reaction of sugars and amino acids approached by means of simple hydroxy ketones 13 ): 5667-71. — Behavior of kojic acid toward acrylonitrile, halo acids and hydrogen cyanide 116 ): 80 ('58) 2526f. - Nitrocoumarans 20 ): 4711-14. — Phenyl- and benzyl-malonohydroxamic acids and their rearrangements 91 ): 6053-57. - The cis and trans 12benzoyl-9,10-dihydro-9,10-ethanoanthracene11-carboxylic acids 114 ): 81 ('59) 116-19. Anomalous reactions of kojic acid and related compounds with acrylonitrile and acrylic ester 107 ) 116 ): 1684-87. - Structure of the compound obtained by reaction of acrylonitrile with a-deoxykojic acid116) : 2430-37. — The cleavage of phenyl alkyl ethers and 0 heterocyclic compounds by sodium in liquid ammonia 83 ): 2795-98. — The addition of ketenes to a,/3-unsaturated ethers 60 ): 82 ('60) 1373-76. — 3-Bromo-2,2-dimethylcoumaran and its reactions 20 ): 3662-67. — The behavior of ketene toward acetals, hemiacetal chlorides, acylals, mixed acetal-acylals and hemiacvlal halides 60 ): 83 ('61) 236-40. - Pyrolytic formation of arenes, 1 : Survey of general principles and findings 69 ) 106 ) 63 ): 84 ('62) 4509-15; — 2: Benzene and other arenes from thiophene, 2-methylthiophene and 2-(methyl14 C)-thiophene 63 ) 69 ): 4515-19; ~ 3: Pyrolysis of pyridine, picolines and methylpyrazine 106 ) : 4519-24; — 4: Pyrolysis of benzene, toluene and radioactive toluene 69 ): 4524-26. — Hydrazinedicarboxylic anhydrides and their reactions 17 ): 89 ('67) 1417-22. J . chem. Educat. The organic laboratory: 24 ('47) 333-37. - The general philosophy of organic nomenclature: 38 ('61) 43-47. —

2126

Hurd - Hurewicz

Hemiacetals, aldals, and hemialdals: 43 ('66) glycosyl halides by phenyllithium' 5 ): 29 ('64) 527-31. — Acid anhydride functionality: 44 2976-79. — Hydrogenation of a benzylio ('67) 454-60. ether without hydrogenolysis: 1-^-Cyclo64 J. chem. and Engng. Data Eeaction of hexyl-l,5-D-anhydroglucitol ): 31 ('66) 2045f. — Behavior of ketene toward a-methoxyhembenzoin with aminobenzoic acids and with to tetrahydropyran p-ethylaniline 76 ): 8 ('63) 87 f. - Solubility of iacetal halides related 96 indigo and dienophilic behavior of furan and to carbohydrates ): 32 ('67) 3516-20. toward dehydroindigo 11 '): 9 ('64) 582 f. — J. physic. Chem. The thermal decomposiAcylbisdiazomethanes 88 ): 12 ('67) 621 f. tion of tetramcthyllead 106 ) 70 ): 36 ('32) 939-48. J. org. Chemistry The ozonization of triple Organic Syntheses Propionaldehyde 74 ): 12 bonds 18 ): 1 ('36) 141-45. - The non-reaction ('32) 64f. - Ethyl ester of benzoylformic of acetylketene and maleic anhydride, and acid 70 ): 16 ('36) 89f. - /3-(2-Hydroxyethylsome notes regarding maleic acid 98 ) 122 ): 2 ('37) mercapto)-propionitrile [2-(2'-hydroxyethyl314-18. — The pyrolysis of alkylallyl and thio)-ethyl cyanide] 37 ): 29 ('49) 52 f. alkylcrotyl ethers of phenol and o-cresol 93 ): Organic Syntheses, Collective Vol. Benzoyl381-86. — Mechanisms for the rearrangement 70 2 of ethers: y-Ethylallyl phenyl ether and y- formic acid ): 1 ('41) 244f. 90 ethylallyl vinyl ether ): 3 ('39) 550-69. Trans. Illinois State Acad. Sci. Separation An improved apparatus for the laboratory and identification of sugars from mixtures 64 ) 122 42 preparation of ketene and butadiene ): 5 ): 34 ('41) Nr. 2. ('40) 122-25, — Directed ring closure in the Mit: ») J. L. Abernethy; a) H. J. Anderson; ») synthesis of chromans and coumarans from J. L. Azorlosa; ') P.J.Baker, jr.; •) - ; •) L. o-allylphenols 49 ): 212-22. — Consideration of Bauer; ') C. A. Blanchard; ') F. H. Blunck; •) T. Bollman; ") W. A. Bonner; ") - ; D. G. general methods for the formation of ke- H. Botteron; ") C. M. Buess; ") M. Calvin; ") S. M. tenes 16 ) 87 ): 8 ('43) 367-72,557-. - Attempts to Cantor; ") F.W. Cashion; so") F. F. Cesark; 18 isolate methylketene by pyrolytic methods 87 ) ) R.E.Christ; ")N.R.Currie; )R. Dowbenko; 22 S. Drake; ••) M. F. Dull; ") L. R. Drake; ): 10 ('45) 62-66. - Chloroacetone cyano- ") A. P. Dunlop;")•')S. O. E. Edwards; ") L.K. hydrin and related compounds 95 ): 441-48. — Eilers; 2') D. T. Englis;31"•) E. H. Ensor; ") J. W. Acyl interconversions of aryl polyacylglyco- Fan; ») O. E. Fanoher; ) J. R. Ferraro; »•) E. M. ••) G. W. Fowler; ") - ; »•) A. A. sides 10 ): 603-07. — Fusion synthesis of aryl Filachione; •«) J.W.Garrett; »') L. L. Gershbein; polyacylglycosides 10 ): 11 ('46) 50-54. — Hy- Frost; »•) L. G. Ginger; ••) H. G. Glass; ") A. R. Goldsby; droxamic acids from aliphatic dicarboxylic ") G. H. Goodyear; ") K. M.Gordon; ") F. O. acids 12 ): 207-14. - l,6-(or 2,5-)Disubstituted Green; ") H. Greengard; ") F. T. Gucker, jr.; »«) Sh. Hayao; ") - ; ") G. B. Heisig; «•) W. A. !0 naphthalenes 80 ) 10 ): 12 ('47) 369-72. - 1,9- Hoffman; ) R. P. Holysz; ") C. W. Huffmann; Cyclohexylenefluorene, a pentacyclic ring ") L. L. Isenhour;") T. Iwashige; ") H.Jen") L. H. system' 7 ): 13 ('48) 339-46. - The l-amino-2- kins; «•) W.Jenkins; ») R.N.Jones; M Jnel; ••) C. D. Kelso; ••) N. Kharaseh; ) R. D. nitroethenes 104 ): 471-76. — Thermal dehy- Kimbrough, jr.; ") I. M. Klotz; ") K. L. Kreuz; dration of sugars 26 ): 14 ('49) 680-91. — Base- •») R. Y. Levetan; •') R. W.Liggett; ») J.M. catalyzed condensation of a-halogenated ke- Longfellow; •') S. C. Lui; ") M. L.MeAuley; s tones with /S-keto esters 24 ): 15 ('50) 1160-64. • ) C. O. Mack; •') A. R. Macon; ™) R.W. McNamee; ") W. D. McPbee; ") T. T. Magel; ") E. Martin; ") R. N. Meinert; ») H. T. Miles; — Preparation and reactions of a-hydroxyl- K. '•) J.Moffat; ") J.D.Mold; ") G. H. Morey; amino nitriles 65 ): 16 ('51) 761-66. - The bro- '•) R. X. Mori;") C. J. Morrissey;")M. E. Nilson; mination of levulinic acid 31 ): 1639-42. — 5- ") C. T. O'Konski; ") G. L. Oliver; ••) E. N. Os•') C. I. Parrish; ••) J. Patterson; •') Carboxyvalerohydroxamic acid, 5-carboxy- borne; P. Perletz; ••) K. C. Petersen; ") F. D. Pilgrim; valeryl azide, 3-carboxypropionohydroxamic •i) M. A. Pollack; ") A. G. Prapas; ") H. M. acid, o-carboxybenzohydroxamic acid, and Priestley; •») M. P. Puterbaugh; ") H. R. Rate") C. H. Rector, jr.; '«) A.J.Richardson; polyamides prepared from them by rear- rink; •') (J.) R. Roach; •«) A. S. Roe; ••) M. A. Rogers; rangement 13 ) 6 ): 17 ('52) 865-76. - Cyclic modi- uo) L. Rosnati; »») B. Rudner; 10") W. H. Saun103 ders, jr.; ) L. S c h m e r l i n g ; L . T. Sherwood, fications of the dialdehyde from periodate 10S ) J. I. Simon; "•) J.H.Simons; »') R.J. oxidation of methyl a-D-glucopyranoside 4 ) 60 ) jr.; 1M ) J. C. Sowden; »») J. S. Strong; 110)A. D. M2 ): 18 ('53) 186-91. - Poly-2-amino-4-pen- Sims; Sweet; "') Sir T. W. J. Taylor; "•) C. L. Thomas; tenoic acid and polytryptophan 6 ): 1440-48. '") G. R. Thomas; »") A. Tockman; »») S. Trofimenko; »•) - ; 117) T.S.Wang; l u ) C.N.Webb; — Succino- and phthalo-hydroxamic acids 13 ) "') H. L. Wehrmeister; »») D. M. Wikholm; m ) «): 19 ('54) 1140-49. - The action of lead K. Wilkinson; »•) J.W.Williams; "») H. E. 1!s tetraacetate on dihydropyran 25 ): 1319-24. — Winberg; »•) W. A.1 Yarnall; ) R. P. Zelinski; 81 "') L. F. Audrieth; ") L. F. Nalefski. Aliphatic nitro ketones ): 20 ('55) 927-36. Decomposition of allylanilines in the presence of zinc chloride 56 ): 22 ('57) 1418-23. - 1- V I HUREWICZ, Witold. Math. Phenylpropyne 114 ): 23 ('58) 1087. - a-Deoxy- 1928-36 Lecturer, Univ. Amsterdam; 116 kojic acid and some of its derivatives ): 127678. — Preparation of acyclic imides 91 ): 24 '36-38 Fellow, Inst, for Advanced Study, ('59) 388-92. — Friedel-Crafts reactions of Princeton, N.J.; '38-39 Assist., '39-46 some acylals 63 ): 1321-24. — The arylation of Assist. Prof., Univ. of North Carolina,

Hurewicz — Hurmuzescu

Chapel Hill, N.C.; '46-48 Assoc. Prof., '48-56 Prof., Massachusetts Inst, of Technol., Cambridge, Mass.; Visiting Prof. : '43 Brown Univ., Providence, R.I., '48 Princeton Univ., Princeton, N.J. *1904, Juni 29, Lodz, Polen; •¡•1956, Sept. 6, Uxmal, Yucatán, Méx. Nekr. S. L e f s c h e t z , Bull. amer. m a t h . Soc. 63 ('57) 77-82 (m. Schr.verz. 49 Nrn.). S. Verhandlungen des Internationalen Mathematiker-Kongresses, Zürich 1932, 2 (Zürich-Leipzig '33) 191 : Über stetige Abbildungen topologischer B ä u m e . — Theory of servomechanisms (H. M. J a m e s u. a.) (New York '47) (Massachusetts Inst, of Technol., Radiation Labor, series, 25) 231-61: Filters a n d servosystems with pulsed d a t a . — Proc. International congress of mathematicians, Cambridge, Mass., 1950, 2 (Providence, R . I . '52) 344-49: H o m o t o p y and homology. W . Dimension theory (m. H . Wallman) (Princeton, N. J . '41) 7 + 1 6 5 S., ('48) 7 + 165 S. (Princeton m a t h e m a t i c a l series, 4). — Ordinary differential equations in t h e real domain with emphasis on geometric m e t h o d s (Providence, R . I . ' 4 3 ) 5 + 1 2 9 S. (Notes of lectures delivered a t Brown Univ. during t h e a u t u m n of 1943) [mimeogr.] ; als Buch u. d. T. : Lectures on ordinary differential equations (New York '58) 122 S. (Technology press, books in science and engineering). Annals Math. Sur la dimension des produits cartésiens: (2) 36 ('35) 194-97. - Ergodic theorem without invariant measure: 45 ('44) 192-206. — Continuous connectivity groups in t e r m s of limit groups 2 ) 1 ): 49 ('48) 391-406. Fundamenta Math. [Warszawa] Une remarque sur l'hypothèse d u continu: 19 ('32) 8f. — Über Schnitte in topologischen R ä u m e n : 20 ('33) 151-62. — Ein Satz über stetige Abbildungen: 23 ('34) 54-62. - Über Abbildungen topologischer R ä u m e auf die n-dimensionale S p h ä r e : 24 ('35) 144-50. - H o m o t o pie, Homologie u n d lokaler Z u s a m m e n h a n g : 25 ('35) 467-85. — Dehnungen, Verkürzungen, Isometrien 4 ): 26 ('36) 120-22. — Dimension of metric spaces 1 ): 43 ('56) 83-88. J. reine u. angew. Math. Über dimensionserhöhende stetige Abbildungen: 169 ('33) 7 1 78. Matematiceskij Shorn. Homotopie u n d H o mologie: 1 ('36) 697 f. [m. russ. Zusammenfassg.]. Prace mat. fizyczne Über E i n b e t t u n g topologischer R ä u m e in Cantorsche Mannigfaltigkeiten: 40 ('33) 157-61. - Ein einfacher Beweis des H a u p t s a t z e s über Cantorsche Mannigfaltigkeiten: 44 ('37) 289-92. 135*

2127

Proc., Koninkl. Akad. Wct. Amsterdam Über die henkelfreien K o n t i n u a : 35 ('32) 1077 f. — Ein Einbettungssatz über henkelfreie Kontinua 6 ): 36 ('33) 557-60. — Beiträge zur Topologie der Deformationen, 1: Höherdimensionale Homotopiegruppen: 38 ('35) 112-19; ~ 2: Homotopie- u n d Homologieg r u p p e n : 521-28; ~ 3: Klassen u n d Homologietypen von Abbildungen: 39 ('36) 117-26; ~ 4: Asphärische R ä u m e : 215-24. Proc. nation. Acad. Sei. USA H o m o t o p y relations in fiber spaces'): 27 ('41) 60-64. — On t h e concept of fiber space: 41 ('55) 956-61. — On t h e spectral sequence of a fiber space 3 ): 961-64. S.-Ber. preuß. Akad. Wiss. Über Abbildungen von endlichdimensionalen R ä u m e n auf Teilmengen Cartesischer R ä u m e : 1933, 7 5 4 68. Mit: C. H. Dowker; 2) J. Dugundji; ») E. Fadell; *) H. Freudenthal; «) - ; «) B. Knaster; ') N. E. Steenrod.

iv-vi HURMUZESCU, Dragomir. Physik. - 1913-37 Prof. Physik, Dir. d, Elektrotechn. Inst., '32 Dekan d. naturwiss. Fak., '36 Prorektor, Univ. Bucuresti; '35 Präs. d. Sekt. Physik, Vizepräs., Rumän. Akad. d. Wissenschaften. *1865, März 13, Bucuresti; •j-1954, Mai 31, Bucuresti. Zur Biogr. C. G. B e d r e a g , Studii si Cercet ä r i fti., Acad. Republ. popul. romine, Filial a Iasi, Fizicä si §ti. tehn. 7 ('57) H . 1. — C. G h i c a , Dragomir Hurmuzescu (Bucuresti '67) 176 S. (m. Bildn., Faks., Schr.verz'.); F l a c ä r ä 14 ('65) Nr. 47, S. 3; Metrologia apl. 12 ('65) 511-; N a t u r a , Ser. Geogr.-Geol. 18 ('66) Nr. 3, 90-92; Standardizarea 17 ('65) 313-. — St. P r o c o p i u i n : Contributii la istoria dezvoltärii Universitätii din Iasi, 18601960 2 (Bucuresti '60) 64-66 (m. Bildn.); Revista §ti. " V . A d a m a c h i " 28 ('42) 312-15 (m. Bildn., Schr.verz.). Zum 100. Geb.tag A. A v r a m a e s c u , Progresele §ti. 1965, Nr. 3, 6 3 - - C. G h i c a , Contemporanul 1965, Nr. 12, S. 7. Autobiogr. Erinnerungen, Analele sti. Univ. "AI. I. Cuza" Iasi, Sect. I (N.S.) 2 ('56) Nr. 1/2, 355-79 [rumän.]. S. Verhandelingen, op 25 Mei 1935 aangeboden a a n P . Zeeman ('s Gravenhage '35) 393f.: L'effet Zeeman et le magneton. W . Curs de electricitate generalä si aplicatä (Bucuresti '34) 927 S. [lithogr.]. Analele Acad, rom&ne, Mem. Sect» Zum 50. J a h r e s t a g des Todes von Professor E m a nuel Bacaloglu: (3) 17 ('42) Nr. 11, 1 - 1 3 I [rumän.].

2128

Hurmuzescu — Hylleraas

Bull. Soc. roumaine Physique Magnétisme Nekr. V. S n y d e r , Bull. amer. math. Soc. et matière. Magnéton et électron: 36 ('34 ) 42 ('36) 164. N r . 63/64, I f . — La supraconductibilité électrique des métaux: 3 - 7 .

HUYBRECHTS, Maurice-Emmanuel. Chem. (analyt.). — 1919 Prof, Ferner Druckausgaben von Vorträgen und extraord., '20-45 Prof, ord., '46 Prof, •weitere Aufsätze in rumänischen Fachzeit- émér., Univ. de Liège; '31-33 Prés, de la schriften in rumänischer Sprache. Soc. Chim. de Belgique. *1877, März 11, Mont-Saint-Guibert, y'VI HURWITZ, W a l l i e Abraham. Brabant; Math. - 1910-14 Instructor, '14-24 As•j-1952, Juni 8, Liège. Zur Biogr. Liber memorialis, L'Université sist. Prof., '24-54 Prof., '54 Prof. Emeride Liège de 1867 à 1935, 2 (Liège '36) 299-302 tus, Cornell Univ., Ithaca, N.Y. (m. Schr.verz.). — G. D u y c k a e r t s in: *1886; Febr. 18, Fulton, Mo.; L'Université de Liège de 1936 à 1966, 2: tl958, Jan. 6, Raleigh, N.C. Notices biographiques ( R . Demoulin) (Liège C.B. Séances Acad. Sei. Boumanie

L'effet

VI

Zeeman et le magnéton: 1 ('36) 18f.

Todesanzeigen American math. Monthly 65 •67) 408-12. ('58) 307. — Notices amer. math. Soc. 5 ('58) Nekr. Université de Liège. Ouverture solen138. - Science [ U S A ] 127 ('58) 231. nelle des cours. R a p p o r t sur la situation Annals Math. Definition of a field b y four de l'université pendant l'année académique 1951-1952 (Liège '53) 18f. postulates: (2) 33 ('32) 403-05. v>VI

HUTCHINS, Charles Clifford. Physik. - 1888-1927 Prof., '27 Prof. Emeritus, Bowdoin College, Brunswick, Me. *1858, Juli 12, Canton, Me. ; tl940, Apr. 13, San Diego, Calif. Nekr. Charles Clifford Hutchins, 1858-1940

S. L i b e r memorialis, L'Université de Liège de 1867 à 1935, 2 (Liège '36) 28-30: Isidore Kupfferschlaeger; 132-43: Lucien-Louis de Köninck.

W . L e p H et sa mesure. Les potentiels d'oxydo-réduction. L e r H 2 (Liège '32) 394 S . ; 3 ('39) 460 S.; 4 ('45, '47) 474 S. (Bibliothèque scientifique belge, 4). — Chimie analytique appliquée. Manuel à l'usage des étudiants (Brunswick, Me. '40) I I S . ( B o w d o i n College a ( L i è g e - P a r i s '38) 363 S.; 3 ('53) 469 S. Bulletin, 254). Bull. Soc. chim. Belgique Solubilité du Chromate plombique. Application au dosage v, vi HUTCHINSON, Arthur. Mineral. titrimétrique du plomb 1 ): 42 ('33) 331-46. - 1926-31 Prof., '31 Prof. Emeritus, '28- Mit: C. Degard.

37 Master of Pembroke College, Univ. of Cambridge; '15-21 Vice-Pres., '21-24 Pres., Mineral. Soc.; '33-34 Pres., Roy. Soc. London, ( g ) *1866, Juli 6, London; 1-1937, Dez. 12. Zur Biogr. Nature [ L o n d o n ] 139 ('37) 577 f. Nekr. W . B r a g g , Proc. roy. Soc., London, Ser. A 169 ('38/39) 1; Ser. B 126 ('38/39) 263. W . C . S m i t h , Obituary Notices Fellows roy. Soc. London 2 ('39) 483-91 (m. Bildn., Faks., Schr.verz.). — H . W . M i l l s , J. chem. Soc., London 1939, 210-13. — Chemistry and Industry 15 ('37) 1162. - N a t u r e [ L o n d o n ] 140 ('37) 1087.

iv-vi

v>VI

HYDE, E d w a r d Pechin. Physik. — 1905-07 Assist. Physicist, '07-08Assoc. Physicist, Bureau of Standards, Washington, D.C.; '08-20 Dir., Nela Research Labor. ; '20-23 Dir. of Research, National Lamp Works of General Electric Co. ; '10 Pres. of the Illuminating Engng. Soc.; '21-28 Pres. of the Internation. Commission on Illumination, Cleveland, Ohio. — Medal (Franklin Inst., Philadelphia, Pa.). — ['69 Living in retirement in Cannes, France]. *1879, Jan. 3, Baltimore County, Md.

HUTCHINSON, John Irwin. Math. V I HYLLERAAS, E g i l Andersen. Phy- 1910-35 Prof., Cornell Univ., Ithaca, sik. — 1926-31 Stipendiat, '31-37 wiss. N.Y. ( B ) Mitarbeiter theoret. Physik, Chr. Michel*1867, Apr. 12, Bangor, Me.; sens Inst., Bergen; '37-65 Prof., Univ. fl935, Dez. 1, Ithaca, N.Y. Oslo. — Gunnerusmedalje (Kgl. Norske

Hylleraas

Videnskabers Selskab,Trondhjem) ; Fridtjof Nansens Bekinning (Videnskabs Akad. Oslo). *1898, Mai 15, Engerdal; 1-1965, Okt. 28, Oslo. Zur Biogr. Universitetet i Oslo 1911-1961,1 (Oslo '62) 520f. - Fysikkens Verden 26 ('64) 49 f. Zum 60. Geb.tag Festskrift til Egil Hylleraas p à sekstiârsdagen 15de mai 1958 (H. Wergeland, O. P. Arvesen) (Trondhjem '58) 135 S. — H. W e r g e l a n d , Fysikkens Verden 20 ('58) 1-6. Nekr. 0 . R. G j o t t e r u d , Nuclear Physics 89 ('66) 1-10 (m. Bildn., Schr.verz. 140 Nrn.). - H. W e r g e l a n d , Fysikkens Verden 28 ('66) 1-10 (m. Bildn., Schr.verz. 76 Nrn.). Zur Bibliogr. E. A. H y l l e r a a s , Abhandlungen aus den Jahren 1926-1937 (Oslo '56) 352 S. H Z . Fysikkens Verden 1939-1956. S. Festskrift til Prof. Björn Heiland-Hansen. Symposium on the quantum theory of molecules, Stockholm-Uppsala 1955 (Bergen '56) 128-38: Recent calculations of the energy values of two-electron atoms. W. N y t t fra fysikkens omrâde (m. L. Vegard) (Oslo '34) 80 S. — Atomenes bygning i lys av lseren om elektroner, protoner og lyskvanta (Bergen '34) (Publikasjoner fra Chr. Michelsens Institutt, 45). — Teoretisk fysikk 1 : Matematisk grunnlag, Vektorregning, Mekanikk (Oslo '39) 6 + 202 S.; 2: Lagrange, Hamiltons mekanikk, Kontinua, Elektrodynamikk, Termodynamikk, Statistisk mekanikk ('39) S. 203-386; 3 : Kvanteteorie, Bolgemekanikk ('39) S. 387-534. Atomene. Forskningens vei mot ukjent land (Oslo '47) 239 S. ; schwed. : Atomerna. Forskningens väg mot okänt land (Stockholm '50) 235 S. ; finn. : (Helsinki '53) 234 S. - Matematisk og teoretisk fysikk 1 : Fysikkejis matematiske grunnlag (Oslo '50) 12 + 215 S.; 2: Mekanikk og statistikk ('51) 10 + 297 S.; 3 : Elektrisitet og magnetisme ('50) 11 + 254 S.; 4: Atomteori ('52) 12 + 320 S. - Forskning og fremskritt i moderne fysikk (m. S. O. Sorensen) (Oslo '54) 79 S. (Aschehougs populaervitenskapelige boker). — Kvantemekanikk. Forelesninger. Vârsemestret 1964 1 (Oslo '64) 2 + 62 S„ 2 ('64) S. 63-173 [mimeogr.]. Advances Quantum Chem. The Schrödinger two-electron atomic problem: 1 ('64) 1-33. Annales Inst. Henri Poincaré Equation d'ondes d'un électron dans le champ de forces de deux noyaux atomiques. Problème de l'ion moléculaire d'hydrogène: 7 ('37) 121-53. Annals Physics On the inversion of eigenvalue problems: 26 ('63) 309-24.

2129

Archiv Math, og Naturvid. Evaluation öf transition probabilities for non-Coulombiän central fields: 48 ('45/46) 57-88. — Expansion of products of Laguerre polynomials: 52 ('54/55) 69-72. Astrophysica norveg. ü b e r die Schwingungen eines stabil geschichteten, durch Meridiane begrenzten Meeres, 1: Allgemeine Betrachtungen: 3.1938/43('43) 139-64; ~ 2: Berechnung der Eigenfrequenzen 4 ): 247-71. — The negative hydrogen ion in quantum mechanics and astrophysics: 9 ('64) 345-49. Astrophysical J. A new stable state of the negative hydrogen ion: 111 ('50) 209-13. — Note on the doubly excited state of the negative hydrogen ion: 113 ('51) 704. Avh. norske Vid.-Akad. Oslo, I Über die Anwendbarkeit des Yukawa-Potentials bei leichten Kernen 3 ): 1941, Nr. 3, 22 S. - On the solution of the relativistic wave equation for an electron in a Coulomb field: 1943, Nr. 1, 15 S. — Potential walls and the socalled Klein paradox in relativistic quantum mechanics: Nr. 2, 9 S. — Two-electron angular wave functions: 1949, Nr. 5, 18 S. Beretninger Chr. Michelsens Inst. Vid. og Andsfrihet Die Struktur der Materie im Lichte der Quantenmechanik: 2 ('32) Nr. 3, 28 S. [norweg. m. deutscher Zusammenfassg.}. — Über die Behandlung von Mehrelektronenproblemen in der Quantentheorie mit besonderer Rücksicht auf eine vollständige Lösung des Heliumproblems: 3 ('33) Nr. 2, 29 S. [ ~ ] . — Die Bedeutung der Wellenmechanik für das Verständnis der chemischen Bindung: Nr. 3, 24 S. [ ~ ] . — Atomtheorie und Kernbau im Lichte der neuesten Entdeckungen des Neutrons und des Deutons: 4 ('34) Nr. 3, 28 S. [—]. — Wellenmechanische Berechnung von Energiezuständen im Heliumatom: Nr. 4, 25 S. [—]. — Das physikalische Weltbild: Nr. 8 , 3 2 S . [ ~ ] . - K v a n t e m e k a n i s k e grunnproblemer. Den almindelige og relativistiske formulering av kvantemekanikken : Nr. 9, 95 S. [m. engl. Zusammenfassg.]. —Das Kausalitätsprinzip in der modernen Physik : 5 ('35) Nr. 7, 30 S. [norweg. m. deutscher Zusammenfassg.]. — Calcul des champs de forces moléculaires sur base de spectres de bandes: 6 ('36) Nr. 3, 38 S. [norweg. m. franz. Zusammenfassg.]. — Was leistet die moderne Atomtheorie zur Erklärung chemischer Gesetze?: 7 ('37) Nr. 6, 24 S. [norweg. m. deutscher Zusammenfassg.]. Fritt Ord Atomforskning og verdensanskuelse: 4 ('34) 101-11. Fysikkens Verden Hvad vet vi om atomkjernene?: 1 ('39) 3-17. - Professor Sem Sseland, in memoriam: 3 ('41/42) 1-4. — Atomkjernenes sammensetninger og omdannelser: 23-32. — Refleksjonsfrie grenseflater for optiske medier: 153-57. — Om

2130

Hylleraas

beregning av visse multiple integraler i kjernefysikken: 191-93. - Galileo Galilei: 194-208. — Om tidevannssvingninger i havomrader begrenset av kontinenter: 4 ('42/43) 97-111. — Robert Mayer og energilovens 100-ars jubileum: 117-26. — Nobelpristagere i fysikk: Wilhelm Konrad Röntgen: 129-37; Hendrik Anton Lorentz, Pieter Zeeman: 193-98; Henri Antoine Becquerel, Pierre Curie, Marie Sklodowska Curie: 5 ('43) 1 - 9 ; Lord Rayleigh, Philipp Lenard, Sir Joseph J o h n Thomson: 69-79; Albert A. Michelson: 6 ('44) 146-50; Gabriel Lippmann: 207-10; Otto Stern, I. I. Rabi: 7 ('45) 1 - 8 ; Guglielmo Marconi, Ferdinand Braun: 11-16; Johannes Diderik van der Waals, Wilhelm Wien, Nils Gustaf Dalen, Heike Kamerlingh Onnes: 65-89; Wolfgang Pauli: 243-47; Max v. Laue: 8 ('46) 1 - 4 ; Sir William Henry Bragg: 5 - 8 ; William Lawrence Bragg: 9f.; Charles Glover Barkla: 11-13; Max Planck: 145-51; Johannes Stark: 15255; Charles Edouard Guillaume: 156-58; Albert Einstein: 9 ('47) 5-12; Niels Bohr: 6577; Robert Andrews Millikan: 10 ('48) 97-102; Manne Siegbahn: 11 ('49) 1 - 7 ; Hideki Yukaw a : 129-33: James Franck og Gustav Hertz: 197-204; J e a n Perrin: 12 ('50) 1 - 6 ; A. H. Compton: 113-18; C. T. R. Wilson: 13 ('51) 49-52; Owen Willans Richardson: 113-17; Felix Bloch, Edward M. Purcell: 15 ('53) 1 - 6 ; Frits Zernike: 97-101; Max Born: 16 ('54) 97-99; Walther Bothe: 17 ('55) 1-4. Dr. Axel Aubert. I n memoriam: 5 ('43) 65-68. — Nobelpristagere i kjemi: Svante Arrhenius: 6 ('44) 5 - 7 ; Sir William Ramsey, Sir Ernest Rutherford, Wilhelm Ostwald: 65-74; George v. Hevesy: 7 ('45) 9f.; Otto H a h n : 248-52; Walter Nernst: 9 ('47) 130-33; Frederick Soddy: 134-39; Francis William Aston: 10 ('48) 49-53; Linus Pauling: 16 ('54) 100f. Professor Dr. Niels Bohr. Til hans 60-ärsdag 7. okt. 1945: 7 ('45) 129-31. - Om formuleringen av variasjonsproblemer for kontinuerlige egenverdi-spektra: 175-79. — Carl Stermer: 239-42. — Elektriske malinger og elektriske mälsystemer: 253-70. — Om polyelektroner: 8 ('46) 228-42. - Binding energy öf the positronium molecule 2 ): 243-49 [ ]. — E n meget vakker halo i Engerdal 1. april 1947: 9 ('47) 27-47. — Elektriske og elektromagnetiske akseleratorer: 111-28. — Construction of differential equations from their eigenvalues: 10 ('48) 84-88. — Om en ny dobbelt anslätt tilstand for det negative vannstoffjon: 12 ('50) 75-89. — Om den magnetiske avskjermning i heliumatomet og vannstoffmolekylet: 152-65. — Tor Böhm Staver, 8. januar 1922-5. februar 1952:14 ('52) 53-55. — Hendrik Anthony Kramers. I n memoriam: 99-103. - The Physical Society: 15 ('53) 190-92. — Albert Einstein, 14. mars 187918. april 1955: 17 ('55) 5-8. - Atomforskningen og det Europeiske samarbeide i kjernefysikk i Geneve (CERN): 18 ('56) 3-18. -

Olaf Devik 70 ä r : 97-102. - Nelius Holte Moxnes, 17. mai 1897-4. nov. 1956: 19 ('57) 1-3. — Professor Dr. Björn Helland-Hansen, 1877-1957: 97-100. - Prof. L. Vegard 80 är, 3. februar 1960: 21 ('59) 241-44. - Reminiscences from early quantum mechanics of twoelectron atoms: 25 ('63) 23f. [m. norweg. Zusammenfassg.]. Geofysiske Publ., Norske Vid.-Akad. Oslo On the theory of tidal oscillations in oceans with solid boundaries: 13 ('43) Nr. 10, 12 S. J. chem. Physics Some critical remarks concerning Bailli Nilsen's paper "On the theory of free radicals and organo-alkali compounds": 3 ('35) 313f. — Energy formula and potential distribution of diatomic molecules: 595. Mathcmatica scandinav. Linearization of products of Jacobi polynomials: 10 ('62) 189-200. Naturen Heisenberg, Schrödinger og Dirac: 57 ('33) 353-61. - Yannstoffatomet med masse 2, og dets betydning for fysisk og kjemisk forskning: 58 ('34) 20-27. - Om neutronet, den nyoppdagede elementserpartikkel i atomkjernene: 47-55. — Positronet, det positive elektron: 161-68. — Robert Mayer og energilovens 100-ars jubileum: 67 ('43) 1-12. Naturwissenschaften Über die formelmäßige Darstellung der Rotationsenergiekonstanten der Moleküle und ihre Anwendung zur Berechnung von Dissoziationsenergien: 24 ('36) 279 f. Nuclear Physics Determination of a perturbing potential from its scattering phase shift and bound states energy levels: 57 ('64) 20831. Physica math, osloensis The variational principle in quantum mechanics: Nr. 1 ('59) 6 S. — On a useful transformation of Legendre and Laguerre product functions in two-electron atomic theory: Nr. 3 ('59) 8 S. — On the formal solution of t h e two-electron wave equation: Nr. 6 ('60) 6 S. — On the computation of sums of reciprocal powers: Nr. 7 ('60) 8 S. — Tables of reciprocal powers of integers and various infinite sums to 55 decimals 1 ): Nr. 8 ('60) 67 S. — Resonance method in scattering theory: Nr. 11 ('61) 16 S.; Nr. 18 ('63) 21 S. — On t h e Bethe-Heitler formula for bremsstrahlung: Nr. 16 ('62) 19 S. — Determination of a perturbing potential from its scattering phase shift and bound states energy levels: 19 ('63) 31 S. — On the conception of generalized spin of free Dirac particles: Nr. 22 ('64) 11 S. Physical Key. Stability of polyelectrons 2 ): 71 ('47) 468-. - Electron affinity of positronium: 491-93. — Binding energy of t h e positronium molecule 2 ): 493-96. — Calculation of a perturbing central field of force from

Hylleraas - - Idel'son the elastic scattering phase shift: 74 ('48) 48-51. — On the magnetic shielding in He and H 2 6 ): 79 ('50) 117-22. - Ground state energy of two-electron atoms 1 ): 108 ('56) 829f.; 109 (*58) 1013f. Physikalische Z. Ein neuer Ansatz für den Potentialverlauf bei zweiatomigen homöopolaren Molekülen. Anwendung auf CdH und N 2 : 86 ('35) 599f. Reviews modern Physics Reminiscences from early quantum mechanics of two-electron atoms: 35 ('63) 421-31. Samtiden Det 20. àrhundres naturopfatning: 52 (*41) 117-26. - Galileo Galilei: 53 ('42) 19-30. — Isaac Newton: 413-22. — Atomer og energi: 54 ('45) 174-87. Skr. norske Vid.-Akad. Oslo Die Grundlagen der Quantenmechanik mit Anwendungen auf atomtheoretische Ein- und Mehrelektronenprobleme : 1932, Nr. 6, 142 S. Tidsskr. Kjemi og Bergvesen Kvanteteori og kemi: 12 ('32) 89-94. - Atomteori og kjernebygning i lys av de nyeste oppdagelser, neutronet og deutronet: 14 ('34) 2 f. — Positronet, det positive elektron: 54-58. — Det "tunge" vannstoffatom og det "tunge" vann. Oppdageren og oppdagelsen: 15 ('35) 7-11. Tidsskr. Kjemi, Bergvesen og Metallurgi Hideki Yukawa. Nobelprisen i fysikk 1949: 10 ('50) 1-3.

2131

Z. Physik Die Wellengleichung des Keplerproblems im Impulsraume: 74 ('32) 216-24. — Wellenmechanische Berechnung der Rydbergkorrektion der Heliumterme: 83 ('33) 739-64. — Polarisationseffekt der Helium-DTerme. Dipol- und Quadrupoleffekt: 88 ('34) 108-13. — Zur Konvergenzfrage gewisser Näherungslösungen der „äußeren" Gleichung des Zweizentrenproblems: 93 ('35) 582-88. — Analytische Darstellung von Potentialen zweiatomiger Moleküle und ihre Bestimmung aus spektroskopischen Daten, 1: Allgemeine Theorie: 96 ('35) 643-60; ~ 2: Anwendung auf die Moleküle CdH und N 2 : 661-68. — Theoretische Berechnung von Übergangswahrscheinlichkeiten im Helium: 106 ('37) 395-404. — Über die Eigenschwingungen des Tetraedermoleküls: 107 ('37) 86-90. - Über die Bindungskräfte zwischen elementaren Kernpartikeln: 258-72. — Zur praktischen Lösung der relativistischen Einelektronengleichung, 1:140 ('55) 626-31; ~ 2: 164 ('61) 493-506. — Über die Darstellung von Spinoren: 167 ('62) 243-49; ~ 2: Zur Frage des generalisierten Spins: 182 ('64) 58-63. — Über die Rotationsenergien und Eigenfunktionen des symmetrischen und asymmetrischen Kreisels: 190 ('66) 226-34. Außerdem Vorlesungsskripten über Atomtheorie, Quantentheorie, Quantenmechanik, Elektromagnetismus. Mit: J. M i d t d a l ; ») Aa. Ore; «) V. R i s b e r g ; *) W. R o m b e r g ; ' ) S. S k a v l e m .

VI

('39) 142-58. — The molecular fields of carbodioxide and nitrous oxide 2 ) 3 ): 173 ('39) 543n 54. — The diffusion and thermal diffusion of hydrogen-deuterium, with a note on the thermal diffusion of hydrogen-helium 3 ) 6 ): 178 ('41) 380-89. Physica The experimental development of W. Thermal diffusion in gases (m. K. E. Grew) (Cambridge '52) 11 -f 143 S.; deutsch: thermal diffusion: 4 ('37) 1133-40. Thermodiffusion in Gasen (Berlin '62) 170 S. Mit: ') B . E . A t k i n s ; ') R. E.5 B a s t i o k ; ') H. R.

IBBS, Thomas Leonard. Physik. 1919-54 Lecturer, '54-56 Prof., '57 Prof. Emeritus, Univ. of Birmingham. *1889, Juni 16, Middleton by Wirksworth.

Philosophical Mag. and J . Sei. The thermal conductivity of carbon dioxide: (7) 21 ('36) 508f. Proc. roy. Soc., London, Ser. A The field of the force and the form of the carbon dioxide molecule, 1: Thermal diffusion in mixtures containing carbon dioxide 4 ): 134 ('32) 613-27; ~ 2: The variation of the viscosity of carbon dioxide with temperature 4 ): 628-35; ~ 3: The form of the carbon dioxide molecule 4 ): 636-42. — Thermal diffusion in mixtures of the inert gases 1 ) 2 ): 172

H e a t h ; ' ) A. C. R. W a k e m a n ; ) N. E. Wild. VI

IDEL'SON, N a u m Il'ic. Astron., Math., Gesch. d. Naturwiss. — Stud, jurist, u. physikal.-math. Fak., Univ. Petersburg; danach Mitarbeiter eines Anwalts u. Mittelschullehrer f. Math.; '18-23 wiss. Mitarb., Astron. Abteiig., Wiss. Inst. „P. F. Lesgaft", Leningrad; '19-23 wiss. Mitarb., Staatl. Recheninst., Leningrad; '23- Leiter d. Astrometr.

Hylleraas - - Idel'son the elastic scattering phase shift: 74 ('48) 48-51. — On the magnetic shielding in He and H 2 6 ): 79 ('50) 117-22. - Ground state energy of two-electron atoms 1 ): 108 ('56) 829f.; 109 (*58) 1013f. Physikalische Z. Ein neuer Ansatz für den Potentialverlauf bei zweiatomigen homöopolaren Molekülen. Anwendung auf CdH und N 2 : 86 ('35) 599f. Reviews modern Physics Reminiscences from early quantum mechanics of two-electron atoms: 35 ('63) 421-31. Samtiden Det 20. àrhundres naturopfatning: 52 (*41) 117-26. - Galileo Galilei: 53 ('42) 19-30. — Isaac Newton: 413-22. — Atomer og energi: 54 ('45) 174-87. Skr. norske Vid.-Akad. Oslo Die Grundlagen der Quantenmechanik mit Anwendungen auf atomtheoretische Ein- und Mehrelektronenprobleme : 1932, Nr. 6, 142 S. Tidsskr. Kjemi og Bergvesen Kvanteteori og kemi: 12 ('32) 89-94. - Atomteori og kjernebygning i lys av de nyeste oppdagelser, neutronet og deutronet: 14 ('34) 2 f. — Positronet, det positive elektron: 54-58. — Det "tunge" vannstoffatom og det "tunge" vann. Oppdageren og oppdagelsen: 15 ('35) 7-11. Tidsskr. Kjemi, Bergvesen og Metallurgi Hideki Yukawa. Nobelprisen i fysikk 1949: 10 ('50) 1-3.

2131

Z. Physik Die Wellengleichung des Keplerproblems im Impulsraume: 74 ('32) 216-24. — Wellenmechanische Berechnung der Rydbergkorrektion der Heliumterme: 83 ('33) 739-64. — Polarisationseffekt der Helium-DTerme. Dipol- und Quadrupoleffekt: 88 ('34) 108-13. — Zur Konvergenzfrage gewisser Näherungslösungen der „äußeren" Gleichung des Zweizentrenproblems: 93 ('35) 582-88. — Analytische Darstellung von Potentialen zweiatomiger Moleküle und ihre Bestimmung aus spektroskopischen Daten, 1: Allgemeine Theorie: 96 ('35) 643-60; ~ 2: Anwendung auf die Moleküle CdH und N 2 : 661-68. — Theoretische Berechnung von Übergangswahrscheinlichkeiten im Helium: 106 ('37) 395-404. — Über die Eigenschwingungen des Tetraedermoleküls: 107 ('37) 86-90. - Über die Bindungskräfte zwischen elementaren Kernpartikeln: 258-72. — Zur praktischen Lösung der relativistischen Einelektronengleichung, 1:140 ('55) 626-31; ~ 2: 164 ('61) 493-506. — Über die Darstellung von Spinoren: 167 ('62) 243-49; ~ 2: Zur Frage des generalisierten Spins: 182 ('64) 58-63. — Über die Rotationsenergien und Eigenfunktionen des symmetrischen und asymmetrischen Kreisels: 190 ('66) 226-34. Außerdem Vorlesungsskripten über Atomtheorie, Quantentheorie, Quantenmechanik, Elektromagnetismus. Mit: J. M i d t d a l ; ») Aa. Ore; «) V. R i s b e r g ; *) W. R o m b e r g ; ' ) S. S k a v l e m .

VI

('39) 142-58. — The molecular fields of carbodioxide and nitrous oxide 2 ) 3 ): 173 ('39) 543n 54. — The diffusion and thermal diffusion of hydrogen-deuterium, with a note on the thermal diffusion of hydrogen-helium 3 ) 6 ): 178 ('41) 380-89. Physica The experimental development of W. Thermal diffusion in gases (m. K. E. Grew) (Cambridge '52) 11 -f 143 S.; deutsch: thermal diffusion: 4 ('37) 1133-40. Thermodiffusion in Gasen (Berlin '62) 170 S. Mit: ') B . E . A t k i n s ; ') R. E.5 B a s t i o k ; ') H. R.

IBBS, Thomas Leonard. Physik. 1919-54 Lecturer, '54-56 Prof., '57 Prof. Emeritus, Univ. of Birmingham. *1889, Juni 16, Middleton by Wirksworth.

Philosophical Mag. and J . Sei. The thermal conductivity of carbon dioxide: (7) 21 ('36) 508f. Proc. roy. Soc., London, Ser. A The field of the force and the form of the carbon dioxide molecule, 1: Thermal diffusion in mixtures containing carbon dioxide 4 ): 134 ('32) 613-27; ~ 2: The variation of the viscosity of carbon dioxide with temperature 4 ): 628-35; ~ 3: The form of the carbon dioxide molecule 4 ): 636-42. — Thermal diffusion in mixtures of the inert gases 1 ) 2 ): 172

H e a t h ; ' ) A. C. R. W a k e m a n ; ) N. E. Wild. VI

IDEL'SON, N a u m Il'ic. Astron., Math., Gesch. d. Naturwiss. — Stud, jurist, u. physikal.-math. Fak., Univ. Petersburg; danach Mitarbeiter eines Anwalts u. Mittelschullehrer f. Math.; '18-23 wiss. Mitarb., Astron. Abteiig., Wiss. Inst. „P. F. Lesgaft", Leningrad; '19-23 wiss. Mitarb., Staatl. Recheninst., Leningrad; '23- Leiter d. Astrometr.

2132

Idel'son

Abteiig., Astron. Inst., Leningrad; gleichzeitig bis '26 Leiter d. Berechnungsabteilg., '31-34 wiss. Mitarb. u. '34Leiter d. Theoret. Abteiig., Observât. Pulkovo; '26-31 Lektor, '31-33 Doz., '33-51 Prof., '36 Dr. d. physikal.-math. Wiss., Univ. Leningrad; '30-37 Prof., Inst. f. Feinmechanik u. Optik, Leningrad. *1885, März 13 (1), Petersburg; tl951, Juli 14, Asari bei Riga. Zur Biogr. N. S. J a c h o n t o v a , Istorikoastron. Issled. 4 ('58) 387-405 (m. Bildn. u. Schr.verz.). Zur Bibliogr. S. N. K o r y t n i k o v , Über die Arbeiten Idel'sons zur Geschichte der Astronomie: Istoriko-astron. Issled. 4 ('58) 407-31 [russ.]. Nekr. Astronomiceskij Cirk. Nr. 117 ('51) 14. H.( Redakt.) P. A p p e l ' , Figury ravno vesi ja vraScajuscejsja odnorodnoj zidkosti [P. A p p e l l , Figures d'équilibres d'une masse liquide homogène en rotation] (Leningrad-Moskva '36); darin eigene Beiträge: 316-57: Die Behandlung des Problems der Gleichgewichtsfiguren in der Theorie von Ljapunov [russ.]; 358-66: Das ellipsoide Geoid [russ.]. — (Redakt.) A. N. K r y l o v , Sobranie trudov [Gesammelte Werke] 2 , 1 : Kompasnoe delo [Arbeiten über den Kompaß] (Moskva-Leningrad '43); 2, 2: Zemnoj magnetizm i kompasnoe delo [Arbeiten über Erdmagnetismus und Kompaß] ('47); 8: Mechanika ('50). (Redakt.) A. K l e r o , Teorija figury zemli, osnovannaja na nacalach gidrostatiki [A. C l a i r a u t , Théorie de la figure de la terre, tirée des principes de l'hydrostatique] (Moskva-Leningrad '47); darin eigene Beiträge: 221-59: A. Clairaut und seine „Theorie der Erdgestalt" [russ.]; 260-355: Kommentare [russ.]. HZ. (Redakt.) Astronomiceskij Ezegodnik SSSR 1942,1948. Ue. Dz. D z i n s , Vselennaja vokrug nas [aus d. Engl.: J . J e a n s , Universe around us] (Leningrad-Moskva '32) 401 S. S. C.R. 7 e Séance de la Commission géodésique baltique, Léningrad et Moscou 1934, 2 (Helsinki '35) 9-23: Über die Bestimmungen der Figur der Erde aus Schwerkraftmessungen. — Zozef Lui Lagranz. Sbornik statej k 200-letiju so dnja rozdenija [Joseph Louis Lagrange. Sammlung von Aufsätzen zum 200. Geburtstag] (A. N. Krylov) (MoskvaLeningrad '37) 17-46: Über die Mechanik Lagranges [russ.]. — M. V. Lomonosov. Sbornik statej i materialov [Sammlung von Aufsätzen und Materialien] 1 (Moskva -Leningrad

'40) 66-116: Bemerkungen zu Lomonosovs Theorie der Kometenschweife und zu deren Diskussion [russ.]. — Galileo Galilej, 15641642. Sbornik, posvjascennyj 300-letnej godovscine so dnja smerti [Galileo Galilei. Sammelband zum 300. Todestag] (A. M. Deborin) (Moskva-Leningrad '43) 68-141: Galilei in der Geschichte der Astronomie [russ.]. - Isaak N'juton, 1643-1727. Sbornik statej k 300-letiju so dnja rozdenija [Isaac Newton. Sammlung von Aufsätzen zum 300. Geburtstag] (S. I. Vavilov) (MoskvaLeningrad '43) 161-210: Das Gravitationsgesetz und die Theorie der Bewegung des Mondes [russ.]. — Nikolaj Kopernik. Sbornik statej k 400-letiju so dnja smerti [Nikolaus Kopernikus. Sammlung von Aufsätzen zum 400. Todestag] (Moskva-Leningrad '47) 5-42: Kopernikus'Leben und Werk [russ.]; 84-179: Studie zur Geschichte der Planetentheorie [russ.]; 214-17: Anmerkungen [russ.]. — Jubilejnyj sbornik, posvjascennyj 30-letiju Velikoj Oktjabr'skoj socialisticeskoj revoljucii [Jubiläumsband zum 30. Jahrestag der Großen Sozialistischen Oktoberrevolution] 1 (MoskvaLeningrad '47) 465-70: Katalog von 2957 Sternen mit Deklinationen —10° bis + 9 0 ° [russ.] x ). — Priborostroenie. Sbornik statej [Apparatebau. Sammlung von Aufsätzen] 1 (Moskva-Leningrad '47) 127-35: Zur Methodik der Darstellung der Theorie des Kreisels [russ.]. - Vol'ter, 1694-1778. Stat'i i materialy [Voltaire. Aufsätze und Materialien] (V. P. Volgin) (Moskva-Leningrad '48) 21541: Voltaire und Newton [russ.]. — Geodezija. Spravocnoe rukovodstvo [Geodäsie. Nachschlagewerk] 1: Fiziceskaja geodezija (Leningrad-Moskva '49) Kap. 4, 56-72: Schwereanomalien [russ.]. — Voprosy istorii otecestvennoj nauki [Fragen zur Geschichte der vaterländischen Wissenschaft] (Moskva-Leningrad '49) 142-64: Lobacevskij als Astronom [russ.]. — Trudy 2-j vsesojuznoj sirotnoj konferencii [Publikationen der 2. sowjetischen Breitenkonferenz], Moskva 1949 (Kiev '50) 93: Bestimmung der Nutationskonstanten aus den Beobachtungen von A. S. Vasil'ev am Passageninstrument von Pulkovo im ersten Vertikal [russ.]. — A. N. K r y l o v , Sobranie trudov 1, 1 (Moskva-Leningrad '51) 7-39: Leben und Werk A. N. Krylovs [russ.] 6 4 ) ). — N. I. L o b a c e v s k i j , Polnoe sobranie socinenij [Vollständige Sammlung der Werke] 5 (Moskva-Leningrad '51) 351-56: Die grundlegenden Arbeiten zur Kinematik und Dynamik des festen Körpers, die dem Werk Lobacevskijs vorausgegangen sind [russ.]; 369-78: Kommentare zu N. I. Lobacevskijs Aufsatz „Bedingungsgleichungen für die Bewegung und Position der Hauptachsen im festen System" [russ.]. — Bol'saja sovetskaja enciklopedija [Große Sowjetenzyklopädie] 10 2 (Moskva '52) 362-65: Das heliozentrische System der Welt [russ.]; 13 2 ('52) 248-50:

Idel'son — Idrac Chr. Huygens [russ.]; 306: D'Alembert [russ.]; 306f.: Das D'Alembertsche Prinzip [russ.]; 19 2 (*53) 401-06: Der Kalender [auch in 1. Aufl. 30 ('37) 691-93] [russ.]; 80 2 ('54) 242f.: Newtons Gravitationsgesetz [russ.]. W . Kinematika (Leningrad '32) 198 S. — Sposob naimen'sich kvadratov 2 (Leningrad '32) 200 S.; 3. Aufl. u. d. T.: Sposob naimen'sich kvadratov i teorija matematiceskoj obrabotki nabljudenij [Die Methode der kleinsten Quadrate und die Theorie der mathematischen Verarbeitung von Beobachtungen] (Moskva '47) 359 S. Teorija potencíala i ee prilozenija k voprosam geofiziki [Die Potentialtheorie und ihre Anwendung auf Fragen der Geophysik] (Leningrad-Moskva '32) 348 S.; 2. Aufl. u. d. T.: Teorija potencíala s prilozenijami k teorii figury zemli i geofizike [Die Potentialtheorie mit Anwendungen auf die Theorie der Figur der Erde und auf die Geophysik] 2 ('36) 424 S. — Nikolaj Kopernik [Nikolaus Kopernikus] (Moskva-Leningrad '43) 32 S. AstronomiSeskij Eíegodnik SSSR Reduktionsgrößen in der Astronomie: 1941 ('40) 3.79-432 [russ.]. — Die Fundamentalkonstanten der Astronomie und Geodäsie: 1942 ('41) 409-76 [russ.]. — Probleme zur Zeitumrechnung 6 ): 1944 ('44) 424-32 [russ.]. Astronomiieskij Kalendar' Grigorij Nikolaevic Neujmin f : 1947, 138-47 [russ.]. Astronomiieskij 2 . F. F. Rene [F. R. Renz] 1859-1942: 19 ('42) Nr. 4, 3f. [russ.]. - V. R. Berg f : 5f. [russ.]. — On the computation of weights of the unknowns in the method of least squares: 20 ('43) Nr. 3, 11-13 [russ. m. engl. Zusammenfassg.]. Circulaire, Union astron. int. Comet Paraskevopoulos (1941c): Elements: Nr. 868 ('41). Cirkuljary glavn. astron. Observat. v Pulkove Encke's comet in 1934. Elements and ephemeris: 10 ('34) Appendix, S. 3. Gerlands Beitr. Geophysik Die Integralgleichung der physikalischen Geodäsie: 40 ('33) 24-28 [m. engl. u. franz. Zusammenfassg.]. — Erwiderung auf die vorstehenden Kritiken [R. Schumann: Über ein angebliches Versehen in H. Bruns' Schrift „Die Figur der E r d e " ; H. Hornick: Über eine Kritik an H. Bruns' Schrift „Die Figur der Erde"]: 47 ('36) 413-15. Ibérica El cometa de Encke: 21 ('34) 38. Istoriko-astron. Issled. Urbain Le Verrier [Vortragskonzept von 1946]: 4 ('58) 433-52 [russ.]. Istoriko-mat. Issled. Lobacevskij als Astronom: 2 ('49) 137-67 [russ.]. Izvest. Akad. Nauk SSSR, Ser. fizií. Periodische Lösung des Dreikörperproblems in Newtons „Principia": 7 ('43) Nr. 5, 177-82 [russ.].

2133

Izvest. glavn. astron. Observat. v Pulkove La comète d'Encke en 1924-1934: 15 ('35) Nr. 1, 1-18 [m. russ. Zusammenfassg.]. — Bestimmung der Nutationskonstanten aus zwei Beobachtungsreihen am Passageninstrument im ersten Vertikal in Pulkovo 2 ): 19 ('52) Nr. 1, 122-37 [russ.]. J . Observateurs La comète d'Encke en 1924-1934: 18 ('35) 133-40. Mirovedenie Zu A. Kloze: Grundlagen der Zeitmessung: 24 ('35) 2 [russ.]. Nauënoe Näsle dstvo, Estestyenno-naußn. Ser. Einführung [Zum Briefwechsel von P. S. Laplace, C. F. Gauss, F. W. Bessel und anderer mit dem Akademiemitglied F. I. Schubert]: 1 ('48) 771-77; Anmerkungen: 823-31 [russ.]. Nauka i 2izn' Galilei und Newton: 1948, Nr. 3, 17-23; Nr. 4/5, 5-11. - Aleksej Nikolaevic Krylov : Nr. 9/10, 35-40. Alle Arbeiten russ. Priroda [SSSR] Der Komet Encke: 25 ('36) Nr. 6, 5-13. — Galilei in der Geschichte der Astronomie [Zum 300. Todestag]: 1942, Nr. 5/6, 95-108; Nr. 7, 105-17. Alle Arbeiten russ. Trudy glavn. astron. Observat. v Pulkove Eigenbewegungen von 185 Sternen in Deklination 3 ): (2) 46 ('34) 59-66. Trudy Inst. Istorii Estestvoznanija i Techn. Die Arbeiten A. N. Krylovs zur Astronomie: 15 ('56) 24-31 [russ.]. - S. I. Vavilov zum Gedächtnis: 17 ('57) 127-36 [russ.]. Vesta. Akad. Nauk SSSR Ansprache bei der Festsitzung der Akademie der Wissenschaften der UdSSR anläßlich des 400. Todestages von Nikolaus Kopernikus : 1943, Nr. 7/8, S. 11- [russ.]. — Alexis Claude Clairaut und die Petersburger Akademie der Wissenschaften: 1947, Nr. 8, 118-20 [russ.]. Vesta. Znanija Von Ptolemäus bis Kopernikus: 1936, Nr. 12 [russ.]. - Nikolaus Kopernikus: 1941, Nr. 3, 54-60 [russ.]. Vopr. Istorii Estestvoznanija i Techn. Galilei in der Geschichte der Astronomie: Nr. 16 ('64) 52-84 [russ.]. Mit: ') A. A. N e m i r o ; ") Ch. I. P o t t e r ; ') B. R a c k ; •) Ju. A. S i m a n s k i j ; ») V. I. S m i r n o v ; «) D. V. Zagrebin. VI

IDRAC, Pierre. Meteorol. - 192232 Météorologiste, Office Nation. Météorol., Paris. *1885, Febr. 14, Paris; fl935, Juni 17, Paris. Nekr. Gedenkheft: Météorologie 1 ('36) Nr. 3, 221-303 (m. Autobiogr. S. 223-26, Schr.verz. S. 317-21). W . Etudes expérimentales sur le vol à voile au lieu même d'évolution des grands oiseaux

2134

Idrac — Iimori

voiliers (vautours, albatros, etc.). Son application au vol a voile humain (Paris '31) 76 S.; deutsch: Experimentelle Untersuchungen über den Segelflug mitten im Fluggebiet großer segelnder Vögel (Geier, Albatros usw.). Anwendung auf den Segelflug des Menschen (München-Berlin '31) 81 S. Nature [Paris] Les puits soufflants 1 ): 61 ('33) 545-50. Alle weiteren Arbeiten bis 1935 bereits in Poggendorff Band VI. Mit: ») Caulle.

VI

tZur Biobibliogr. Matematika v SSSR 19171957: 2 ('59) 278. W. Elementarnye osnovy teorii opticeskich priborov [Elementare Grundlagen der Theorie der optischen Instrumente] (LeningradMoskva '33) 184 S. — Vlijanie formy i polozenija istocnika sveta pri izmerenijach interferenc-komparatorom Kestersa [Der Einfluß von Form und Lage der Lichtquelle bei Messungen mit dem Interferenz-Komparator nach Kösters] (Leningrad-Moskva '35) 83 S. [russ. m. deutscher Zusammenfassg.]. C. R. (Dokl.) Acad. Sei. URSS Zur LaplaceTransformation: 1935 II, 5-11 [russ. m. deutscher Zusammenfassg.]; ~ 2:1936 II, 169-74; ~ 3: 1936 IV, 107-10; ~ 4: 14 ('37) 167-71; ~ 5: 475-78; ~ 6 : 1 5 ('37) 67-70; ~ 7: 16365; ~ 8: 231-34; ~ 9 : 1 7 ('37) 169-72; ~ 10: 18 ('38) 511-14. - Zur Theorie der Gitter [, 1]: 20 ('38) 105-08; ~ 2: 22 ('39) 16-20; ~ 3: 21-24. — Zur Beugung an einem Spalt, resp. Streifen, 1: 25 ('39) 375-78; ~ 2: 665-67. — Zur Beugung an einer kreisrunden Öffnung und ebensolcher Scheibe: 31 ('41) 868-71. Izvest. Akad. Nauk SSSR Fortpflanzung von Störungen in inhomogenen isotropen Medien: 1932, 857-905. - Wellenfortpflanzung und Beugung in inhomogenen isotropen Medien: 1203-18. — Über ein Integral mit Besseischen Funktionen: 1933, 345-62. - Beugung am Fernrohrobjektiv und sein Auflösungsvermögen: 729-62. — — Alle Arbeiten m. russ. Zusammenfassg. Trudy fiziko-mat. Inst. im. Steklova Kreisscheibenkondensator : 2 ('32) Nr. 3, 104 S. — Untersuchung einiger Integrale mit Besseischen Funktionen und ihre Anwendung auf Beugungserscheinungen und andere, 1: Untersuchungen der Integrale: 3 ('33) Nr. 1, 118 S.

Bull. Inst, physic, and ehem. Res. [Die Band- u. Seitenzahlen in < . . beziehen sich auf die engl. Zusammenfassungen in: Abstracts from Bull. Inst, physic, and chem. Res.]. The occurrence of feebly radioactive lateritic soil in Japan') 1 ): 11 ('32) 901-09 INGERSOLL, Leonard Rose. Physik. — 1905-08 Instructor, '08-10 Assist. Prof., '10-24 Assoc. Prof., '24-50 Prof., '36-47 Chairman of the Departm., '50 Prof. Emeritus, Univ. of Wisconsin, Madison, Wis. - '51 Hon. Sc. D. (ColoTechnical Publ., Amer. Inst. Mining and rado College, Colorado Springs, Colo.). metallurg. Engr. Recent geothermal measurements in the Michigan copper district 14 ) 18 ): *1880, Juni 1, New York; Nr. 481 ('32). fl958, Apr. 25, Madison, Wis. Nekr. American J. Physics 26 ('58) 357. J . opt. Soc. America 48 ('58) 674. W. A laboratory manual of experiments in physics (m. M. J . Martin) 3 (New York-London '32) 9 + 301 S., 4 ('36), E ('42); (m. M . J . Martin, T. A. Rose) 6 ('53) 11 + 286 S. Heat conduction. With engineering and geological applications (m. 0 . J . Zobel, A. C. Ingersoll) (New York '48) 12 + 278 S.; Neuauflage u. d. T.: Heat conduction. With engineering, geological and other applications (Madison, Wis. '54, London '55) 13 + 325 S. American Physics Teacher Report of the Committee on Differentiation in First-Year Courses: 1 ('33) 51f.; 2 ('34) 33f. - University of Wisconsin Physical Museum: 4 ('36) 112-14. American J. Physics My most successful experiment in teaching physics: 23 ('55) 609. — Second law of thermodynamics apparatus 2 ): 24 ('56) 172f. J. Geology Postglacial time calculations from recent geothermal measurements in the Calumet copper mines 15 ): 42 ('34) 113-22. J. opt. Soc. America C. E. Mendenhall: 26 ('36) 75. — The polarizing characteristics of

Trans., Amer. Soc. Heating and Ventilating Engr. Theory of the ground pipe heat source for the heat pump 1 7 ): 54 ('48) 339-, - Theory of earth heat exchangers for the heat pump I3)i7)i6). 5 7 167-88.

Mit: ') S. Breen; *)M. B . C o l e ; 3 ) J. N. H u m p h r e y ; •) \V. L. J a m e s ; ' ) E. H. K r a u s e ; •) D. H. L i e b e n berg; ') P. R u d n i c k ; ') F. G. S l a c k ; •) N. U n d e r ivood; ">) J. G. W i n a n s ; ") W. R. W i n c h ; ") A. A. Z u e h l k e ; ») F. T. Adler; ") J. F i s h e r ; ») W. O. H o t c h k i s s ; »•) A. C. I n g e r s o l l ; ") II. J. P l a s s ; 1! ) H. V i v i a n . VI

INGHAM, Albert Edward. Math. (Analysis, Zahlentheorie). — 1926-30 Reader, Univ. of Leeds; '30-67 Fellow, Lecturer and Dir. of Math. Studies of King's College, '30-53 Univ. Lecturer, '53-67 Univ. Reader, Cambridge. *1900, Apr. 3, Northampton; fl967, Sept. 6, near Chamonix. Nekr. I. C. B u r k i l l , Biographical Mem. Fellows roy. Soc. 14 ('68) 271-86 (m. Bildn., Faks., Schr.verz. 32 Nrn.). — H. D a v e n p o r t , Nature [London] 216 ('67) 311.

Ingham — Ingold, Christopher S. Studies in mathematical analysis and related topics. Essays in honor of George Pölya (Stanford, Calif. '62) 156-64: On absolutely convergent Dirichlet series. — Abhandlungen aus Zahlentheorie und Analysis. Zur Erinnerung an Edmund Landau (BerlinNew York '68) 119-35: On the high-indices theorem for Borel summability. W. The distribution of prime numbers (Cambridge '32, London '33) 8 + 114 S. (Cambridge tracts in mathematics and mathematical physics, 30)¡Neudruck: (NewYork '64). Acta arithmet. [Warszawa] A note on the distribution of primes: 1 ('35/36) 201-11. Arithmetical Tauberian theorems 1 ): 9 ('64) 341-56. American J. Math. On two conjectures in the theory of numbers: 64 ('42) 313-19. Annals Math. A Tauberian theorem for partitions: (2) 42 ('41) 1075-90. J. London math. Soc. A note on Fourier transforms: 9 ('34) 29-32. - A note on Hilbert's inequality: 11 ('36) 237-40. - Some Tauberian theorems connected with the prime number theorem: 20 ('45) 171-80. - Improper integrals as limits of sums : 24 ('49) 4450. — Some aspects of Hardy's mathematical work, 4: The additive theory of numbers: 25 ('50) 115-19. Mathematische Z. Some trigonometrical inequalities with applications to the theory of series: 41 ('36) 367-79. Proc. Cambridge philos. Soc. An integral which occurs in statistics: 29 ('33) 271-76. On two classical lattice point problems: 36 ('40) 131-38. — A further note on trigonometrical inequalities: 46 ('50) 535-37. Proc. London math. Soc. On Wiener's method in Tauberian theorems: (2) 38 ('34/35) 458-80. — On Tauberian theorems: (3) 14A ('65) 157-73. Quarterly J. Math., Oxford Ser. Mean-value theorems and the Riemann zeta-function: 4 ('33)278-90. - On the "high-indices theorem" of Hardy and Littlewood: 8 ('37) 1-7. - On the difference between consecutive primes: 255-66. — On the estimation of N( Ioffe (Bülgarska akademija na naukite, Inst. Leningrad; '13-15 außerord. Prof., '15- Fiziki) [Populärwissenschaftliche Sitzung des 48 ord. Prof., '19 Begründer u. '19-48 (m. Physikalischen Instituts der Bulgarischen Unterbrechungen) Dekan d. Physikal.- Akademie der Wissenschaften zu Ehren A. F. Ioffes] (Sofija '54); darin S. 13-23: Biogr. von Mechan. Fak., Polytechn. Inst., Peters- G. N a d i a k o v ; ferner Aufsätze über Ioffes burg ->• Leningrad; '18-51 Dir. d. Physi- wissenschaftliche Arbeiten.

kal.-Techn. Inst., '26-29, '42-45 Vizepräs., '45-52 Mitglied d. Präsidiums, '5260 Vorstand d. Kommiss. f. Halbleiter, '52 Begründer u. '52-60 Dir. d. Labor, (seit '55 Inst.) f. Halbleiter, Akad. d. Wiss. d. UdSSR; '23-30 Präs. d. Physiker-Gesellschaft d. UdSSR; '57 Vizepräs., Internat. Union of Pure and Appi. Physics (IUPAP) u. Vorstand d. Internat. Kommiss. f. Halbleiter ; Organisator mehrerer physikalisch-technischer Institute in der UdSSR. - '46 Dr. hon. (Sorbonne, Paris); '48 Dr. h. c. (Techn. Hochsch. Graz); '48 Dr. h. c. (Univ. Bucure?ti); '55 Dr. h. c. (Univ. München). — '40, '45, '55 Leninorden (UdSSR) ; '42 Staatspreis 1. Kl. (UdSSR); '53 Preis (Akad. Wiss. UdSSR); '55 Titel „Held d. Sozialistischen Arbeit" (UdSSR); '55 Goldmedaille „Sichel und Hammer" (UdSSR); '61 Leninpreis [posthum] (UdSSR).

Zum 60. Geb.tag J a . I. F r e n k e l ' , Vestn. Akad. Nauk SSSR 1940, Nr. 10, 72-77. - B. M. G o c h b e r g , M . S . S o m i n s k i j , Priroda [SSSR] 1941, Nr. 1, 96-99 (m. Bildn.). - I. K. K i k o i n , Usp. fizic. Nauk 24 ('40) Nr. 1, 3-10. — I. V. K u r c a t o v , P. P. K o b e k o , Èlektricestvo [Moskva] 1940, Nr. 10, 34-36. — Izvest. azerbajdzansk. Filiala Akad. Nauk SSSR 1941, Nr. 1, 92f. - J . Physics, Acad. Sei. USSR 1 ('40) 225-30. - 2. éksper. i teoret. Fiziki 10 ('40) 955-60. Zum 70. Geb.tag Festschrift: Sbornik, posvjaäcennyj semidesjatiletiju akademika A. F. Ioffe [Sammelband, A. F. Ioffe zum 70. Geburtstag gewidmet] (Moskva '50) 571 S. (m. Bildn. u. Schr.verz.); darin S. 5-30: Biogr. von V. M. D u k e l ' s k i j . — Èlektricestvo [Moskva] 1950, Nr. 12, S. 84 (m. Bildn.).

Zum 75. Geb.tag A. I. A n s e l ' m , V. P. 2 u z e , 2. techn. Fiziki 25 ('55) 2013-21 (m. Bildn.). — M. S o m i n s k i j , Radio [Moskva] 1956, Nr. 1, 10-12 (m. Bildn.). - Analele romîno-soviet., Ser. Mat.-Fizicä 10 ('56) Nr. 4, 102-06. - Vestn. Akad. Nauk SSSR 26 ('56) Nr. 1, 78f. (m. Bildn.). — 2. éksper. i teoret. *1880, Okt. 29 (17), Romny, Ukraine; Fiziki 30 ('56) Nr. 1, 3-6 (m. Bildn.). - 2. techn. Fiziki 25 ('55) 2011 (m. Bildn.).

fl960, Okt. 14, Leningrad.

Zur Biogr. V. G. C h l o p i n , A. A. B a l a n d i n , S. A. P o g o d i n in: Ocerki po istorii Akademii nauk 1725-1945. Chimiceskie nauki [Beiträge zur Geschichte der Akademie der Wissenschaften 1725-1945. Chemische Wissenschaften] (S. I. Vol'fkovic) (Moskva-Leningrad '45) 97. — S. I. V a v i l o v in: Fizikomatematiceskie nauki Physikalisch-mathematische Wissenschaften] (A. F. Ioffe) (Moskva-Leningrad '45) 22f. - J a . G. D o r f m a n , Priroda [SSSR] 54 ('65) Nr. 5, 122-. R. G. G e v o r k j an, Fizika v gkole 1961, Nr. 3, 8-10 (m. Bildn.). — S. H e y m , Das kosmische Zeitalter (Berlin '59) 43-51 (m. Bildn.); Ogonek 1959, Nr. 4, S. 19 (m. Bildn.). - A. N. K r y l o v , Moi vospominanija [Meine Erinnerungen] (Moskva '45) 492-97; Vospominanija i ocerki [Erinnerungen und Studien] (Moskva '56) 442-49. — D. M a m l e e v , Nauka i 2izn' 1959, Nr. 2, 29-33 (m. Bildn.). T. D. P a v l o v , Priroda [Sofija] 1 ('52) Nr. 5, 88-92. - M. S. S o m i n s k i j , Abram Fedorovic Ioffe (Moskva-Leningrad '65) 644

Zum 80. Geb.tag I. K. K i k o i n , M. S. Som i n s k i j , Usp. fizic. Nauk 72 ('60) 307-21 (m. Schr.verz.-Auszug 52 Nrn.). — M. S. Som i n s k i j , Fizika v Skole 20 ('60) Nr. 4, 25-28 (m. Bildn.). — L. N. S t e p a n o v, Uber Ioffes Arbeiten auf dem Gebiet der Agrophysik : Zemledelie 1960, Nr. 10, 76-78 [russ.] (m. Bildn.). — Fizika Metallov i Metallovedenie 10 ('60) Nr. 3, Beilage (m. Bildn.). — Optika i Spektroskopija 9 ('60) Nr. 4, 551 f. (m. Bildn.). Nekr. J . B a l t á E l i a s , Revista tecn. Inst, nación. Electrónica 4 ('61) 263-65. - B. N. F i n k e l ' S t e j n , Vestn. vysäej Skoly 1960, Nr. 10, 47-52. - A. T. G r i g o r ' j a n , Vopr. Istorii Estestvoznanij a i Techn. Nr. 10 ('60) 49-54 (m. Bildn.). - P l a n k , Kältetechnik 13 ('61) 140. - A. R. R e g e l ' , L. S. S t i l ' b a n s , Fizika tverdogo Tela 2 ('60) 2671-76. - 1 . B. R e v u t , Vestn. sel'skochozjajstvennoj Nauki [Moskva] 1960, Nr. 10, 134r-36 (m. Bildn.). - R. R o m pe, Jahrb. dtsch. Akad. Wiss. Berlin 1963 ('64) 201. - N. N. S e m e n o v , J a . G. D o r f m a n , Priroda [SSSR] 1960, Nr. 12, 32-39 (m.

Ioffe Bildn.). - N. N. S e m e n o v , V. N. K o n d r a t ' e v , Nature [London] 190 ('61) 761f. - K . T h i e ß e n , Technik [Berlin] 16 ('61) 122 (m. Bildn.). — D. A. W r i g h t , Proc. physic. Soc. 77 ('61) 1226 f . - Atomnaja Énergija 9 ('60) Nr. 5, 359f. (m. Bildn.). — Dokl. Akad. Nauk SSSR135 ('60) 1023-26 (m. Bildn.). - Kristallografija 5 ('60) Nr. 5, 671-73 (m. Bildn.). Radiochimija 5 ('63) 144f. — Usp. fizic. Nauk 72 ('60) 2 S. vor S. 161 [Nachdruck aus: Pravda vom 15. 10. 60] (m. Bildn.). — Vestn. Akad. Nauk SSSR 30 ('60) Nr. 11, 76f. (m. Bildn.). - 2. éksper. i teoret. Fiziki 39 ('60) vor S. 1177 (m. Bildn.). - 2. techn. Fiziki 30 ('60) 1261-64 (m. Bildn.). Autobiogr. Mo ja zizn' i rabota [Mein Leben und meine Arbeit] (Moskva-Leningrad '33) 56 S. (m. Bildn. u. Faks.). Zur Biobibliogr. A. I. A n s e l ' m , V. P. 2uz.e, Abram Fedorovic Ioffe [russ.] (Moskva '60) 136 S. (m. Bildn., Faks., Schr.verz.) (Materialy k biobibliografii ucenych SSSR, Ser. fiz., Nr. 12). H. (Redakt.) V. K. R e n t g e n , 0 novom rode lucej [W. K. R ö n t g e n , Über eine neue Art von Strahlen] [Übersetzg. aus dem Deutschen] (Moskva-Leningrad '33); darin eig. Beitr. : 5-24: Biographie Röntgens [russ.]. — (Redakt.) A. F. Y a l ' t e r , Y. N. K o n d r a t ' e v , J û . B. C h a r i t o n , Zadacnik po fizike [Aufgabenbuch für die Physik] 5 (LeningradMoskva '33), 8 ('34),'('35), 8 ('36),»('37), 10 ('38), "('38); ukrain.: 4 (Char'kov-Kiev '32), 5 (Char'kov '35), ®('39); grusin.: (Tbilisi '37); usbek.: (Taskent '39). — (Redakt.) Osnovnye problemy fiziki pocv [Grundlegende Probleme der Physik der Böden], 1. 2 (Moskvar-Leningrad '35). — (Redakt.) Exposés sur la physique des solides (Actualités scientifiques et industrielles) 1 (Paris '35) [siehe unten bei W.] - 2 ('36). — (Redakt.) K. M o r o z o v a , Nikolaj Aleksandrovic Morozov. K 90-letiju so dnja rozdenija [Zum 90. Geburtstag] (Moskva '44). - (Redakt.) Ocerki po istorii Akademii nauk 17251945. Fiziko-matematiceskie nauki [Studien zur Geschichte der Akademie der Wissenschaften 1725-1945. Physikalisch-mathematische Wissenschaften] (Moskva-Leningrad '45). — (Redakt.) Akademija nauk SSSR, Otdeleniefiziko-matematiceskich nauk. Referaty naucnoissledovatel'skich rabot za 1943-44 gody [Akademie der Wissenschaften der UdSSR, Abteilung der physikalisch-mathematischen Wissenschaften. Referate der Forschungsarbeiten 1943-44] (Moskva-Leningrad '45); ~ za 1945 ('46). — (Redakt.) Naucnyj otcet vsesojuznogo fiziko-agronomiceskogo instituta za 1942-1943 gg. [Wissenschaftlicher Rechenschaftsbericht des Phvsikalisch-Agronomischen Instituts der UdSSR über die Jahre 1942-1943] (Moskva'46) (Vsesojuznaja akademija sel'skochozjajstvennych nauk im. Lenina). — (Redakt.) Sbornik trudov po techni137 Poggendorff

2157

ceskoj fizike [Sammlung von Arbeiten über technische Physik] (Moskva-Leningrad '48). — (Redakt.) A. F. C u d n o v s k i j , Zamorozki [Bodenfröste] (Leningrad '49), darin S. l f . : Vorwort [russ.]. — (Redakt.) Poluprovodniki v nauke i technike [Halbleiter in Wissenschaft und Technik] 1 (Moskva '57), darin S. 3: Vorwort [russ.]; 2 (Moskva-Leningrad '58), darin S. 3 : Vorwort [russ.]. — (Redakt.) Fizika tverdogo tela. Sbornik statej [Physik des festen Körpers. Sammlung von Aufsätzen] 1.2 (Moskva-Leningrad '59). MH. (Mitredakt.) Trudy Vsesojuznoj konferencii po izuceniju stratosfery [Arbeiten der Unionskonferenz über die Erforschung der Stratosphäre], 1934 (Moskva-Leningrad '35). — (Mitredakt.) Voprosy agronomiceskoj fiziki [Fragen der Agrophysik] (Leningrad '57); darin eig. Beitr.: 5-10: Aufgaben der Agrophysik [russ.]. — (Mitredakt.) Maks Plank. Sbornik k stoletiju so dnja rozdenija [Max Planck. Sammelband zum 100. Geburtstag] 1858-1958 (Moskva '58); darin eig. Beitr.: 89-93: Max Planck (Erinnerungen) [russ-]- _ (Mitredakt.) Osnovy agrofiziki (Moskva '59), darin S. 9-16: Vorwort [russ.]; engl.: Fundamentals of agrophysics (Jerusalem '66). HZ. (Redakt.) Zumal prikladnoj fiziki 1924-1930. — (Redakt.) 2urnal Russkogo fiziko-chimiceskogo obscestva, Cast' fizièeskaja 1924-1930. — (Redakt.) 2. éksper. i teoret. Fiziki 1931-1938. - (Redakt.) 2. techn. Fiziki 1931-1959. - (Redakt.) Izvest. Akad. Nauk SSSR, Ser. fizic. 1947-1948. - (Redakt.) Fizika tverdogo Tela 1959. S. Techniceskaja ènciklopedija [Technische Enzyklopädie] 17 (Moskva '32) 785-92: [Elektrischer] Durchschlag [russ.]; 26 ('S4) 752-58: Energie [russ.]. — Voprosy izoljacii v élektrotechnike. Trudy I I Vsesojuznoj konferencii po élektroizolirujuâcim materialam [Fragen der Isolierung in der Elektrotechnik. Arbeiten der 2. Unionskonferenz über elektrisch isolierende Materialien] (Moskva-Leningrad '32) 17-21: Über die Planung wissenschaftlicher Forschungsarbeiten auf dem Gebiet elektrisch isolierender Materialien [russ.]. — Voprosy élektroperedaci bol'Sich moscnostej na bol'sie rasstojanija. Trudy I Vsesojuznoj konferencii po razmeäceniju proizvoditel'nych sil SSSR vo Vtorom pjatiletii [Fragen der elektrischen Energieübertragung bei hohen Leistungen über große Entfernungen. Arbeiten der 1. Unionskonferenz über die Verteilung der Produktivkräfte der UdSSR im 2. Fünfjahrplan] (Moskvar-Leningrad '32) 117, 348-52, 366 f., 390-97: Über Hochspannungsisolation [russ.]. — Akademija nauk na zavodach i fabrikach Leningrada [Die Verbindung der Akademie der Wissenschaften mit den Werken und Fabriken von Leningrad] (Leningrad '32) 201-10: Die nicht ausgenutzten Wärmequellen [russ.]. — C. R. Congrès inter-

2158

Ioffe

national d'électricité, Paria 1932, 2: C. R. des travaux de la première section (Paris '32) 457-59: Le champ moléculaire dans les diélectriques. — Trudy Nojabr'skoj jubilejnoj sessii, posvjascennoj pjatnadcatiletnej godovscie Oktjabr'skoj revoljucii [Arbeiten der November-Jubiläums-Sitzung (der Akademie der Wissenschaften der UdSSR) anläßlich des 15. Jahrestages der Oktoberrevolution] Leningrad 1932 (Leningrad '33) 142-49: Arbeiten zum Studium der elektrischen Eigenschaften fester Körper [russ.]. — General'nyj plan élektrifikacii SSSR. Materialy vsesojuznoj konferencii (po élektrifikacii) [Generalplan zur Elektrifizierung der UdSSR. Materialien der Unionskonferenz (über die Elektrifizierung)] 10/11 (Moskva-Leningrad '33) 6 10: Die Anwendung von Fotoelementen in der Industrie [russ.]. — Zapiska ob ucenych trudachdejstvitel'nychclenov Akademii nauk SSSR po Otdeleniju matematiceskich i estestvennych nauk, izbrannych v 1931-32 godach [Berichte über die wissenschaftlichen Arbeiten der in den Jahren 1931/32 gewählten ordentlichen Mitglieder der Akademie der Wissenschaften der UdSSR, Abteilung Mathematik und Naturwissenschaften] (Leningrad '33) 94-101 : Bericht über die wissenschaftlichen Arbeiten N. N. Semenovs [russ.]; 125-27: Bericht über die wissenschaftlichen Arbeiten A. A. Öernysevs [russ.]. — Naucnotechniceskoe obsluzivanie tjazeloj promyslennosti [Die wissenschaftlich-technische Betreuung der Schwerindustrie] (Moskva-Leningrad '34) 41—47 : Das Leningrader Physikalisch-Technische Institut [russ.]. — Bol'saja sövetskaja ênciklopedija [Große Sowjetenzyklopädie] 22 (Moskva '35) 686-92: Dielektrika [russ.] ; 692-94: Dielektrizitätskonstante [russ.]; 46 ('40) 202-07: Halbleiter [russ.]; 33 2 ('55) 643-48: Halbleiter [russ.]; 45 2 ('57) 7 16: Physik [russ.]. — Naucno-issledovatel'skie instituty tjazeloj promyslennosti [Die wissenschaftlichen Forschungsinstitute der Schwerindustrie] (A. A. Armand) (Moskva-Leningrad '35) 1-13: Das Leningrader PhysikalischTechnische Institut [russ.]. — Trudy Vsesojuznoj konferencii po izuceniju stratosfery [Arbeiten der Unionskonferenz zur Erforschung der Stratosphäre] (Moskva-Leningrad '35) 385-88: Kosmische Strahlung [russ.]. — International conference on physics, London 1934, Papers and discussions, 2: The solid state of matter (London '35) 72-76: On the cause of the low value of mechanical strength; 77-80: On the mechanism of brittle rupture; 126, 131-33: Discussion on the derivations of real crystals from the ideal lattice structure. — G. G j u n t e r , Ènergetika majbutn'ogo [Energetik der Zukunft] (Char'kov '36) 78-81 : Ungelöste Probleme der Technik [ukrain.]. — Matematika i estestvoznanie v SSSR. Ocerki razvitija matematiceskich i estestvennych nauk za dvadcat' let [Mathematik und Natur-

wissenschaften in der UdSSR. Studien zur Entwicklung der Mathematik und der Naturwissenschaften seit 20 Jahren] 1917-1937 (Moskva-Leningrad '38) 206-28: Unsere Arbeit auf dem Gebiet der Erforschung der mechanischen und elektrischen Eigenschaften fester Körper [russ.]. — Dvatcat' let inzenerno-fiziceskogo fakul'teta LH [20 Jahre ingenieurwissenschaftlich-physikalische Fakultät des Leningrader Industrie-Instituts] (Leningrad '39) 5 - 9 : Die ingenieurwissenschaftlichphysikalische Fakultät des L I I in Vergangenheit und Gegenwart [russ.]. — Jubilejnaja sessija Akademii nauk SSSR, posvjascennaja 25-letiju Velikoj Oktjabr'skoj socialisticeskoj revoljucii [Jubiläumssitzung der Akademie der Wissenschaften der UdSSR anläßlich des 25. Jahrestages der Großen Sozialistischen Oktoberrevolution] (Moskva-Leningrad '42) 175-88: Die Entwicklung der exakten Wissenschaften der UdSSR seit 25 Jahren [russ.]; engl.: A. F. I o f f e , Development of the exact sciences in the U.S.S.R. [zusammen mit: A. V. V i n t e r , Twenty-five years of power development in the U.S.S.R.] (American Russian Institute for Cultural Relations with the Soviet Union) (New York '43) 47 S. — Osnovnye problemy v oblasti fiziko-matematiceskich nauk [Grundlegende Probleme auf dem Gebiet der physikalisch-mathematischen Wissenschaften] (Moskva '45) 3-6: Wissenschaftliche und organisatorische Probleme, die vor der Abteilung der physikalisch-mathematischen Wissenschaften der Akademie der Wissenschaften der UdSSR stehen [russ.]; 7-21: Die wichtigsten Probleme auf dem Gebiet der Physik [russ.]. — Periodiceskij zakon D. I. Mendeleeva i ego filosofskoe znacenie. Sbornik statej [Das Periodische System Mendeleevs und seine philosophische Bedeutung. Sammlung von Aufsätzen] (Moskva '47) 79-98: Die physikalische Bedeutung des Periodischen Systems [russ.]. — 75 let periodiceskogo zakona D. I. Mendeleeva i Russkogo chimiceskogo obscestva [75 Jahre Periodisches System von D. I. Mendeleev und Russische Chemische Gesellschaft] (Moskva-Leningrad '47) 97-114: Die physikalische Bedeutung des Periodischen Systems [russ.]. — Jubilejnaja sessija Akademii nauk SSSR [Jubiläumssitzung der Akademie der Wissenschaften der UdSSR] 1945, 2 (Moskva-Leningrad '47) 7593: Halbleiter und ihre Anwendung [russ.]. — Jubilejnyj sbornik, posvjascennyj tridcatiletiju Velikoj Oktjabr'skoj socialisticeskoj revoljucii [Jubiläumsband zum 30. Jahrestag der Großen Sozialistischen Oktoberrevolution] 1 (Moskva-Leningrad '47) 305-32: Elektronische Leiter [russ.]. — Ocerki razvitija medicinskoj rentgenologii. 50 let rentgenovych lucej v medicine [Studien zur Entwicklung der medizinischen Röntgenologie. 50 Jahre Röntgenstrahlen in der Medizin] (S. A. Rejnberg) (Moskva '48) 29-35: Erinnerun-

Ioffe gen an Wilhelm Konrad Röntgen [russ.]. — Obscee sobranie Akademii nauk SSSR, Juni 1947 [Hauptversammlung der Akademie der Wissenschaften der UdSSR, J u n i 1947] (Moskva-Leningrad '48) 13-27: Halbleiter und Legierungen [russ.]. — Obscee sobranie Akademii nauk SSSR, posvjascennoe tridcatiletiju Velikoj Oktjabr'skoj socialistiöeskoj revoljucii. Doklady [Hauptversammlung der Akademie der Wissenschaften der UdSSR anläßlich des 30. Jahrestages der Großen Sozialistischen Oktoberrevolution. Vorträge] (Moskva-Leningrad '48) 379-92: Entwicklungslinien der sowjetischen Physik [russ.]. — Dosjagnennja radjans'kich fizikiv [Erfolge sowjetischer Physiker] (Kiev '50) 24-37: Die Entwicklung der Physik in der Sowjetunion [ukrain.] (m. Bildn.); 49-69: Die elektrischen Eigenschaften fester Körper [ukrain.]. — Pamjati Sergej a Ivanovica Vavilova [Sergej Ivanovic Yavilov zum Gedenken] (Moskva '52) 307-12: Leerstellen- und Elektronen-Mechanismen des elektrischen Stromes in Metallen [russ.]. — Voprosy teorii i issledovanija poluprovodnikov i processov poluprovodnikovoj metallurgii [Fragen der Theorie und der Untersuchung der Halbleiter und der Prozesse der Halbleitermetallurgie] (Moskva '55) 5-11: Einige Aufgaben auf dem Gebiet der Halbleiterphysik [russ.]. — Ejnstejn i sovremennaja fizika. Sbornik p a m j a t i A. ISjnstejna [Einstein und die moderne Physik. Gedenkband für A. Einstein] (Moskva '56) 20-26: Dem Gedenken Albert Einsteins [russ.]. — Trudy I Mezvuzovskoj konferencii po sovremennoj technike dielektrikov i poluprovodnikov [Arbeiten der 1. allgemeinen Hochschulkonferenz über die moderne Technik der Dielektrika und der Halbleiter] 1956 (Leningrad '57) 5 - 7 : Halbleiter in der neuen Technik [russ.]. — Vsesojuznoe sovescanie rabotnikov sel'skochozjajstvennoj nauki [Unionskonferenz der Landwirtschaftswissenschaftler] 1956 (Moskva '57) 65-69: Ansprache [russ.]. — Materialy Jubilejnoj sessii (Vsesojuznoj akademii sel'skochozjajstvennych nauk im. V. I. Lenina), posvjascennoj 40-j godovscine Velikoj Oktjabr'skoj socialisticeskoj revoljucii [Materialien der Jubiläumssitzung (der Leninakademie der Landwirtschaftswissenschaften der UdSSR) anläßlich des 40. Jahrestages der Großen Sozialistischen Oktoberrevolution] (Moskva '58) 207-11: Sowjetische Agrophysik [russ.]. — J a . I. Frenkel'. Sobranie izbrannych trudov, 2: Naucnye stat'i [Sammlung ausgewählter Arbeiten, 2: Wissenschaftliche Aufsätze] (Moskva-Leningrad '58) 17f.: Das wissenschaftliche Vermächtnis J a . I. Frenkel's [russ.]. — P a m j a t i Alekseja Nikolaevica Krylova [Aleksej Nikolaevic Krylov zum Gedenken] (Moskva-Leningrad '58) 189-92: Erinnerungen an A. N. Krylov [russ.]. — Nauka i molodez' [Wissenschaft und Jugend] (Moskva '58) 151 f.: Das große Glück, Erbauer des 137*

2159

Kommunismus zu sein [russ.]. — Voprosy zemledelija [Fragen des Ackerbaus] (Moskva '59) 451-77: Errungenschaften der Agrophysik im Dienste der Landwirtschaft [russ.]. — Knyga dlja cytannja z fizyky (M. I. Rozenberg), 8: Elektryka, optyka i budova atoma [Physik-Lesebuch, 3: Elektrizitätslehre, Optik, Atombau] (Kiev '59) 55-60: Ein verwirklichter Traum [ukrain.]. — Advances in semiconductor science. Proc. 3 rd International conference on semi-conductors, University of Rochester, N. Y., 1958 (New York-London '59) 6-14: Properties of various semi-conductors. W . Èlektronnye poluprovodniki [Elektronenhalbleiter] (Leningrad-Moskva '33) 92 S. (Problemy novejsej fiziki, 1). — Kurs fiziki [Lehrgang der Physik], 1 : Osnovnye ponjatija iz oblasti mechaniki; Svojstva teplovoj énergii; ÏSlektricestvo i magnetizm [Grundbegriffe aus dem Gebiet der Mechanik; Eigenschaften der Wärmeenergie; Elektrizität und Magnetismus] 2 (Leningrad-Moskva '33) 367 S., ukrain.: (Kiev '33) 328 S.; 1, 1: Mechanika; Teplota; Élektricestvo [Mechanik; Wärme; Elektrizität] 3 (Leningrad-Moskva '40) 520 S. ; 4, 1 : Molekuljarnaja fizika (Gazy i zidkosti) [Molekularphysik (Gase und Flüssigkeiten)] (m. N. Semenov) (Moskva-Leningrad '32) 276 S., 2 ('33) 278 S. - Conductibilité électrique des isolants solides et des semi-conducteurs (Paris '34) 3 5 + 6 S. (Actualités scientifiques et industrielles, 87. Réunion internationale de chimie-physique 1933, 7). — Atomnoe jadro segodnja [Die heutigen Anschauungen über den Atomkern] (MoskvaLeningrad '34) 37 S. — Semi-conducteurs électroniques (Paris '35) 93 S. (Actualités scientifiques et industrielles, 202. Exposés sur la physique des solides, 1). — Problemy sovremennoj fiziki v rabotach Fiziko-techniceskogo instituta [Probleme der modernen Physik in Arbeiten des Physikalisch-Technischen Instituts] (Moskva-Leningrad '36) 96 S. — Nekotorye problemy sovremennoj fiziki [Einige Probleme der modernen Physik] (Moskva '41) 24 S. - Èlektriceskij zarjad [Die elektrische Ladung] (Moskva-Leningrad '45) 39 S. (m. Bildn.) (Ucenye-skol'nikam);estn. : (Tart u '47) 45 S.; rumän.: (Bucuresti '49) 53 S. (m. Bildn.); tschech.: (Praha '51) 35 S. — Élektriceskie svojstva tverdych tel [Elektrische Eigenschaften fester Körper] (Leningrad '47) 32 S. (Vsesojuznoe obscestvo rasprostraneniju politiceskich i naucnych znanij, Leningradskoe otdelenie). — Fizika na sluzbe sel'skogo chozjajstva [Die Physik im Dienste der Landwirtschaft] (m. I. B. Revut) (Moskva '59) 40 S. (Vsesojuz. ~ znanij, Serija 5: SePskoe chozjajstvo, 25). — Osnovnye predstavlenija sovremennoj fiziki [Grundlegende Auffassungen der modernen Physik] (LeningradMoskva '49) 368 S. — Énergeticeskie osnoay

2160

Ioffe

termoelektriceskich batarej iz poluprovodnikov [Die energetischen Grundlagen thermoelektrischer Batterien aus Halbleitern] (Moskva-Leningrad '50) 51 S. — Poluprovodniki v sovremennoj fizike [Halbleiter in der modernen Physik] (Moskva-Leningrad '54) 356 S.; chines.: (Shanghai'55) 327 S.; poln.: (Warszawa '56) 321 S.; 2. Aufl. u. d. T.: Fizika poIüprovodnikov 2 (Moskva-Leningrad '57) 491 S.; deutsch: Physik der Halbleiter (Berlin '58) 10+400 S., ('60) 10+410 S.; tschech.: (Praha '59) 476 S.; engl.: (New York-London '60) 11+436 S. - Poluprovodniki [Halbleiter] (Moskva-Leningrad '55) 96 S.; chines.: (Peking '55) 92 S. — Fizika i sel'skoe chozjajstvo (Primenenie fiziki v agronomii) [Physik und Landwirtschaft (Anwendung der Physik in der Landwirtschaft)] (Moskva-Leningrad '55) 32 S. (Akad. nauk SSSR. Nauc.-popul. serija "V pomosc' sel'skomu chozjajstvu"); kasach.: (Alma Ata '56) 34 S. — Poluprovodnikovye termoelementy (Moskva-Leningrad '56) 104 S., ('60) 188 S.; poln.: (Warszawa '57) 127 S.; deutsch: Halbleiter-Thermoelemente (Berlin '57) 8 + 6 9 S.; engl.: Semi-conductor thermoelements, and Thermoelectric cooling [vgl. nächsten Titel] (London '57) 184 S.; japan. [zusammen mit den beiden nächsten Titeln]: (Tokyo '57) 266 S.; chines.: (Shanghai '58) 91 S. — Termoelektriceskoe ochlazdenie (m. L. S. Stil'bans, E. K. Iordaniävili, T. S. Stavickaja) (Moskva-Leningrad '56) 110 S.; engl.: (London '57) [vgl. vorigen Titel]; japan. [zusammen m. d. vorigen u. d. nächsten Titel]: (Tokyo '57) 266 S.; franz.: Le refroidissement thermoeleotrique (Paris '58) 112 S. — Poluprovodniki i ich primenenie [Halbleiter und ihre Verwendung] (Moskva-Leningrad *56) 71 S., 2 (Moskva '60) 77 S., 3 ('62) 77 S.; ukrain.: (Kiev '57) 64 S.; franz.: (Moskva '57) 84 S.; engl.: (Moskva '57) 76 S., 2 (MoskvaLondon '60) 77 S.; japan. [zusammen m. d. beiden vorigen Titeln]: (Tokyo '57) 266 S.; armen.: (Erevan '58) 88 S.; aserbaidsch.: (Baku '58) 80 S.; korean.: (Moskva '58) 96 S. Vozmoznosti i perspektivy poluprovodnikov [Möglichkeiten und Perspektiven auf dem Gebiet der Halbleiter] (Leningrad '57) 12 S. (Leningr. dorn nauc.-techn. propagandy, Poluprovodniki, 18). — Vstreci s fizikami. Moi vospominanija o zarubeznych fizikach (Moskva '60) 144 S., 2 ('62) 144 S.; deutsch: Begegnungen mit Physikern. Meine Erinnerungen an ausländische Physiker (Leipzig '67) 142 S. (m. Bildn.). Acta physica sinica Untersuchung von Dielektrika und Halbleitern in der UdSSR: 11 ('55) 293-98 [chines, m. engl. Zusammenfassg.]. Bjul. vses. Akad. sel'skoehozjajstvenn. Nauk im. Lenina Ergebnisse der Arbeiten des Physikalisch-Agronomischen Instituts seit 1934: 1985, Nr. 3, 10-13 [russ.].

Bjul. tecbniko-ékon. Informacii, Akad. Nauk SSSR Thermoelektrische Kühlanlagen 10 ) 26 4 ) ): 1956, Nr. 4, 17f. [russ.]. Bjul., VOKS Eine Entdeckung junger sowjetischer Wissenschaftler (Neue Ansicht über den spontanen radioaktiven Zerfall des Urans): 1941, März/April, 114f. [russ.]. Bull., VOKS Physics and the war: 1943, Nr. 1/2, 14-22 (m. Bildn.). Canadian J. Physics Heat transfer in semiconductors: 34 ('56) Nr. 12A, 1342-55. Chimizacija socialist. Zemledelija Physik in der Agronomie: 1932, Nr. 9/10, 25-27 [russ.]. Cholodil'naja Techn. Thermoelektrische Kühlanlagen 10 ) 26 ) 4 ): 1956, Nr. 1, 62f. [russ.]. — Thermoelektrische Kühlung in der Kältetechnik 10 ) 26 ) 4 ) : Nr. 3, 5-16 [russ.]. Chronika Estestvoznanija i Mat. v SSSR Die Entwicklung der physikalischen Wissenschaften: 1945, Nr. 9, 5f. [russ.]. C. R. hebd. Séances Acad. Sei., Paris Sur la distribution spectrale de l'effet photoélectrique dans l'oxyde cuivreux 9 ): 199 ('34) 569-71. Current Sei. Investigation of dielectrics and semi-conductors in the USSR: 26 ('57) Nr. 5, 135-38. Dokl. Akad. Nauk SSSR Elektronische Halbleiter in starken elektrischen Feldern 9 ): 16 ('37) 77-81. - Die Eigenschaften der Sperrschicht bei Trockengleichrichtern 9 ): 81— 83. — Zur Bestimmung der Wärmeleitfähigkeit von Halbleitern: 87 ('52) 369-72. - Einige Gesetzmäßigkeiten hinsichtlich der Wärmeleitfähigkeit von Halbleitern 9 ): 97 ('54) 821 f. — Einfluß von Zusätzen auf die Wärmeleitfähigkeit von Halbleitern 9 ) : 98 ('54) 757-59. — Über die Erhöhung der Wirksamkeit von Halbleiterthermoelementen 1 )») 14 ) 26 ): 106 ('56) 981. — — Alle Arbeiten russ. Êlektriéestvo [Moskva] Halbleiter in der modernen Physik und Technik: 1939, Nr. 6, 5-10. — Gegenwart und Zukunft der Halbleiter: 1940, Nr. 10, 31-34. - Petr Leonidovic Kapica zum 50. Geburtstag: 1944, Nr. 8/9, 18-20. — Halbleiter und ihre Anwendung: 1946, Nr. 1, 3-10. — Die Entwicklung der sowjetischen Physik: 1948, Nr. 1, 3-9. - PetrNikolaevic Rybkin 2 4 ) 2 9 ) u a ): Nr. 2, S. 89. - Albert Einstein 20 ) 27 )"" ): 1955, Nr. 6, 85f. Alle Arbeiten russ. Engineering J. Development of semi-conductors in the USSR: 41 ('58) Nr. 8, 88f. Fizika v Skole Die Entwicklung der sowjetischen Physik: 1948, Nr. 4, 5-11 [russ.]. Physik in der Mittelschule: 1958, Nr. 5, 20-23 [russ.]. Fizika tverdogo Tela Zwei Mechanismen der Bewegung freier Ladungen: 1 ('59) 15759. — Zwei Mechanismen der Wärmeleitfähigkeit: 160 f. — Die Bedeutung der

Ioffe effektiven Masse und der Beweglichkeit für die Thermoelemente : 1627-29. — Die Wärmeleitfähigkeit fester Lösungen vonHalbleitern 9 ) : 2 ('60) 781-92. — Über energetische Anwendungen von Thermoelementen 17 )- 6 ): 2834-57. — — Alle Arbeiten russ.

2161

in der Stalinschen Epoche: 14 ('50) 7-14. — Ungelöste Probleme in der Theorie der Halbleiter: 15 ('51) 477-86. - Unsere Aufgaben auf dem Gebiet der Halbleiter: 16 ('52) 10-17. — Eröffnungsansprache [zur Sitzung der physikalisch-mathematischen Abteilung der Akademie der Wissenschaften der UdSSR im April 1955 über Probleme der Halbleiter]: 20 ('56) 63f. — Wärmeleitfähigkeit von Halbleitern 9 ): 65-75. — Thermoelektrische Generatoren: 76-80. — — Alle Arbeiten russ.

Front Nauki i Techn. 15 Jahre sowjetische Physik : 1933, Nr. 10/11,116-20. - Über Mängel und einige Probleme in der Entwicklung der sowjetischen Physik 18 ) : 1934, Nr. 4, 32-36. — Die Entwicklung der atomistischen AnschauJ. Physics, Acad. Sei. USSR Electrostatic ungen im 20. Jahrhundert: Nr. 9,28-38. — Der stärkste Eindruck meines bisherigen Lebens: generator 8 ): 2 ('40) 243-52. - Semi-conducEin Gespräch mit dem Genossen S. M. Kirov: tors in strong electric fields 9 ): 283-304. — On electrostatic generators: 4 ('41) 167f. .— Nr. 12, S. 6. — — Alle Arbeiten russ. Semi-conductors and their technical applicaGazeta mat. fisicä, Ser. A Physik in der tion: 169. — Contact of semi-conductor with Mittelschule: 11 ('59) 147-51 [rumän. m. metal 9 ): 171. — Electrostatic high-voltage franz. u. russ. Zusammenfassg.]. — Die in generator with a grounded metal axis8) : 389Aussicht stehenden Erfolge der Physik: 12 91. — Electrical resistance of the contact ('60) 97f. [rumän.]. between a semi-conductor and a metal: 10 IKP Die heutigen Anschauungen über den ('46) 49-60. Atomkern: 1934, Nr. 6, 13-32 [russ.]. J. Physique et Radium Propriétés thermoIzvest. Akad. Nauk SSSR, Ser. chim. Irène électriques et thermiques des semiconducCurie et Frédéric Joliot: 1986, 601-04 [russ.], teurs: 18 ('57) 209-13. 604-08 [franz.], Junyj Kommunist Die neusten Erfolge auf Izvest. Akad. Nauk SSSR, Ser. fizië. Die dem Gebiet der Physik: 1932, Nr. 15, 41-47 Voraussetzungen meiner wissenschaftlichen [russ.]. Arbeit: 1936, 7-33, Diskussion: 59-144, Kolchoznoe Proizvodstvo Erfolge der AgroSchlußwort: 145-62. — Zu Ja. I. Frenkel', Die Wärmebewegung in festen und flüssigen physik in Kolchosen und Sovchosen: 1960, Körpern und die Theorie des Schmelzens: Nr. 3, 37f. [russ.]. Eul'tura i Zizn' Halbleiter in Gegenwart 400f. — Eröffnungsansprache [zur Sitzung der Gruppe Physik der Akademie der Wissen- und Zukunft: 1969, Nr. 4, 18-24 [russ.] (m. schaften der UdSSR zu Fragen des Physik- Bildn.). unterrichts an technischen Hochschulen] : Meidunarodnyj sel'skochozjajstvennyj 2 . 1937, 5-7. - Zu G. S. Landsberg: Gegen- Physik in der Landwirtschaft 23 ): 1969, Nr. 2, wärtiger Stand des Physikunterrichts an den 29-42 [russ.]. technischen Hochschulen: 51-55. — EröffNarodnoe Obrazovanie [Moskva] Physik nungsansprache [zur 2. Unionskonferenz über den Atomkern]: 193S, 8-11; Diskussions- in der Mittelschule: 1958, Nr. 3, 94^96 [russ.] beiträge: 69 f., 100-02, 125, 126, 128, 130, (m. Bildn.). Nature [London] The crystal photoeffect 9 ) : 132f., 154-56, 205-08, 229-32; Schlußwort: 132 ('33) 168 f. — Behaviour of electrons and 249-52. — Eröffnungsansprache [zur Sitzung 18 19 der Gruppe Physik der Akademie der Wissen- "holes" in cuprous oxide ) ): 239f. — schaften der UdSSR über Halbleiter und Foto- Message [to the Division for the Social and elemente, Kiev 1938]: 614-16. — Halbleiter International Relations of Science of the 151 ('43) 385f. - L.I. in starken Feldern und ihre Gleichrichter- British Association]: 11 28 ('45) 105f. - A . A . wirkungen: 617-24. — The models of electro- Mandelstam t ) ): 156 28 8 static generators ) : 4 ('40) 367-71 [m. engl. Glagoleva-Arkad'eva t ) : 169 ('47) 296f. Zusammenfassg.]. — Rechenschaftsbericht Electron transport in metals and solids: 178 vom 23. Sept. 1943 über die Arbeit der physi- ('56) 1217-. kalisch-mathematischen Abteilung der AkaNauka i Techn. [Moskva-Leningrad] Halbdemie der Wissenschaften der UdSSR : 8 ('44) leiter in Physik und Technik: 1939, Nr. 6, 3-15. — Grundlegende Arbeiten der Institute 3-5 [russ.]. der physikalisch-mathematischen Abteilung Nauka i 2izn' Der Atomkern: 1934, Nr. 1, der Akademie der Wissenschaften der UdSSR Bildn.). — Die Physik in der Agroim Jahre 1944: 9 ('45) 259-65. - Halbleiter 3-12 (m. 13 und ihre Anwendung: 10 ('46) 3-14. — Die nomie ) : 1935, Nr. 1, 38-40. - Atomkern und historische Bedeutung der Entdeckung Rönt- kosmische Strahlung: 1938, Nr. 11/12, 23-25. gens: 343—49. — 30 Jahre sowjetische Physik: — Das Physikalisch-Technische Institut der 8 11 ('47) 581-90. - Die Entwicklung der Akademie der Wissenschaften der UdSSR ): physikalisch-mathematischen Wissenschaften 1940, Nr. 10, 59-63. - Halbleiter: 1953, Nr. 11, 25-29. — Der Atomkern - wohltätiger

2162

Joffe

F r e u n d , aber nicht bösartiger Feind der Menschheit: 1956, Nr. 4, S. 15 (m. Faks.). Physik in der Agrarwissenschaft: 1961, Nr. 1, 3 - 6 (m. Bildn.). — — Alle Arbeiten russ. Neva Ein Wunschtraum der Wissenschaft [Über Halbleiter-Thermoelemente]: 1955, Nr. 7, 136-38 [russ.] (m. Bildn.). News [Moskval Mid-century t h o u g h t s : 1956, Nr. 1, 15 f. Novoe Vremja Über einige I r r t ü m e r Prof. Albert Einsteins. Ein offener Brief sowjetischer Wissenschaftler 28 ) 25 ) 7 ): 1947, Nr. 48, 14[russ.]. Novyj Mir Physik u n d technischer Fortschritt in der Landwirtschaft 2 3 ): 1959, Nr. 11, 157—65 [russ.]. Partijnaja 2 i z n ' [Moskva] Halbleiter in Gegenwart u n d Z u k u n f t : 1956, Nr. 11, 66-69 [russ.]. • Physical Rev. On the electric and photoelectric properties of contacts between a metal a n d a semi-conductor 6 ): 39 ('32) 530f.

Propagandist [Moskva] Einige Probleme der modernen Physik: 1940, Nr. 24, 9-18 [russ.]. Radio [Moskva] Die Erforschung der Halbleiterelektronik verstärken!: 1955, Nr. 8, 4 - 7 [russ.]. Radiotechnika P. I. Lukirskij f 1 6 ) 6 ) u a ) : 10 ('55) Nr. 1, S. 78 [russ.]. Radiotechnika i filektronika Der Stand unserer Kenntnisse über Halbleiter u n d die künftigen Aufgaben: 1 ('56) Nr. 8, 1036-39 [russ.]. Rep. Progr. Physics Physical problems of thermoelectricity 2 6 ): 22 ('59) 167-203.

Sborn. nauön. Rabot Studentov fiziko-mech. Fak., LeningT. politechn. Inst. im. Kalinina Über Physikingenieure: Nr. 3 ('59) 5 - 7 [russ.]. Scientific American The revival of thermoelectricity: 5 ('58) 31-37. Socialistiieskaja Rekonstr. i Nauka Das Problem neuer Energiequellen: 1932, Nr. 1, 23-30. — Über einen Aufsatz von F. Quittner Physics and Chemistry Solids Properties of u n d über die Physik des festen Körpers: Nr. 5, various semi-conductors: 8 ('59) 6-14. 64-73. - Der Atomkern: Nr. 6, 26-47. Physikalische Z. Sowjetunion Vorwort: 1 15 J a h r e Physikalisch-Technisches I n s t i t u t : Alle Arbeiten russ. ('32) 3 f. — On the electric and photoelectric 1933, Nr. 8, 160-64. properties of contacts between a metal and 6 Socialistiieskaja Rekonstr. sel'skogo Choza semi-conductor ): 60-87. — Zerreißfestigkeit von dünnen Glasfäden und Glimmer- jajstva Die Physik im1 3 Dienste der sozialistiblättchen 3 0 ) : 132-36. — Über die mechanische schen L a n d w i r t s c h a f t ) : 1936, Nr. 4, 216-25 Festigkeit dünner Schichten: 137-39. — Zur [russ.]. Sovetskaja Nauka Halbleiter in Physik u n d Frage über den Mechanismus des elektrischen Durchschlags: 155-88. — Über die Durch- Technik: 1940, Nr. 11, 90-104 [russ.]. schlagsfestigkeit dünner Schichten 2 ): 2 ('32) Sovetskij Sojuz [Moskva] Halbleiter: 1956, 527-36. — Zum 90. Jahrestag der Deutschen Nr. 2, 26f. [russ.] (m. Bildn.). Physikalischen Gesellschaft: 7 ('35) 128. Sovetskoe Studeniestvo Physikalisch-mathePhotoelectromotive forces in cuprite crystals s ) : 343-65. — The spectral distribution of the matische Wissenschaften [Plan der wisseninner photoeffect in cuprous oxide"): 11 ('37) schaftlichen Arbeiten der physikalisch-mathe241-62. — Twenty years of soviet physics: 12 matischen Abteilung der Akademie der Wissenschaften der UdSSR 1946-1950]: 1946, ('37) 493-505. Nr. 6/7, S. 19 [russ.] (m. Bildn.). Pokroky Mat., Fysiky a Astron. UnterSowjetwissenschaft Physik u n d Landwirtsuchung von Halbleitern in der Sowjetunion: s c h a f t : 1954, Nr. 6, 691-700. Thermo3 ('58) 427-34 [ ]. elektrische Generatoren: 1956, Nr. 12, 1160Priroda [SSSR] 20 J a h r e sowjetische P h y - 64. — Der Stand unserer Kenntnisse über sik: 26 ('37) Nr. 10,43-49. - Wilhelm K o n r a d Halbleiter und die künftigen Aufgaben: 1957, Röntgen, 1845-1923. Zum 15. Todestag: 27 Nr. 5, 507-11. ('38) Nr. 2, 107-12. - Halbleiter in der Suppl. Nuovo Cimento On thermal conducmodernen Physik u n d Technik: 28 ('39) Nr. 4, 13-19. — A. N. Krylov zum 80. Geburtstag: tion in semi-conductors: 3 ('56) 702-15. 32 ('43) Nr. 6, 81 f. - Halbleiter in der moderTechnical Physics USSR Concerning t h e nen P h y s i k : 4 1 ('52) Nr. 12, 16-24. - Physik problem of the filtration of water in a heterou n d Landwirtschaft: 43 ('54) Nr. 7, 3-9. - geneous medium: 1 ('35) 400-14. — T w e n t y Pierre Curie - ein hervorragender französischer years of soviet physics: 4 ('37) 891-900. Physiker. Zum 50. Todestag: 45 ('56) Nr. 5, Technika Molodeäii Die Physik der nächsten 74-79. — Halbleiter in Gegenwart u n d Zu- Z u k u n f t : 1936, Nr. 2/3, 80f. - Halbleiter: k u n f t : 46 ('57) Nr. 11, 43-48. - - Alle 1940, Nr. 8/9, 11-14 (m. Bildn.). - Theorie Arbeiten russ. u n d Praxis der sowjetischen P h y s i k : 1950, Progress Semiconductors Noncrystalline Nr. 3, 12-15. - Physik u n d Technik: 1957, amorphous a n d liquid electronic semiconduc- Nr. 11, 12 f. — Das Erwachen eines Giganten (Die Z u k u n f t der Thermoelemente): 1959, tors 2 1 ): 4 ('60) 239-91.

Ioffe Nr. 3, 6-9 (m. Bildn.). - - Alle Arbeiten russ. Technika socialist. Zemledelija Die Erfolge der Physik im Dienste der Agronomie: 1982, Nr. 9, lOf. [russ.]. Trudy Inst. Istorii Estestvoznanija i Techn. A. N. Krylov in der Akademie der Wissenschaften: 15 ('56) 6-12 [russ.]. Usp. fiziC. Nauk Elektrische Leitfähigkeit fester Isolatoren und Halbleiter: 13 ('33) Nr. 4, 469-90. — Die sowjetischen Physiker und die vorrevolutionäre Physik in Rußland: 33 ('47) 453-68. - Zur Frage philosophischer Irrtümer meines Buches „Grundlegende Probleme der modernen Physik": 63 ('54) 589-98. — Albert Einstein zum Gedenken: 57 ('55) 187-92. — Pierre Curie [zum 50. Todestag]: 58 ('56) 571-79. — Der Stand unseres Wissens über Halbleiter und die bevorstehenden Aufgaben: 60 ('56) 173-77. - Ergänzung zu „Erinnerungen an Professor P. Ehrenfest" von G. E. Uhlenbeck: 62 ('57) 371 f. - Untersuchung von Halbleitern in der Sowjetunion: 63 ('57) 527-32. - Albert Einstein zum 5. Todestag: 71 ('60) 3-7. - I. V. Kurcatov als Erforscher der Dielektrika: 73 ('61) 61114. — — Alle Arbeiten russ. Vestn. Akad. Nauk SSSR Die komplexe Expedition zum Elbrus: 1935, Nr. 2, 2-7. Ein Kämpfer für die sowjetische Wissenschaft. A. P. Karpinskij zum Gedenken: 1936, Nr. 7, 47. — Erste Mendeleev-Vorlesung: Die Arbeiten des Ehepaares Joliot über den Atomkern: Nr. 10,43-45. — Resultate der großen zwanzig Jahre 1917-1937: 1937, Nr. 10/11, 308f. Die technischen Aufgaben der sowjetischen Physik und ihre Lösung: 1939, Nr. 11/12, 140-50. — Halbleiter in Physik und Technik: 1940, Nr. 10, 12-27. - Physik und Krieg: 1942, Nr. 5/6, 66-76. - Die Entwicklung der exakten Wissenschaften in der UdSSR seit 25 Jahren: 1943, Nr. 1/2, 10-22. - Der Plan der Akademie der Wissenschaften für 1943: Nr. 3, 23 f. — Die sowjetische Wissenschaft in den Jahren des Vaterländischen Krieges: Nr. 7/8, 6-8. — Die physikalische Bedeutung des Periodensystems: 1944, Nr. 6, 18-29. — Vladimir Leont'evic Komarov zum 75. Geburtstag: Nr. 10, U l f . — Pavel Michajlovic Nikiforov Nr. 11/12, 102-05. - Einige der nächstliegenden Aufgaben der Physik 31 ): 1946, Nr. 7, 3-8. - P. I. Lukirskij, 1894-1954 "•): 1954, Nr. 12, S. 62. - Albert Einstein f : 1955, Nr. 7, 98-101. - Pierre Curie zum 50. Todestag: 1956, Nr. 4, 30-35. - Die Halbleiter und ihre technische Anwendung: 1957, Nr. 8, 15-20. — Eine hervorragende wissenschaftliche Entdeckung. Zur Verleihung des Nobelpreises für Physik an die sowjetischen Wissenschaftler P. A. Cerenkov, I. E. Tamm und I. M. Frank"- *••): 1958, Nr. 12, 7-9. Diskussionsbeitrag zu A. V. Topciev: Der 21. Parteitag der KPdSU und die Aufgaben

2163

der Wissenschaft: 1959, Nr. 4, 37f. - Halbleiter und technischer Fortschritt: 1960, Nr. 11, 25-27. — Neue Wege zur Erforschung von Halbleitern: Nr. 12, 11-13. - - Alle Arbeiten russ. Vestn. sel'skochozjajstvcnnoj Nauki [Moskva] Ein wertvoller Beitrag der Agrophysiker zum technischen Fortschritt in der Landwirtschaft: 1960, Nr. 4, 58-63 [russ. m. engl., deutscher u. franz. Zusammenfassg.]. Vesta, vyssej Skoly Grundlegende methodische Richtlinien für Physikkurse an technischen Hochschulen: 1947, Nr. 1, 5f. [russ.]. — Über den Physikunterricht an technischen Hochschulen: 1951, Nr. 10, 16-20 [russ.]. Vestn. Znanija Die Spaltung des Atomkerns: 1934, 698-700. - Die Natur amorpher Körper: 1935, 566f. — Die Physik in der Sowjetunion: 1938, Nr. 8, 3-5. - Halbleiter in der Physik und Technik: 1941, Nr. 1, 34-41. — — Alle Arbeiten russ. Z. Physik Zur Frage nach dem Mechanismus des elektrischen Durchschlages 12 ) 16 ) 30 ): 73 ('32) 775-77. — Über Zerreißfestigkeit von dünnen Fäden und Folien 32 ) 30 ): 778. - Über den Photoeffekt in Cupritkristallen 9 ): 82 ('33) 754-58. 2 . eksper. i teoret. Fiziki Photoelektromotorische Kräfte in Cupritkristallen 9 ): 5 ('35) 112-26. — Die spektrale Verteilung des inneren Photoeffekts im Kupfer(I)oxid »): 6 ('36) 737-50. — 20 Jahre sowjetische Physik: 7 ('37) 1189-93. — Halbleiter in starken elektrischen Feldern 9 ): 9 ('39) 1428-50. - Einfluß der Feldstärke auf die elektrische Leitfähigkeit von Cu 2 0, V 2 0 5 , Se, Sb2S3, MoS2, WO,, T1 2 S 9 ): 1451-58. - Unsere Erfolge und unsere Aufgaben auf dem Gebiet der Halbleiter: 21 ('51) 231 f. - Albert Einstein 20 ) 27 ): 28 ('55) 637 f. Alle Arbeiten russ. 2 . techn. Fiziki Zur Frage der Durchschlagsfestigkeit dünner Blättchen 2 ): 3 ('33) 32-38 [m. deutscher Zusammenfassg.]. — Technische Physik in der UdSSR: 7 ('37) 1937-39. — Der elektrostatische Generator: 9 ('39) 2071-80. — Modelle von elektrostatischen Hochspannungsgeneratoren mit flüssigem Dielektrikum 8 ) 22 ): 2081-89. - Elektrostatische Hochspannungsgeneratoren in Kerosin 3 ) 8 ) 22 ): 2090-93. - Modelle von elektrostatischen Hochspannungsgeneratoren mit mehreren Scheiben 8 ) 22 ): 2094-103. — Schema eines elektrostatischen Hochspannungsgenerators mit metallisch geerdeten Achsen 8 ): 11 ('41) 617 f. — 220 Jahre Akademie der Wissenschaften: 15 ('45) 97 f. - Jakov Il'ic Frenkel' t : 22 ('52) 1905-07. - Einfache Methode zur Messung der Wärmeleitfähigkeit 9 ): 2005-13. — Relaxationsprozesse in einem gleichrichtenden Halbleiterpaar»): 23 ('53) 209-25. Thermoelektrizität in Halbleitern: 1452-59. — Über die Korrelation der Wärmeleitfähig-

2164

Ioffe - • Ionescu, Dumitru

keit von Halbleitern mit der Beweglichkeit der Elektronen 9 ): 24 ('54) 1910f. - Zwei neue Anwendungen des Peltier-Effekts: 26 ('56) 478-82. — Einige Aufgaben der Weiterentwicklung der Lehre von den Halbleitern: 27 ('57) 1153-60. - Die technische Physik in der Sowjetunion: 2433-36. — Messung der Wärmeleitfähigkeit von Halbleitern in der Nähe der Zimmertemperatur 9 ): 28 ('58) 235763. — — Alle Arbeiten russ. Pod Znamenem Marksizma Die Entwicklung der atomistischen Anschauungen im 20. Jahrhundert: 1934, Nr. 4, 52-68. - Über die Lage an der philosophischen Front der sowjetischen Physik: 1937, Nr. 11/12, 131-43. - Physik und Krieg: 1942, Nr. 5/6, 90-99. Die Entwicklung der exakten Wissenschaften in der UdSSR seit 25 Jahren: Nr. 11/12, 15063. — — Alle Arbeiten russ. Znanie — Sila Ein verwirklichter Traum (Über Halbleiter und ihre Anwendung): 1956, Nr. 2, 12-16 [russ.]. Zrezda [Leningrad] Die nächstliegenden Aufgaben der sowjetischen Physik: 1946, Nr. 11, 166-72 [russ.]. Ferner in den gleichen und anderen Sammelwerken und Zeitschriften zahlreiche Diskussionsbeiträge, Vortragsreferate sowie weitere Beiträge zu wissenschaftsorganisatorischen Fragen. Zahlreiche Aufsätze in Zeitungen. Vorworte zu einigen Büchern. Mit: ') S. V. A j r a p e t j a n c ; ') A. P. A l e k e a n d r o v ; *) S. A. B o b k o v s k i j ; «) N. A. F e d o r o v i i ; •) V. A. F o k ; •) Ja. I. F r e n k e l ' ; ' ) A. N. Frumkin;") B. M. G o c h b e r g ; ') A. V. I o f f e ; 10) E. K. I o r d a n i ä v i l l ; ") P. L. K a p i c a ; ") P. P . K o b e k o ; ") F. E . K o l j a s e v ; ") N. V. K o l o m o e c ; ") I. V. K u r c a t o v ; ") A. A. L e b e d e v ; ") B. Ja. M o j i e s ; ") D. N. N a s l e d o v ; '•) L. M. N e m e n o v ; M) A . N . N e s m e j a n o v ; ") A. R. R e g e l ' ; ") N. M. R e j n o v ; ") I. B. R e v u t ; '•) M. A. S a t e l e n ; ") N. N. S e m e n o v ; ") L. S. S t i l ' b a n s ; ") A. V. T o p i i e v ; ") S. I. V a y i l o v ; ») V. P. V o l o g d i n ; 30) A. V a l ' t e r ; ") B. M. Yul; ") S. N. Zurkov. VI

IONESCU, V. Dumitru. Math., ration. Mech. — 1928 Habil. math., Univ. Bucure?ti; '28-31 Doz., '31-52 außerord. Prof., '52-64 ord. Prof., '64Prof. emer., Univ. Cluj; '56-68 SektionsChef, Inst, de Calcul, Akad. d. Volksrepubl. Rumänien. — '63 Preis (Unterrichtsministerium); '66 wiss. Verdienstorden 3. Kl. (Volksrepubl. Rumänien). *1901, Mai 14, Bucurefti. W. Curs de ecuatii diferen^iale (Cluj '50) 429 S. — Curs de matematici speciale (Cluj '53) 393 S. — Curs de matematici superioare (Cluj '55) 306 S. — Curs de analizä matematicä (m. G. Cälugäreanu), 1: Notiunile de bazä ale analizei matematice; Calculul diferential; Calculul integral (Cluj '55) 669 S.; 2: Functii de mai multe variabile; Teoria seriilor; Inte-

graie multiple; Ecuatii diferencíale ('58) 805 S. — Cuadraturi numerice (Bucuresti '57) 340 S. (Academia Republicii Populare Romîne, Stiintä si tehnicä, 10). — Matematici superioare. Manual pentru clasa a Xl-a umanistica (Bucuresti '59) 276 S., weitere Auflagen in den folgenden Jahren; Ungar.: (Bucuresti '61) 279 S., weitere Auflagen in den folgenden Jahren; deutsch: Höhere Mathematik, Lehrbuch für die 11. Klasse der humanistischen Abteilung (Bucuresti '63) 276 S. — Ecuatii diferencíale si integrale (Bucuresti '64) 332 S. — Ecuatii diferentiale ordinare si cu derivate partiale. Manual (m. C. Kalik) (Bucuresti '65) 288 S. — Elemente de analizä matematica. Manual pentru clasa a XI-a liceu, seccia umanistica (Bucuresti '67, '68)231 S.; deutsch: Elemente der mathematischen Analysis, Lehrbuch für die 11. Klasse des Lyzeums, humanistische Abteilung (Bucureçti '67) 228 S.; ungar. : (Bucuresti '67) 232 S. Acta math. Acad. Sei. hungar. Bestes des formules de quadrature de Gauss et de Turán: 18 ('67) 283-95. Analele $ti. Univ. „AI. I. Cuza" Ia§i, Secf. Ia La représentation de la différence divisée généralisée par une intégrale définie, dans le cas des nœuds simples, 1: 11 B ('65) 165-84 [m. rumän. u. russ. Zusammenfassg.]. Annales polon. math. Généralisation d'une formule de dérivation numérique de V. N. Fadeeva: 14 ('64) 169-81. Buletin çti., Acad. Republ. popul. romîne, Sec(. $ti. mat. fi fizice Kubaturformeln, deren Integrationsbereich sich über ein bestimmtes Dreieck erstreckt: 5 ('53) 423-30. — Eine Verallgemeinerung einer Eigenschaft, die in der Runge-Kutta-Methode der numerischen Integration von Differentialgleichungen vorkommt: 6 ('54) 229-41; 8 ('56) 67-100. Existenzsätze für eine Funktionalgleichung von Picard: 9 ('57) 263-67. Alle Arbeiten rumän. m. russ. u. franz. Zusammenfassg 1 Buletinul Inst, politehn. Ia$i Formules de cubature avec un nombre réduit de nœuds, 1: 13 ('67) Nr. 3/4, 111-18 [m. rumän. ZÚT sammenfassg.]. Buletinul Soc. §ti. Cluj, România Quelques applications des propriétés d'une famille de trajectoires: 9 ('39/40) 294-98. - Généralisation d'une propriété mécanique de la chaînette;: 299-306. — Quelques applications d'une formule de G. Darboux : 446-52. Bull. Cl. Sci. Acad. roy. Belgique Deux théorèmes sur une équation intégro-différèritielle: (5) 19 ('33) 1377 f. Bull. math. Soc. roumaine Sci. Le théorème de Fuchs: 35 ('33) 149-71. — La généralisation d'une équation fonctionnelle rencontrée par G. Darboux: 41 ('39) 77-100. - Sur les formules généralisées de G. Darboux, et un

Ionescu, Dumitru théorème sur les quadratures mécaniques: 48 ('41) 7-22. Bull. math. Soc. Sci. math, et physiques Bépubl. popul. roumaine L'application de la méthode des approximations successives à l'intégration numérique des équations différentielles: (N.S.) 3 ('59) 423-31. Bull. math. Soc. Sci. math. Républ. social. Roumanie La représentation de la différence divisée généralisée d'une fonction par une intégrale définie dans le cas des nœuds multiples, 2: (N.S.) 9 ('65) 31-57. - Sur quelques formules de dérivation numérique: 12 ('68) 47-74. Bull. sci. Ecole polytechn. Timiçoara Un problème de géométrie différentielle: 4 ('32) 185-91. — Sur la parabole de sûreté: 192-95. — Sur certains déterminants déduits du déterminant de Vandermonde: 11 ('43) 48-53. — Sur le calcul d'un déterminant: 12 ('45) 49-52. Bull. Sect. sci., Acad. roumaine L'application d'une formule de T. J . Stieltjes à un problème de M. D. Pompeiu: 21 ('38/39) 21418. — Généralisation d'une équation fonctionnelle rencontrée par G. Darboux: 22 ('39) 16567. — Applications d'une formule généralisée de G. Darboux: 168-71. — Une application d'une équation fonctionnelle: 24 ('41/42) 57376. — Un théorème sur les formes quadratiques: 27 ('45) 176-79. — Extension d'une équation fonctionnelle de M. Th. Anghelutza à des fonctions de deux variables: 30 ('47) 264r-69. Comunicarile Acad. Bepubl. popul. romîne Einige praktische Quadraturformeln: 13 ('63) 689-95 [rumän. m. russ. u. franz. Zusammenfassg.]. C.R. Acad. bulgare Sci. Méthodes pratiquées pour l'intégration numérique des équations différentielles du premier ordre: 16 ('63) 46971 [m. russ. Zusammenfassg.]. C.B. hebd. Séances Acad. Sci., Paris Certaines courbes qui généralisent les coniques: 194 ('32) 2006-09. - Généralisation d'une équation de M. E. Goursat: 197 ('33) 666-68. — Nouvelles formules pratiques de quadrature: 259 ('64) 504-07. C.B. hebd. Séances Acad. Sci., Paris, Sér. A Sur une classe de formules de cubature: 266 ('68) 1155-58. C.B. Séances Acad. Sci. Boumanie Quelques problèmes relatifs à un système d'équations aux dérivées partielles du second ordre: 1 ('36/37) 12-17, 55-59. - Remarques sur une équation intégrale singulière de M. E. Picard: 27 l f . — Généralisation d'une équation fonctionnelle de M. D. Pompeiu: 2 ('38) 431-40. — Un problème relatif à la seconde formule de la moyenne: 603-06. C.B. Séances Inst. Sci. Boumanie Sur une équation aux différences finies: 4 ('40) 227-30.

2165

Disquisitiones math, et pliysicae [Bucuregti] Quelques problèmes relatifs à une formule de récurrence: 4 ('45) 3-94. — Sur une équation de récurrence à deux indices: 6 ('48) 49-80. Dokl. Akad. Nauk SSSB Darstellung der geteilten Differenz der Ordnung (m, n) einer Funktion zweier Variablen durch ein bestimmtes Integral, 1:141 ('61) 1026-29 [russ.]; ~ 2: 1294-97 Enseignement math. Sur certaines courbes qui généralisent les coniques: 31 ('32) 58-66. Gazeta mat. [Bucure§ti] Schwerpunkt des Dreiecks und des Tetraeders: 39 ('33/34) 25156. — Eine Eigenschaft einer TrajektorienFamilie: 41 ('35/36) 57 f. - Prof. G. Titeica f : 44 ('38/39) 505-09, 561-64. - Über einen Satz des Herrn General Gh. Buicliu: 45 ('39/ 40) 64-72. - Über das Problem Nr. 2735: 46 ('40/41) 31 f. — Anwendungen der Vektorrechnung. Eigenschaften des Tetraeders: 230-37. — Verallgemeinerungen einiger Sätze von Pappus: 47 ('41/42) 201-04, 252-56. Lösung eines Gleichungssystems: 50 ('44/45) 213-18. — Anwendung der Funktionaldeterminante: 51 ('45/46) 91-94. — Anwendungen des Begriffes der Geometrie der Gewichte zum Beweisen einiger Sätze: 52 ('46/47) 267-74. — — Alle Arbeiten rumän. Gazeta mat. çi fizicä, Ser. A Das Restglied in der „Lieblingsquadraturformel" von Newton: 7 ('55) 298-302. - Eine wichtige Identit ä t und Auflösung einer Bilinearform in einer Produktsumme: 303-12. — Verallgemeinerung der Formel von Taylor: 389-95. — Von der Formel des Archimedes zu einer Kubaturformel: 8 ('56) 3-10. — Über den Stewartschen Satz: 407-11. — Theoreme, äquivalent mit den Theoremen von Menelaus und Ce va: 53441. — Die Teilung von Polynomen: 11 ('59) 462-70. — Geometrische Betrachtungen über die Gleichung zweiten Grades mit komplexen Koeffizienten: 15 ('63) 225-31. - - Alle Arbeiten rumän., meist m. russ. u. franz. Zusammenfassg. Gazeta mat. çi fizicä, Ser. B Einige Sätze vom Dreieck: 8 ('57) 113-18 [rumän.]. — Über eine arithmetische Progression: 15 ('64) 245-50 [rumän.]. ; Gazeta mat. [Bucure§ti], Ser. A Die wissenschaftliche Tätigkeit von Th. Anghelutä: : 70 ('65) 190-97 [rumän.]. Lucräri $ti., Inst, politehn. Cluj Der Fundamentalsatz über implizite Funktionen: 1 (.'58) 57-67 [rumän. m. russ. u. franz. Zusammenfassg.]. Mathematica [Cluj, Timi$oara] Sur un mouvement tautochrone: 15 ('39) 49-52.' — Sur un mouvement relatif: 204-08. — L'activité scientifique du professeur A. Angelescu: 17 ('41) 111-28. — Sur une configuration de six points attachée à un tétraèdre coupé par

2166

Ionescu, Dumitru

trois plans parallèles à une face: 18 ('42) 104—11. — Quelques applications de certaines équations fonctionnelles: 19 ('43) 159-66. — Relations entre polynômes définis par certaines relations de récurrence: 22 ('46) 102-08. — N. Abramescu f : 23 ('47/48) 139-46. - Sur une équation fonctionnelle: [N.S.] 1 ('59) 1126. — Formules de cubature: Application à l'intégration numérique des équations aux dérivées partielles du second ordre de type hyperbolique: 239-80. — Formules de quadrature à nœuds extérieurs: 2 ('60) 55-142. — La représentation de la différence divisée d'une fonction de deux variables par une intégrale double, 1: 3 ('61) 59-78; ~ 2: 23171. — L'intégration numérique des équations différentielles du second ordre: 6 ('64) 217-32. — Sur la formule de quadrature de Gauss: 7 ('65) 43-46. — Application de la représentation des différences divisées d'une fonction, par une intégrale définie, à certaines formules de dérivation numérique de l'Académicien T. Povoviciu : 8 ('66) 51-60. Mathesis Quelques propriétés des coniques et des quadriques: 46 ('32) 398-400; 47 ('33) 51-54, 106-09. Revistä mat. Timiçoara Methode zur Bestimmung des Schwerpunkts: 12 ('32) 25-28. — Über einen geometrischen Ort: 49f. — Verallgemeinerung eines Problems von Newt o n : 74f. — Einige Anwendungen eines Satzes von Guldin: 100f. — Sukzessive Entwicklung: 109-11. — Anwendungen der Vektorrechnung: 133-36. — Ein Satz aus der Elementargeometrie: 13 ('33) 13 f. — Über einen Satz von Prof. V. Alaci: 20 ('40) 17-19. - Die Verallgemeinerung eines Satzes von M. d'Ocagne: 21 ('41) 25f. — Über ein Problem von Prof. D. Pompeiu : 22 ('42/43) 132. - Eigenschaften des Tetraeders: 23 ('43/44) 4. Über einen Satz von Thébault: 24 ('45) 123f. — — Alle Arbeiten rumän.

tion numérique de V. N. Fadeeva avec les différences divisées: 1966, Nr. 1, 29-35. Alle Arbeiten rumän. m. russ. u. franz. Zusammenfassg. Studii Cercetàri §ti., Acad. Republ. popul. romîne, Filíala Cluj (Ser. 1) Quelques formules de quadrature mécanique: 2 ('51) Nr. 3/4, 16-37. — La généralisation de la formule de quadrature de N. Obreschkoff: 3 ('52) Nr. 3/4, 1-9. — L'intégration d'une équation aux dérivées partielles qui intervient dans le problème du calcul des tensions thermiques dans les tubes bouilleurs des chaudières au passage forcé et des chaudières à radiation 4 ): 4 ('53) Nr. 1/2, 73-78. - Formules de cubature, le domaine d'intégration étant un triangle quelconque: 6 ('55) Nr. 1/2, 7-49. Aile Arbeiten rumän. m. russ. u. franz. Zusammenfassg. Studii $i Cercetàri Mat., Acad. Republ. popul. romîne, Filíala Cluj L'activité mathématique du professeur Tiberiu Popoviciu 5 ) 6 ) 3 ) 4 ) 1 ) 7 ) : 8 ('57) 7-13. — L'intégration d'une équation différentielle: 275-89. — Formules de quadrature à nœuds extérieurs: 9 ('58) 45-134. — La forme canonique d'un déterminant et ses applications: 10 ('59) 33-44. — Réduction d'une forme bilinéaire à une forme canonique : 45-49. — L'application des formules de dérivation numérique à l'intégration numérique des équations différentielles: 259-315. — Formules de cubature; application à l'intégration numérique des équations aux dérivées partielles du second ordre de type hyperbolique: 11 ('60) 35-78. — Application de la méthode des approximations successives à l'intégration numérique des équations différentielles: 273-86. — Un théorème sur les formes quadratiques relatif aux théorèmes d'Appollonius: 287-97. — Nouvelles formules du type Adams pour l'intégration numérique des équations différentielles du premier ordre: Suppl., 101-16. — Méthodes pratiques d'intégration numérique des équations différentielles: 12 ('61) 257-81. — La généralisation de la formule de quadrature de N. Obreschkoff à des intégrales doubles: 13 ('62) 35-86; 17 ('65) 831-41. — Quelques formules pratiques de cubature: 13 ('62) 275-99. — Numerische Integration: Suppl., 243-86. — Le reste dans la formule d'intégration numérique de Nyström: 14 ('63) 43-48; ~ de Stürmer: 49-56. — Construction de quelques formules pratiques de quadrature: 16 ('64) 757-69. — Généralisation des formules de quadrature de Simpson et de Newton: 1001-32. — — Aile Arbeiten rumän. m. russ. u. franz. Zusammenfassg. [13 ('62) Suppl., 243-86 rumän. ohne Zusammenfassg.].

Revue roumaine Math, pures et appi. Quelques formules pratiques d'intégration numérique des équations différentielles: 9 ('64) 23743. Soobsë. Akad. Nauk Graz. SSR Eine Verallgemeinerung der Quadraturformeln von Simpson, Newton und Milne: 34 ('64) 11-18 [russ. m. grusin. Zusammenfassg.]. Studia Univ. Babeç (et) Bolyai, Ser. I Une formule d'Abel et sa généralisation: 1957, 13-22. — La formule de Boole: 1958, Nr. 1, 39-47. — Le professeur Theodor Anghelu^ä. A l'occasion de son 75 e anniversaire: 165-72. — Un théorème sur les systèmes d'équations linéaires: 1960, Nr. 1, 97-106. - - Aile Arbeiten rumän. m. russ. u. franz. Zusammenfassg. Studia Univ. Babeç-Bolyai, Ser. math.-phys. Studii çi Cercetàri Mec. api., Acad. Republ. Sur une formule de cubature: 1963, Nr. 1, popul. romîne Numerische Integration der 79-91. — La relation de la formule de dériva- Integralgleichung vom Typ Volterra: 12 ('61)

Ionescu, Dumitru — Ionescu, Mircea 175-83 [rumän. m. russ. u. franz. Zusammenfassg.]. 2 . vyiislitcl'noj Slat, i mat. Fiziki Restterm in Adams' Integrationsformel: 2 ('62) 154-57 [russ.]. Ferner einige Beiträge in Sitzungsberichten.

Mit: ') L. B a l ; ! ) G. Cälugäreanu; •) E. Gorgely; 4) Ii. Németi; ») M. Nioolcscu; •) G. Pie; ') F.

Kadó.

VI IONESCU, Mircea V. Chem. (anorg. u. org.). — 1928-41 Titularprof. allg. Chem., Landwirtsch. Hochsch., Cluj ; '4252 Prof. org. Chem. u. Biochem., '52-66 ord. Prof., '66- konsult. Prof., Agronom. Inst. („N. Bälcescu"), Bucuresti. — '35, '41, '54, '65 Medaillen (Landwirtschaftsministerium) ; '64 Prämie (Unterrichtsministerium). *1896, Mai 11 (April 28), Bucurefti.

S. Probleme actúale de biologie si stiinte agricole. Lucrare dedicata acad. prof. G. Ionescu-Sisesti cu prilejul implinirii a 75 de ani. Academia Republicii Populare Romíne ([Bucuresti] '60) 95-102: Biochemical characters of the species Zea mais; relationships between the biochemical characters, the morphological structure and the environment [rumän. m. russ. u. engl. Zusammenfassg.]. W. Industria produselor de azot in serviciul agriculturii (Bucuresti '32) (Pubi. Inst, de Cercetäri Agronomice). — Calitätile porumbului din Romania si posibilitadle de valorificare ale acestuia (Bucurefti '32) — Metode de analiza a bauturilor spirtoase (Bucuresti '36) ( ~ ) . — Metodede analiza vinurilor (Bucuresti '45) 159 S. ( ~ ) . — Analiza cerealelor, semintelor, fäinii, piinii, pastelor fáinoase si nutre furilor (Bucuresti '47) ( ~ ) . — Microelementele si rolul lor in sporirea produc^iei agricole (Bucuresti '56). — Curs de chimie organica (Bucuresti '56, '60) 3 6 5 + 4 S. — Chimie generalä (pentru biologie si agricultura) (m. S. Gogalniceanu) (Bucurefti '57) 627 S.; 2. Aufl. u. d. T.: Chimie generalä (pentru institutele agronomice) (m. ~ ) 2 ('64) 723 S. — Lucrari practice de chimie analitica, organica si biologica (m. M. Ivänescu, M. Ferando) (Bucuresti '61) 33 S. — Curs de chimie biologica: Substancie organice fundamentale ale organismului. Pentru uzul studenfilor cu si färäfreeventä (Bucuresti'62) 301 S. — Metode de analiza chimice si fizice folosite in agricultura (m. D. Davidescu, M. Ivänescu) (Bucuresti '63) 17+491 S.

2167

Analele Inst. Cercetäri agron. României L'établissement de la provenance d'un moût ou d'une vinasse par l'analyse chimique14): 4 ('32) 175-87 [rumän. m. franz. Zusammenfassg.]. — Contribution à l'étude de la détermination de l'acidité volatile des vins 14 ) 27 ): 6 ('33) 26 S. — Contribution à l'étude de la détermination de l'acidité volatile des vins. Influence de l'acide lactique27) : 6 ('34) 3-24. — Beiträge zur Untersuchung der Pflanzenaschen. Chemische Methode zur Kennzeichnung und Unterscheidung von Getreide und Früchten 17 ): 194-230 [rumän. u. franz.], — Beiträge zur chemischen Untersuchung rumänischer Maissorten: 7 ('35) 145-66 [rumän.]; ~ 27)30)14). 9 ('37) ) 1 0 ('38) 282-357,11 ('39) 266-312,12 ('40/41) 383-425 [rumän. m. franz. Zusammenfassg.]. — Beiträge zur Untersuchung der chemischen Bestimmung der Glucose in den durch Verzuckerung der Getreidemehle erhaltenen Maischen14): 8 ('36) 453-76 [ ~ ] . — Untersuchung über die Stärkebestimmung [, 1]: Schlußfolgerungen über die Exaktheit und Schnelligkeit einiger Methoden zur Stärkebestimmung in Getreide30): 9 ('37) 160-84 [ ~ ] ; ~ 2: Beziehungen zwischen Stärke- und Zellulosegehalt30): 10 ('38) 358-76 [ - ] . — Beiträge zum Studium der Brotfabrikation aus Mehlmischungen14): 12 ('40/41) 3-14 [rumän. m. deutscher Zusammenfassg.]. — Continutul în zahär al sorgului zaharat, cultivât la Bäneasa. Prepararea si proprietätile siropului obtinut din sorb: [?] ('46). — Stabilitatea la pästrare a uleiului de floarea soarelui obtinut in presele täränesti: [?] ('47). Annales Falsificat. et Fraudes Les jus de fruits préparés comme boissons alcooliques. Le vin de groseilles: 28 ('35) 78-88. Buletin §ti., Acad. Republ. popul. romine, Ser. Agron. Noi produse obfinute din porumb: 9 ('57). Buletinul Acad. înalte Studii agron. Cluj Sur la purification de l'alcool industriel. Contribution à l'étude de l'élimination des aldéhydes, 1: 3 ('32) 10 S. — Contributions à la détermination colorimétrique des aldéhydes en liquides et distillats alcooliques: 5 ('34) [rumän.]. — Contribution à l'étude de l'acide sulfureux dans les vins: 6 ('36) 9 S.

Buletinul Fac. Agron., Bucureçti Sur la détermination de la cellulose brute dans les matières végétales: 4 ('46/47). — Contribution à l'étude des relations entre la composition chimique et le degré d'extraction d'une farine: [?] ('47). Buletinul Fac. Agron. Cluj Die chemische Zusammensetzung von rumänischem Mais: 7 Agricultura socialista Calitatea recoltelor si ('39) 15 S. [ ]. cercetarea variabilità^ chimice a plantelor Bull. Soc. chim. France, Mém. Contribuagricole: 3 ('65) Nr. 20, 8-. tions à l'étude des substances à hydrogène Agrochimica [Pisa] The chemical variability mobile méthylénique: (4) 51 ('32) 171-200. of cultivated plants : 1969. L'établissement de la provenance d'un moût

2168

Ionescu, Mircea

ou d'une vinasse par l'analyse chimique 14 ) : 616-18. — Contribution à l'étude des dérivés de la biindone, 1 : Les classes des indanedionebiindones et des bis-biindones 30 ) : 1109-25; ~ 2: Action des alcalis alcooliques et des alcoolates alcalins sur les bis-biindones 30 ): 1245-58; ~ 3 : Action de la biindone sur les aldéhydes alcoyliques 30 ) : 1551-56. — Contribution à l'étude de la désoxybenzoïne comme substance à méthylène actif, l 2 7 ): 1215-27; ~ 2 27 ): 1231-45. - Sur la purification de l'alcool industriel. Contribution à l'étude de l'élimination des aldéhydes, 2»): 68 ('33) 899-909. — Une nouvelle méthode de différenciation et de détermination quantitative des aldéhydes formique et acétique dans leur mélange 30 ) : 909-18. — Nouvelle méthode pour le dosage de la pyridine en solution diluée 30 ): 1087-96. — Nouveau modèle de manomètre: (5) 2 ('35) 125f. - Contribution à l'étude de la détermination des bases déplaçables du sol32) : 6 ('39) 149-60, 160-66. Comunicârile Acad. Republ. popul. romîne La valeur des farines de maïs de différents degrés d'extraction 2 1 ): 6 ('56) 1205-10 [rumän. m. russ. u. franz. Zusammenfassg.]. Grâdina, Via si Livada Beiträge zum Studium der Beschleunigung des Wachstums von Tomaten [, l] 22 ) 21 ): 1954, 24-31 [rumän.]. Lucrärile Sesiunii çti., Inst, agron. „N. B&lcescu" Contributions à l'étude de l'accélération de la maturation des tomates 22)21) : 1 ('55) 157-60 [russ. u. franz.]. — Une nouvelle méthode pour établir la qualité des grains des céréales28) : 274f. [russ. u. franz.]. Anuarul Lucrärilor §ti., Inst. agron. „N. Bâlcescu", Bucureçti Emploi de la farine de maïs à la fabrication du pain, 1 : Obtention du pain avec bonnes propriétés technologiques et de digestibilité: 2 ('57) [ ]. Lucrâri $ti., Inst, agron. „N. Bâlcescu", Ser. A Action stimulatrice de l'hétéroauxine sur les semences des plants et boutures de fleurs, légumes et de vigne 11 ) 22 ) 21 ) 24 ) 16 ) 23 ) 1 ): 4 ('60) 111-20 [rumän. m. russ. u. franz. Zusammenfassg.]. — Caractéristiques physiques et chimiques du maïs hybride double cultivé à Fundulea en 1957-19592»)21)13)6) : 129-35 [ - ] . Emploi de la farine de maïs à la fabrication du pain, 2 : Valeur alimentaire du pain obtenu 21 ) : 137-43 [ ~ ] . — La qualité du maïs double hybride et de ses farines de différents degrés d'extraction 31 ) 21 ) 8 ) 13 ) 28 ): 5 ('61) [rumän., S. 212-14 russ., franz. u. engl. Zusammenfassg.]. — L'influence des substances de croissance sur le racinement des boutures de portegreffe 18 ) 21 ) 1 ): 6 ('62) 157-66 [rumän. m. russ., franz. u. engl. Zusammenfassg.]. — Untersuchungen über die Wechselwirkung der Nährstoffe bei Winterweizen unter den Bedingungen einer NPK-Düngung 34 ) 19 ) 21 ) 7 ) 13 ) : 7 ('64) 35-47 [rumän. m. russ. u. deutscher Zusammenfassg.]. — The dynamics of quantitative

changes of certain substances in simple and double hybrid maize ontogeny 10 ) 8 ) 21 ) 13 ) 33 ) 4 ) : 133-46 [rumän. m. russ. u. engl. Zusammenfassg.]. — Die Veränderlichkeit der chemischen Eigenschaften der Maisdoppelhybride unter verschiedenen Umwelteinflüssen 2 ') 21 ) 1 ®) 33 ) : 157-70 [rumän. m. franz. u. deutscher Zusammenfassg.]. — Dynamique de la modification de certaines substances dans l'ontögénie des hybrides simples et doubles de maïs (PL F 2 , F 3 ) 10 ) 8 ) 21 ) 13 ) 33 ): 9 ('66) 41-43 [franz., engl. u. russ.]. — Influence des engrais sur le contenu protéique des récoltes chez les cultures mixtes maïs-légumineuses 34 ) 33 ) 6 ): 111 f. [ ~ ] . — La qualité des hybrides doubles de maïs: 288f. [ ~ ] . — Comportement de différentes variétés de betterave sucrière pendant l'attaque de la cercosporiose en conditions d'irrigation 36 ) 37 ) 38 )'): 441-43 [ ~ ] . Lucrâri çti., Inst. agron. „N. Bâlcescu", Ser. B Einige biochemische Merkmale von 2 Pfirsichsorten während der Vegetationsperiode und während des Ruhezustandes 18 ) 21 ) 7 ) : 7 ('64) 65-74 [rumän. m. engl. u. deutscher Zusammenfassg.]. — Certains caractères biochimiques chez les variétés de pêcher „Fleur de mai" et „Elberta" 18 ) 7 ) 1 ) : 8 ('65) 141-52 [rumän. m. franz. u. engl. Zusammenfassg.]. — — Einige weitere Arbeiten in dieser Serie. Probleme agric. [Bucureçti] Gehalt des Maismehls an Carotinoiden und ihren Derivaten bei verschiedenen Ausmahlungsgraden 2 ) 12 ): 9 ('57) Nr. 6, 36-43. - Gehalt der rumänischen Maissorten und ihrer Mehle verschiedener Ausmahlungsgrade an eiweißhaltigen Nährstoffen 20 ): 10 ('58) Nr. 2, 31-37. — Forschungen über die Produktivität, Reife und Qualität von Maisdoppelhybriden 2> ): Nr. 10, 20-31; ~ 2 ») 21 ): 12 ('60) Nr. 11, 22-32. — Die biochemischen Merkmale der in Fundulea 1957 angebauten Maisdoppelhybriden 13 ) 21 ): 11 ('59) Nr. 6, 13-22. - Die Erzeugung von Maishybridsaatgut in Rumänien2»)21)13)6): 12 ('60) Nr. 11, 8-21. - Der Einfluß der pedoklimatischen Bedingungen auf die Kornqualität bei verschiedenen Maisdoppelhybriden 2 ») 21 ) 13 ) 6 ) : 14 ('62) Nr. 5, 49-56. — — Alle Arbeiten rumän., oft m. russ. u; franz. Zusammenfassg. Probleme zootehn. çi vetcrin. Contribution à la connaissance de la qualité de la graissé obtenue à l'aide de porcs engraissés avec lès farines de maïs à divers degrés d'extraction 3 ) 21 13 ) )»): 1958, Nr. 7, 23-27 [rumän. m. russ;; franz. u. engl. Zusammenfassg.]. Revistâ Cliim. [Bucureçti] Uber die Mer thoden der Bestimmung von Lipoiden in pflanzlichen Stoffen 13 ): 7 ('56) 718-21 [rumän.]. Revista Înyà(âmîntului sup. Allgemeine und biologische Chemie: 8 ('66) Nr. 1, 21r29 [rumän.].

Ionescu, Mircea - Ionescu, Theodor Revue Chim., Acad. Républ. popul. roumaine The chemical variability of the agronomic crops and t h e improvement of their quality: 7 ('62) 271-77. Revue roumaine Biochim. Le caractère de la variabilité chimique des plantes (le cas de l'éspèce Zea Maïs): 2 ('65) 3-17. - Some biochemical characters of shrivelled wheat 28 ) 13 ) 33 21 ) ) : 4 ('67) 19-23. Bevue roumaine Chim. Le caractère chimique héréditaire des formes biologiques et sa variabilité (cas de l'espèce Zea Maïs)20) : 9 ('64) 331-36. — Modification des caractères chimiques des plantes agricoles par hybridation. Cas du maïs 10 ) 8 ): 389-94. — Neue Angaben über die Getreideverwertung: 12 ('67) 152934Studii çi Cercetäri Biochim., Acad. Republ. popul. romîne, Bucureçti Einige biochemische Eigenschaften geschrumpfter Maiskörner 29 ) 21 ) 5 ) : 4 ('61) 485-90 [rumän. m. russ. u. franz. Zusammenfassg.]. — Le caractère de la variabilité chimique des plantes: 8 ('65) [rumän.]. Mit: *)4 N. Anglielide; ! ) M. Anghelovici; 3) G. Bäia; ) X. Blrnaure;8 ') M. Bîrsan; •) S. Caragiani; ') E. Cernescu; ) A. Ciolu; *) M. Constantinescu; ") T. Cräclun; ") D. Davidescu; ") C. Diaconescu; ") M. Ferando; ») L. Gaal; 1S) I. M. Georgescu; ") M. Georgrescu; ") V. N. Georgescu; ") N. Ghena; ")!I V. Ionescu-§i?e?ti; "•) S. Ionut-Caragiani; ) M. Ivänescu; ") I. Màier; ") A. Militiu; ") M. Nistor; »•) - ; ") S. Popesco; •') O. G. Popescu; ••) S. Rizescu; *•) N. ") E. Stancu; Säulescu; ••) H. SluçaiiBchi; «) P. Stancovici; 3S) M. Visarion; ") N. Zamfirescu; M) E. Docea; M) E. F r ä t i l ä ; ") O. Vulpe. VI

IONESCU, Theodor V. Physik. Stud., 1923 Dr., Univ. Iaçi; '24 Dr. ès sei. physiques, Univ. Nancy; '25-41 Prof. Expierimentalphysik, Univ. Ia§i; '41- Prof. Elektrizitätslehre, Univ. Bueureçti. — '63 Staatspreis (Volksrepubl. Rumänien). *1899, Febr. 8, Dorohoi. Zur Biogr. C. V. G h e o r g h i u , Revista sti. „V. Adamachi" 31 ('45) Nr. 1/2, 130-, Zum 70. Geb.tag Festschrift: Revue roumaine Physique 14 ('69) Nr. 9 (S. 849-1088, m. Biogr. S. 851-53, Bildn., Paks.). S. Probleme des Plasmas in Physik und Astronomie. Tagung der Physikalischen Gesellschaft in der Deutschen Demokratischen Republik, Leipzig 1956 (Berlin '58) 79-91: Les fréquences critiques et les couches ionosphériques [m. deutscher Zusammenfassung]. — Tagungsbericht Geomagnetismus und Aeronomie (Berlin '62) (Deutsche Akad. d. Wissenschaften zu Berlin, Geomagnet. Inst. Potsdam, Abhandig. 29) 243-51: Vergleichsstudium über die Absorptionsfrequenzen der negativen Wasserstoff- und Sauerstoffmolekülionen 4 ). — Contributed papers. 8"1 International conference on phenomena in ionized

2169

gases, Vienna 1967 (Wien '67) 170: Effect of magnetic field on the unstable, molecular negative hydrogen ions, within a high frequency electric field 3 ). W. Electricitatea. Ours aprobat de Ministerul Învâtamîntului pentru uzul studen^ilor de la facultadle de matematicä si fizicä (Bucuresti '57) 584 S.; 2 ('61) 612 S.; 6 ('62) 648 S. Annalen Physik Elektrische Ströme aus Glühkathoden in Gasen und Dämpfen von Atmosphärendruck (Bemerkung über die Arbeit von M. Ruhnke): (5) 16 ('33) 39f. Quecksilberdampflampe als Schwingungserzeuger 2 ): 20 ('34) 183-95. Annales sei. Univ. Jassy, Partie I Sur la constante diélectrique et la conductibilité des gaz ionisés 7 ): 17 ('33) 78-110. — Les gaz ionisés et le fonctionnement des lampes à grille positive: 18 ('33) 7-9. — Effet magnétique longitudinal sur les électrons à grande vitesse des tubes de Geissler: 26 ('40) 254-70. - Sur la structure de l'ion négatif. Détermination du moment magnétique nucléaire: 394-96. Buletin §ti., Acad. Republ. popul. rom âne, A Über eine neue Induktionserscheinung bei bewegten negativen Ionen'): 1 ('49) 229-40 [rumän. m. russ. u. franz. Zusammenfassg.]. Buletin çti., Acad. Republ. popul. romlne, Sec$. Çti. mat. çi fizice Die Struktur des negativen Sauerstoffions (0 2 ~) auf Grund experimenteller Untersuchungen und ionosphärischer Beobachtungen: 6 ('53) 215-38. — Die Struktur der negativenWasserstoffionen (H 2 ~) : 239-45. — Die Feinstruktur der kritischen Frequenzen in der Ionosphäre : 583-92. — Die Struktur der negativen Molekülionen von Wasserstoff (H2~) und von Sauerstoff (0 2 ~). Erklärung der kritischen Frequenzen der Ionosphäre aus den Eigenfrequenzen der negativen Sauerstoffionen: 6 ('54)339-86. — Das Aktivierungspotential der negativen Molekülionen des Wasserstoffs (H 2 ~): 919-35. — — Alle Arbeiten rumän., meist m. russ. u. franz. Zusammenfassg. Bull. Soc. roumaine Physique Distribution de vitesse des électrons dans un champ magnétique'): 37 ('36) 3-6. — Die Absorption hochfrequenter elektromagnetischer Felder in Niederdruck-Entladungsröhren: 43 ('42) 6583. Comunicärile Acad. Republ. popul. romine Absorption et émission d'énergie par les ions négatifs moléculaires d'oxygène et d'hydrogène: 11 ('61) 181-86 [rumän. m. russ. u. franz. Zusammenfassg.]. C. R. hebd. Séances Acad. Sei., Paris Les gaz ionisés dans le champ magnétique; preuve de l'existence de l'électron tournant : 194 ('32) 70-72, 404. — Les électrons libres des gaz ionisés dans le champ magnétique') : 1330-32. — Les gaz ionisés dans le champ magnétique; pressions plus petites que 10~3 mm Hg 7 ) : 195

2170

Ionescu, Theodor

('32) 765-67. — Les gaz ionisés dans le champ magnétique; pressions plus grandes que 10~3 mm Hg7) : 1008-10. — Sur l'absorption d'énergie dans les gaz ionisés8) : 196 ('33) 682-84. — Sur la décharge à haute fréquence dans les gaz8): 1292-94. — Ionisation de l'air et de l'hydrogène dans la décharge à haute fréquence8): 1873-75. — Fonctionnement du radiomètre de Crookes dans la décharge à haute fréquence: 197 ('33) 1103f. — Sur la propagation de l'énergie dans les tubes à gaz ionisés: 198 ('34) 353-55. — Nouvelle méthode pour amplifier et produire des oscillations à basse fréquence1) : 1482-84. — Sur un redresseur à gaz ionisé pour courants alternatifs de moyenne tension dans le champ magnétique1): 199 ('34) 664-66. — Sur la structure de la couche ionisée de l'atmosphère (ionosphère)7): 130103, 1693. — Sur la propagation des ondes électriques: explication des échos'): 1389-91. — Propagation des ondes électriques dans le champ magnétique terrestre7): 200 ('35) 130103. — Répartition des vitesses des électrons dans le champ magnétique'): 202 ('36) 116062. — Décharges lumineuses observées dans le champ magnétique à des pressions inférieures à 10 - 4 mm Hg: 1842f. — Sur les périodes propres des vibrations des gaz ionisés dans le champ magnétique: 203 ('36) 57-59. — Sur les propriétés d'un électron qui roule sans glisser et dont le rayon varie en raison inverse de la vitesse: 537-39. — Sur la structure du photon: 864-67. — Calcul de l'énergie émise par une antenne à l'aide de la théorie des quanta: 204 ('37) 1061-63. - Sur un nouvel oscillateur à ondes très courtes (microondes): 1411-13. — Sur le calcul de l'intervalle de temps r entre deux chocs successifs d'un électron contre les molécules de l'ionosphère: 205 ('37) 569-71, 759. - Nouvelles observations sur les oscillateurs à gaz ionisé dans le champ magnétique: 207 ('38) 54-57. — Sur le couplage d'un circuit oscillant avec un tube de Geissler: 567-69. — Sur le fonctionnement des oscillateurs à gaz ionisé dans le champ magnétique: 208 ('39) 85-88. — Sur le rayon de l'électron et le calcul de la constante photoélectrique des métaux: 210 ('40) 170-72. — Sur une théorie corpusculaire de la conductibilité électrique des métaux: 502-04. — Sur l'émission quantique en phase dans le domaine des ondes radioélectriques : 666-69. — Sur la structure de l'ion négatif. Détermination du moment magnétique nucléaire: 699-701. — La résistance de frottement des ions négatifs dans l'hydrogène: 218 ('44) 230-32. - Sur l'absorption de l'énergie par les ions négatifs : 226 ('48) 1005-07. - Sur la diffusion des ondes électriques de très grande fréquence dans l'ionosphère: 245 ('57) 520-22. — Les fréquences propres des ions négatifs moléculaires d'oxygène, comprises entre 3 et 13 MHz, observées dans des tubes à air ionisé4) : 898-901. — Sur une méthode pour l'enregistrement photo-

graphique des fréquences d'absorption des ions moléculaires négatifs d'oxygène4): 246 ('58) 2250-53. — Certains phénomènes observés lors du couplage entre un oscillateur et un tube à gaz ionisé introduit dans l'inductance de l'oscillateur4): 3598-601. — Fréquences d'absorption des ions négatifs moléculaires d'hydrogène, comprises entre 2,5 et 44 MHz4) : 250 ('60) 2182-84. — Action du champ magnétique sur la formation des ions négatifs moléculaires d'hydrogène et d'oxygène4): 252 ('61) 870-72. Sur les conditions de mesure des fréquences propres des ions négatifs moléculaires: 257 ('63) 2268-71. C. R. hebd. Séances Acad. Sci., Paris, Sér. B Sur la conductivité des gaz ionisés dans un champ magnétique3): 262 ('66) 5-7. - Sur la structure des ions moléculaires négatifs lábiles: 944r-46. — Sur une preuve directe de l'existence des ions négatifs moléculaires, labiles, dans l'espace de Faraday 3 ): 263 ('66) 896-99. — Sur quelques aspects de la décharge en courant continu due aux électrons cathodiques: 264 ('67) 1189-91. - L'effet Zeeman dans le néon, l'hydrogène et l'oxygène pour les grands nombres quantiques et pour les fréquences de 5-20 MHz») : 267 ('68) 26366.

C. B. Séances Acad. Sci. Roumanie Nouvelles observations sur la décharge électrique, dans un champ magnétique à des basses pressions: 1 ('36/37) 149-53. — Contributions à l'étude des figures de Lichtenberg5) : 319-23. Disquisitiones math, et physicae [Bucureçti] Structure des ions négatifs: 1 ('41) 491-556. . J . Physique et Radium Contribution à l'étude des gaz ionisés: (7) 5 ('34) 578-84. — Sur la constante diélectrique et la conductibilité des gaz ionisés'): 6 ('35) 35-48. — La structure de l'ionosphère et la propagation des ondes électriques courtes'): 388-96. Revue Physique [Bucureçti] La structure des ions moléculaires négatifs d'hydrogène (H2~) et d'oxygène (0~ a ). Explication des fréquences critiques de l'ionosphère à l'aide des fréquences propres des ions négatifs d'oxygène : 1 ('56) 19-62. — Ondes électriques métriques d'origine extra-terrestre: 127-35. — Etude des fréquences d'absorption, des ions négatifs moléculaires d'oxygène, comprises entre 3 et 44 MHz4): 4 ('59) 113-51. - Potentiel d'activation des ions négatifs moléculaires d'hydrogène (H 2 "): 5 ('60) 251-65. - Sur l'absorption et l'émission d'énergie par les ions négatifs moléculaires d'hydrogène et d'oxygène: 6 ('61) 197-205. - Sur le coefficient de frottement des ions négatifs moléculaires d'hydrogène et d'oxygène: 8 ('63) 347-59. Revue roumaine Physique On the gyromagnetic frequencies, multiples of the fundamental frequency, as observed beyond the

Ionescu, Theodor - — Ionescu-Matiu

2171

ionosphere: 10 ('65) 131-48 [m. franz. Zusammenfassg.]. — Absorptions of a high frequency field due to the molecular negative ions of oxygen in the 1-20 MHz frequency range 9 ) : 12 ('67) 847-63 — Correlations between ionospheric phenomena and those observed in laboratory: 13 ('68) 67-71 [ ~ ] . — Zeeman effect in nitrogen oxide, oxygen, neon and hydrogen at high quantum numbers and frequencies from 5-20 MHz»): 14 ('69) 527-45 [-]• Studii çi Cercetäri Fizicä, Acad. Bepubl. popul. romine, Bucureçti Impedanz von negative Ionen enthaltenden ionisierten Gasen und Untersuchung einiger durch diese Ionen verursachter neuer Erscheinungen: 1 ('50) 139-84 [rumän.]. — Neue Untersuchungen über das Vorhandensein negativer Ionen des Deuteriums im Wasserstoff 8 ): 3 ('52) 71-89 [rumän.]. Mit: *) 4 I. Cerkez; ! ) A. Cisman; 3) M. Comänescu; ) O. C. Gheorghiu; ') V.9Majern; •) V. P. Mihu; ') C. Mihul; ») I. Mihul; ) C. D. Ionescu.

— Une nouvelle réaction générale très sensible pour la caractérisation des peroxydes et des persels 16 ): 3 ('38) 387-90. - Préparation de charbons actifs à partir de noyaux de fruits 9 ) : 391-426. — Eine neue Reaktion zur chemischen Identifizierung der Sulfamide 9 ) 19 ) : 1947, 8-12 [rumân.].

VI

Bull. Soc. Chim. biol. La mercurimétrie et ses applications dans les analyses chimiques et biochimiques: 16 ('34) 970-92. — Application de la méthode mercurimétrique à de nouveaux produits biologiques. Le dosage de l'hydrastinine, de l'hyoscyamine, de la scopolamine, de l'ésérine et de l'apiol par la méthode mercurimétrique. Nouvelle réaction d'identité de l'apiol 1 «): 17 ('35) 671-77. - Une modification de la méthode Nicloux pour le microdosage de l'alcool éthylique. Emploi d'un indicateur 1 «): 19 ('37) 911-14. - Sur le dosage de l'acide urique dans l'urine et dans le sang par la méthode phosphotungstique et la nouvelle méthode chromométrique. Son état et ses transformations temporaires. L'influence des agents physico-chimiques 15 ): 21 ('39) 264-74. — Dosage du glutathion et des sulfures en général par la méthode volumocolorimétrique 16 ): 22 ('40) 474-80.

IONESCU-MATIU, Alexandru. Chem. (pharmaz.). — 1926-34 Prof. pharmaz. Chem. u. Galenik, Univ. Iaçi; '34-40 ord. Prof. allg. Chem., '40-47 ord. Prof. pharmaz. Chem., '47 Prof. emer., Univ. Bucureçti. — Médaille Pasteur (Soc. Chim. biol., Paris); Diplôme de Mérite (Fac. Pharm., Paris). *1883, Dez. 21, Focçani. Zum 75. Geb.tag Farmacia (Bucureçti) 7 ('59) 97 f. (m. Bildn.). S. Congrès de pharmacie à l'occasion du cinquantenaire de l'Institut de Pharmacie A. Gilkinet de l'Université de Liège, Liège 1934 (Liège '35) 128-32: Vorhandensein von Milchsäure in Borschtsch 17 ) [ ]. W. Tendin^ele chimiei în prepararea de noi medicamente (Bucuresti ['46]) 21 S. (Publ. Acad. Çti. Romînia, Ser. I I I , 15). Annales pharm, franç. Dosage de la morphine et de l'apomorphine par la méthode volumo-colorimétrique 13 ) 10 ) : 6 ('48) 26-30. — Contribution à l'étude de l'altération et de la stabilisation de la morphine et de l'apomorphine 15 ) 10 ): 137-43. Annales sei. Univ. Jassy Contributions à l'étude de l'identification et du dosage de l'alcool méthylique, en présence de l'alcool éthylique 16 ): 17 ('33) 205-15. Buletinul Soc. Çti. farmac. Eomânia Le dosage de l'hydrastinine, de la scopolamine, de l'hyoscyamine, de l'ésérine et de l'apiol par la méthode mercurimétrique. Nouvelle réaction d'identité de l'apiol 1 «): 1 ('36) 61-67. - Bestimmung von Tanninen und ihren Derivaten 1 «): 2 ('37) 38-42 [ ]. — Verwendung des Volumo-Kolorimeters bei Analysen: 80f. [ ].

Bull. Acad. Méd. Roumanie Le gaz de combat. Au point de vue chimique, industriel et national: 3 ('38) 79-102. — La microdétermination des alcools méthylique et éthylique seuls et en mélanges 1 «) 13 ): 5 ('38) 511-24. — Dosage du glutathion et des sulfures en général par la méthode volumo-colorimétrique 16 ) : 7/8 ('38/39) 385-95. - Sur le contrôle des arsénobenzols par la détermination de l'indice chromique 15 ) : 11 ('41) 249-56. — Application de la méthode volumo-colorimétrique à l'analyse des produits médicinaux 15 ) 12 ): 14 ('43) 598-606. — Les applications de la volumocolorimétrie au microdosage des alcaloïdes1«)4) : 19 ('46) 312-24.

Bull. Soc. chim. France, Mém. Le dosage des ions phosphorique et glycérophosphorique par la méthode mercurimétrique 16 ): (4) 51 ('32) 769-74. — Le dosage du chrome par la méthode mercurimétrique 5 ) : 53 ('33) 1032-38. — Le dosage des halogènes par la méthode mercurimétrique 5 ) : (5) 1 ('34) 1379-86. - L'utilisation des leucobases comme réactifs analytiques 16 ): 4 ('37) 1230-35. Chimie analyt. La volumo-colorimétrie et ses applications dans les analyses chimiques: (4) 89 ('57) 175-79. Chimie et Industrie Analyse d'amalgames 16 ): 27 ('32) No. spéc. 3bis, 162 f. — Dosage du véronal et du tannate de mercure 15 ): 542f. — Dosage des cyanures et des sulfocyanures par la méthode mercurimétrique 15 ): 29 ('33) No. spéc. 6bis, 1011-13. — La préparation des „charbons actifs" à partir des noyaux de fruits 9 ): 45 ('41) No. spéc. 3bis, 163-73.

2172

Ionescu-Matiu — Ipat'ev, Vladimir N.

Chimie et Techn. L'histoire du médicament, son évolution à travers les siècles: 5 ('58) Nr. 2, 10-18. C. R. Séances Àcad. Sei. Roumanie La préparation des „charbons actifs" à partir des noyaux de fruits 9 ) : 3 ('39) 488-96, 589-99. C. R. Séances Inst. Sei. Roumanie Contribution à l'étude des procédés chimiques et biochimiques de microdosage de l'urée. Transformation du procédé gravimétrique fosse en procédé volumétrique 11 ) : 4 ('40) 24-38. — Contributions à l'étude des tannins de l'écorce de chêne 16 ) 1 ): 5 ('41) 45-62. Industrie chim. belge Contributions à l'étude des tannins: 24 ('59) 1495-98.

Derivaten durch die merkurimetrische Methode 7 ) : 889-93. — Beiträge zum Studium der Identifizierung von Alkaloiden in Form ihrer Pikrate 8 ): 897-914. - Quantitative Bestimmung des Tannins und seiner Derivate 16 ): 36 ('37) 403-07. - Geschichte und Entwicklung der Militärpharmazie in Rumänien 21 ) 22 ) : 52631. — Studien über die Vorgänge der Wasserbestimmung in chemischen und Arzneimittelsubstanzen 20 ) : 39 ('40) 103-09, 113. Alle Arbeiten rumän., meist m. franz. Zusammenfassg.

Mit: *) C. B r a i l e n a n o ; 2) O. C o n s t a n t i n e s c u ; 3 ) A . G a r i b a l d i ; 4) A. G h i o r g h i u ; 5) S. H e r s c o v i c i ; ') E. H r i s t e s c u ; ') C. I c h i m ; ') E. I l i e s c u ; •) C. M a i o r o v i c i ; ») L. Monciu; ") P a n e a ; ") E. P e t r e s c u ; ") I. P o p a ; ") — ; ") A. P o p e s c u ; ") C. P o p e s c u ; ") M. P. Saer; ") M. S a n d o v i c i ; J. Pharm, et Chim. Dosage du véronal et du ") N. T e o d o r e s c u ; ") V. T o r j e s c u ; ") C. Cerbiitannate de mercure 15 ): (8) 15 ('32) 551-54. - l e s c u ; ") S. Dragomir.

Dosage des ions phosphorique et glycérophosphorique par la méthode mercurimétrique 15 ): 16 ('32) 471-79. - Dosage des cyanures et des sulfocyanures par la méthode mercurimétrique 16 ) : 19 ('34) 54-61. — Contribution à l'étude de l'altération des produits médicamenteux par la détermination du pH 18 ) : 21 ('35) 337-66. - Contribution à l'étude de l'identification des alcaloïdes à l'état de picrates 8 ): 23 ('36) 117-41. - Le dosage des alcaloïdes de l'opium et de leurs dérivés par la méthode mercurimétrique 7 ): 26 ('37) 49-56. — Etude expérimentale comparative sur le pouvoir réducteur des divers phénols 16 ): 27 ('38) 193-203. — Le dosage de quelques produits médicamenteux par la méthode mercurimétrique'): 28 ('38) 417-30. - Le microdosage de quelques phénols par la méthode volumo-colorimétrique 16 ) 16 ) : 30 ('39) 49-58. Le microdosage de l'alcool éthylique dans les produits pharmaceutiques. La détermination de l'indice chromique 16 ) 2 ) : 252-63. Pharmacie Gerbstoffe in verschiedenen medizinischen Präparaten 1 6 ) 6 ): 1 ('43) 294r-97 [franz.]. Produits pharm. Le microdosage des esters médicamenteux à base d'alcool méthylique ou éthylique par la méthode chromométrique 13 ) : 2 ('47) 389-91. - Application de la volumoeolorimétrie au microdosage des alcaloïdes 16 ) 4 ): 3 ('48) 295-99. — La lutte contre la douleur à travers les âges: 4 ('49) 133-36, 183-87. — Influence des médicaments chimiques organiques sur l'intensité des réactions diastasiques protéolytiques 16 ) 3 ): 525-28. — La saccharimétrie ferricyanique et la mercurimétrie : 12 ('57) 247-54. — Etude critique des procédés de détermination de l'eau dans les produits chimiques médicamenteux 20 ): 709-16. — Identification et dosage des sulfamides par l'aldéhyde glutaconique 19 ) : 16 ('61) 207-11. Revista sanit. milit. Untersuchung von Reinheit, Veränderungen und Konservierung medizinischer Präparate: 35 ('36) 858-69. — Bestimmung von Opiumalkaloiden und ihren

i v - vi IPAT'EV (Ipatieff), V l a d i m i r Nikolaevic. Chem. - 1930-35 Prof., '35 Prof. Emeritus, Northwestern Univ., Evanston, Hl.; '30- Chem. Research Dir., Universal Oil Products Company, Chicago, III. — Medaille Marcelin Berthelot (Soc. Chim. industr. de France). *1867, Nov. 21 (9), Moskva; fl952, Nov. 29, Chicago, III. Zur Biogr. B. A. B o g o y a v l e n s k y , Technique moderne 31 ('39) X I I I - X V . - W. V. E v a n s , Chemist 19 ('42) 327-31; Industrial and Engng. Chem., News Edit. 18 ('40) 493f. — C. B. M a r q u a n d , H. H. M a r q u a n d in: Great chemists (E. Färber) (New York '62) 1279-98. - D. N e w i t t , Nature [London] 160 ('47) 43 f. — Industrial and Engng. Chem., News Edit. 17 ('39) 707 (m. Bildn.). Zum 70. Geb.tag W. V. E v a n s , Chemical Bull. 24 ('37) 331-33 (m. Bildn.). - A. V. G r o s s e , Chemistry and Industry 16 ('38) 105f. (m. Bildn.); J . chem. Educat. 14 ('37) 553f.; Revue pétrolifère 1937, 1667f. Zum 80. Geb.tag B. A. B o g o y a v l e n s k y , Chimie et Industrie 58 ('47) 600-02. - Chemical and Engng. News 25 ('47) 3720f. - Chemistry and Industry 1947, 601 f. Nekr. R. L. B u r w e l l , jr., Nature [London] 171 ('53) 151 f. - J . E. G e r m a i n , Bull. Soc. chim. France, Mém. (5) 20 ('53) 351 f. (m. Bildn.). — P. M. E. S c h m i t z , Bull. Assoc. franç. Techniciens Pétrole 1953, 84f. - G. R. S c h u l t z e , E r d ö l u . K o h l e 6 ('53)40. - Chemical and Engng. News 30 ('52) 5300f. (m. Bildn.). - J . chem. Educat. 30 ('53) 110. Zum 100. Geb.tag H. P i n e s , Science [USA] 157 ('67) 166-70. Âutobiogr. The life of a chemist. Memoirs of Vladimir N. Ipatieff (X. Joukoff Eudin, H. D. Fisher, H. H. Fisher) (Stanford, Calif. - Ox-

Ipat'ev, Vladimir N.

2173

ford '46) 15+658 S. (Hoover library on war, carbures: 42 ('39) 215-22. - Catalyseurs revolution and peace, 21). — My twelve years mixtes: 45 ('41) 103-11. in t h e USA: Chemist 19 ('42) 332-41. - My Chimija tverd. Topliva Polymerisation der life in the United States; the memoirs of a Olefine aus Crackgasen 32 ) : S ('32) 707-13 chemist (Evanston, 111. '59) 200 S. [russ.]. S. C. B. 2 e Congrès mondial du pétrole, Glasn. chem. DruS. [Beograd] Neue kataParis 1937, 2 Sect. 2: Physique, chimie, raffi- lytische Methode der Kohlenwasserstoffnage (Paris '37) 455-60: Catalysis in the pe- synthese: 9 ('38) 73-88 [serb.]. troleum industry [ ]. — Atti X Congresso inIndustrial and Engng. Chem. Double deternazionale di chimica, Borna 1938, 3 (Borna composition and oxidation of inorganic com'39) 742-56: New catalytic methods for the pounds under pressure. Transformation of synthesis of hydrocarbons [ ]. heavy spar into barium carbonate 12 ) : 27 ('35) W . Kataliticeskie reakcii pri vysokich 342 f. — Catalytic polymerization of gaseous temperaturach i davlenijach 1900-1933 (Mo- olefines by liquid phosphoric acid, 1 : Propylskva-Leningrad '36) 774 S. ; engl. : Catalytic ene: 1067-69; ~ 2: Butylenes 6 ): 1069-71. — reactions at high pressures and temperatures Polymerization, a new source of gasoline6)10) : (London-New York '36) 2 2 + 7 8 6 S. - Crack- 1077-81. — Polymerization of ethylene under ing of some distillates from crude oil under high pressures and in the presence of phoshigh pressure and destructive hydrogénation phoric acid 35 ): 1364-69. — Phosphoric acid of various tars (Chicago, 111. '37) 72 S. (Uni- as catalyst for alkylation of aromatic hydroversal Oil Products Co.). carbons 36 ) 23 ) : 28 ('36) 222f. - Action of aluminum chloride on paraffins. AutodestrucAdvances Catalysis and related Subj. Alkyl16 ation of isoparaffins"): 1 ('48) 27-64. - Mech- tive alkylation ) : 461-64. — Propylene poly41 merization under high pressure and temperaanism of the polymerization of alkenes ): ture with and without phosphoric acid 35 ): 2 ('50) 21-80. 684—86. — Gasoline from ethylene by catalytic Allgemeine Öl- u. Fett-Ztg. Die Katalyse polymerization 6 ): 860-63. — Iso-octane proin der Erdölindustrie: 34 ('37) 574-76. duction by simultaneous polymerization and Ber. dtsch. ehem. Ges. Bemerkung betref- hydrogénation 23 ): 29 ('37) 958f. - Mixed fend „Neues Laboratoriumsverfahren zur polymerization of butenes by solid phosphoric Darstellung von reinem Äthylen und Pro- acid catalyst 39 ): 30 ('38) 596-99. - Olefine pylen" von P. K. Sakmin: 67 ('34) 1061. - hydrogénation. Selective hydrogénation by 6 Zu P. K. Sakmin, Zur Frage der Darstellung nickel catalyst in the presence of aromatics ) : 1039 f. — Befining gasoline with solid phosvon Äthylen. Berichtigung: 2018. 6 Brennstoff-Chem. Katalyse, die Chemie der phoric acid catalyst ): 1316f. — Catalytic gaseous paraffins 16 ): 32 dehydrogenation of Zukunft: 19 ('38) 48-51. — Isomerizing and hydrogenating splitting of hydrocarbons with ('40) 268-72. — Destructive hydrogénation aluminium chloride — hydrogen chloride, 1: of high-molecular weight polymerides. IsoPure paraffins and naphthenes. [Note to the butene polymeride,39 butadiene polymeride, article of H. Koch and W. Gilfert] 41 ): 31 ('50) and natural rubber ): 762-64. — Cracking cyclohexane. Thermal and catalytic de181. composition at high pressures 17 ): 35 ('43) Bull. Soc. chim. France, Mém. Le cuivre, 632-38. — Heptenes and heptanes from catalyseur de l'hydrogénation du benzène: propylene and butylenes 39 ): 37 ('45) 362-64. (5) 7 ('40) 281-95. — Formation catalytique de toluène à partir du benzène seul et d'un — Ethylation of benzene in the presence of mélange de benzène et de méthane 30 ): 1947, solid phosphoric acid 41 ): 38 ('46) 400-02. — 403 f. — Décarboxylation catalytique des sels Polytreating of catalytically cracked gasolines de sodium en solution aqueuse. Essai de 17 ): 1045-47. — Selective demethylation of différenciation des acides cyclopentaniques et paraffin hydrocarbons 17 ): 39 ('47) 853-57. cyclohexaniques 14 ) 35 ) : 1951, 259-68. Polymerization of pentenes 39 ) : 40 ('48) 78-80. Chemical Bull. Catalysis - the chemistry —11High-pressure laboratory flow apparatus ^J ): 2059-62. - Effect of hydrogen on the of the future: 24 ('37) 371-75. action of aluminum chloride on alkanes 41 ): Chemical and Engng. News Aviation gaso- 2354-60. — Decomposition of alcohols over line by polymerization and alkylation of nickel-kieselguhr and other catalysts 30 ) 11 ) 28 ): cracking gases: 20 ('42) 1367f. 41 ('49) 1802-05. — Low temperature hydroChemical Trade J. and Chemical Engr. High- gen production 30 ) 11 ): 42 ('50) 92-94. octane petrol: 112 ('43) 58. Industrial and Engng. Chem., Analyt. Edit. Chimica e Industria Neue Methoden der Determination of solubilities of gases at high Kohlenwasserstoff-Synthese: 20 ('38) 310 [ ]. temperatures and high pressures by the 30 Chimie et Industrie La polymérisation des rotating bomb ): 14 ('42) 166-71. - Detercritical temperatures by the mélanges de butènes 39 ): 40 ('38) 211-16. - mination of 30 Nouvelles synthèses catalytiques des hydro- rotating bomb ): 171-74. 138 Poggendorff

2174

Ipat'ev, Vladimir N.

J . amer. chem. Soc. Hydrogenation of cyclopropane; the synthesis of n- and isoaromatic compounds at temperatures close propylcyclopropane 36 ) 19 ): 75 ('53) 2311-15. — to their decomposition in presence of catalysts: Alkylation of benzene with cycloparaffins in 55 ('33) 3696-701, 5079. - The action of the presence of sulfuric acid 36 ) 6 ): 60 ('38) 577f. aluminum chloride on benzene and cyclo- — Action of aluminum chloride on cyclohexane 23 ): 56 ('34) 1926-28. - Catalysis in hexylbenzene 6 ) : 747-49. — Phosphoric acid the hydrogen bromide - define addition 36 ) 46 ): as catalyst in the ethylation of phenol 36 ) 41 ) : 2398-400. — Isomerization of normal butenes 1161f. — Reaction of isobutene and diiso3S 3 ) '): 2696-98. - Oxidation of phosphorus butene with phenol, with and without scission •with water at high temperature and pressure of C-C linkages 36 ) 13 ) : 2495-97. - Reaction of in the presence of alkali. The production of aliphatic defines with thiophenol 36 ) 13 ) : 2731phosphorous acid 44 ): 57 ('35) 300-02. - Re- 34. — Reaction of thiol compounds with action of paraffins with defines 1 6 ): 1616-21. aliphatic defines 1 3 ): 61 ('39) 71-74. - Re— Reaction of naphthenic hydrocarbons with action of paraffins with hexahydroaromatic defines 23 ) 16 ): 1722-24. — Reaction of paraffins hydrocarbons in the presence of aluminum with aromatic hydrocarbons (destructive halides36)16) : 640-43. Identification of alkylation) 16 ): 2415-19. Alkylation of phenylalkyl sulfides, sulfoxides, and sulfones 13 paraffins with defines in the presence of ) : 684-89. — Simultaneous dehydrogenationaluminum chloride 16 ) 35 ) 23 ): 58 ('36) 913-15. - hydrogenation of cyclohexene in presence of Polymerization of ethylene with aluminum nickel 8 ): 1056f. — Isomerization of alkylchloride 16 ): 915-17. — Phosphoric acid as cyclopentanes 36 ) : 1076f. — Reaction of proa catalyst for the destructive alkylation of pylene with iso-olefines in the presence of hydrocarbons 23 ) 35 ): 918f. — Influence of sulfuric acid 35 ) 13 ): 1825f. — Synthesis of sulfuric acid concentration on reaction be- tert.-butyl- and tert.-amylcyclopentane and of tween defines and benzene 6 ) 35 ): 919-22. — their intermediate products 36 ): 2728-30. — Destructive alkylation with a hydrogenating Hydrogenation of acetophenone to cyclocatalyst 2 3 ): 922 f. — Alkylation accompanying hexylmethylcarbinol in the presence of solvent depolymerization 35 ): 1056. — Alkylation of 6) : 3292. — Reaction of benzene with methylaromatics with olefines in the presence of cyclobutene and methylenecyclobutane in the boron fluoride 16 ): 2339. — The cleavage of presence of sulfuric acid35) : 3374-76. — side chains in aromatic hydrocarbons in the Catalytic hydration of acetylene and of some form of paraffins by means of aluminum alkylacetylenes 3 *) : 62 ('40) 178-80. - Prechloride 36 ): 59 ('37) 56-60. - Influence of paration and properties of some aliphatic cyclohexene concentration in the alkylation hydrocarbons 41 ) 13 ) : 2446-49. — Catalytic preof benzene by cyclohexene. Dealkylation of paration and interconversion of simple and cyclohexylbenzenes 6 ): 645-47. — „Hydro- mixed ethers 6 ): 63 ('41) 969-71. — Alkylation polymerization" 23 ): 720-22. — Identification of paraffins at low temperatures in the presof alkylbenzenes, 1: Identification of mono- ence of aluminum chloride 36 ) 16 ): 64 ('42) 33alkylbenzenes by means of the acetamino 36. — Hydrogenation of alkyl phenyl ketones derivative 41 ): 1056-59; ~ 2: Identification of in the presence of copper-alumina catalysts the eight amylbenzenes and cyclopentyl- 1? ): 520f. — Synthesis of 1,4-epoxycyclobenzene by means of their mono- and di- hexane 33 ) 36 ): 65 ('43) 2260. - Reaction of acetamino and monobenzamino derivatives benzene with butadiene in the presence of 41 ): 60 ('38) 1476-79; ~ 3: Acetamino and H 2 S0 4 and H F catalysts 35 ) 3 ") : 66 ('44) 816f. benzamino derivatives of isobutylbenzene 41 ): 65 ('43) 2470. - Dealkylation of dialkyl- — Dehydration of 1,4-cyclohexanediol. Synbenzenes 6 ): 59 ('37) 1417 f. — Isomerization thesis of 1,4-epoxycyclohexane 33 ) 35 ): 1096-99. accompanying alkylation [, 1]: Alkylation of — Studies in the terpene series, 1 : Dehydrabenzene with isopropylethylene in the presence tion of alcohols in the terpene series under of sulfuric acid 36 ) 41 ): 60 ('38) 353f.; ~ 3: pressure and in presence of dilute aqueous Alkylation of benzene with neopentyl chloride salt solutions 36 ): 1120-22; ~ 2: Hydrogen and alcohol 36 ) 41 ): 62 ('40) 2901 f.; ~ 4: Re- disproportionation of limonene 36 ) 33 ) : 67 ('45) action of cycloheptanol and cycloheptene with 694f. ; 3 : Hydrogen transfer reaction during benzene; synthesis of cycloheptylbenzene 35 ) 9 ): the dehydration of terpenic alcohols36) : 1226 f. ; 67 ('45) 2193-96; ~ 5: Reaction of 4-methyl- ~ 4: Determination of ring structure in cyclohexene with benzene in the presence of dicyclic dihydroterpenes; isomerization of hydrogen fluoride 28 ) 36 ): 72 ('50) 2772-74; pinane in presence of dilute aqueous salt ~ 6: Reaction of isobutylene and 2-butene solutions 35 ): 1931-34; ~ 5: Action of dilute with benzene 36 ) 26 ): 2850-53; ~ 7: Reaction of aqueous salt solutions on 3,3,5-trimethylbenzene with methylcyclopropane, ethylcyclo- cyclohexanol and -hex-x-ene 36 ) 33 ) : 68 ('46) propane, and with dimethylcyclopropanes 36 ) 1709f.; ~ 7: Destructive hydrogenation of " ) : 73 ('51) 4343—47; ~ 8: Reaction of benzene bicyclic dihydroterpenic hydrocarbons 36 ) 38 ) : with 2- and 3-pentanol 36 ) 1 «): 4483; ~ 9: The 69 ('47) 1948-52; ~ 8: Effect of catalyst, reaction of benzene with n- and isopropyl- solvent, and temperature on the dehydrogenation of pinane and p-menthane 36 ) 33 ) : 70

Ipat'ev, Vladimir N. ('48) 533-37; ~ 9: Isomerization accompanying cycloalkylation of benzene2)35): 72 ('50) 4260-62; ~ 10: Isomerization accompanying hydrogenolysis of alcohols13)35) : 73 ('51) 55355; ~ 11: The dehydroxymethylation of bicyclic primary terpenic alcohols by hydrogenolysis in the presence of nickel catalysts 7 ) 36 ) : 4098-101; ~ 14: Skeletal isomerization and hydrogen transfer of cyclic olefines in the presence of alumina - hydrogen chloride and silica-alumina catalysts 35 ) 33 ): 74 ('52) 487276; ~ 16: Hydrogenolysis of pinane in a flow type apparatus in the presence of hydrogénation catalysts 34 ) 36 ) : 75 ('53) 3179-81; ~ 17 : The thermal isomerization of pinane at high pressure18)35): 6222-25; ~ 18: Isomerization accompanying the dehydrogenation of 1,1,3-trimethylcyclohexane and of 1,1,3-trimethyl-x-cyclohex-x-ene36)20) : 6226-28 ; ~ 19: Hydroisomerization and hydrogenolysis of cyclohexene, methylcyclohexene and p-menthene in the presence of hydrogénation catalysts 36 ) 3 ') 4 ) : 76 ('54) 2740-42; ~ 20: The thermal isomerization of pinane at atmospheric pressure36)18) : 4412-16. — Dehydration of the lower aliphatic alcohols in the presence of dilute aqueous solutions of acids and salts m ) : 66 ('44) 1627-31. Determination of equilibrium constants for butanes and pen36 26 22 tanes ) ) ): 67 ('45) 631-37. - Reaction between benzene and butadiene in the presence of a silicophosphoric acid catalyst39)36) a»): 1060-62. - Dehydration of 2-methyl-2,4pentanediol and 4-methyl-pent-x-en-2-ol under pressure and in the presence of dilute aqueous salt solutions36): 1200-02. — p-Acetamino(/?-chloro-tert.-butyl)benzene41) : 1624. — Reaction of methylcyclopentane with olefines in presence of sulfuric acid and hydrogen fluoride catalysts 36 ): 1631-38. — p-Di(j8chloro-tert.-butyl)benzene41) : 1862. — Synthesis of methanol from carbon dioxide and hydrogen over copper-alumina catalysts. Mechanism of reaction30) : 2168-71. —Selective demethylation of paraffin hydrocarbons17): 68 ('46) 345f. — Isomerization of saturated hydrocarbons, 5: Effect of cyclohexene on the isomerization of methylcyclopentane and cyclohexane36)1) : 70 ('48) 1742-46; ~ 6: Effect of benzene upon the isomerization of methylcyclopentane36)3): 71 ('49) 749; ~ 7: Effect of light upon isomerization of methylcyclopentane in presence of AlBr 3 -HBr 36 ) 3 ) : 72 ('50) 4055 f.; ~ 8: Effect of oxygen and light upon isomerization of methylcyclopentane in presence of aluminum bromide35)3) : 4304; ~ 9: Isomerization of ethylcyclopentane, 1,3-dimethylcyclopentane, and 1,1dimethylcyclopentane in the presence of aluminum bromide; synthesis of 1,1-dimethylcyclopentane35)34): 73 ('51) 5738-40; ~ 10: Catalytic isomerization of cycloheptane35)34) : 74 ('52) 5544f.; ~ 11: Isomerization of alkylcyclopropanes and alkylcyclobutanes in the 138*

2175

presence of aluminum halide catalysts 36 ) 19 ): 75 ('53) 2315-17; ~ 12: Effect of experimental variables, alkyl bromides and light upon the isomerization of methylcyclopentane in the presence of aluminum bromide36)3) : 4775-78. — Catalytic formation of toluene from benzene and benzene-methane at high pressures30): 69 ('47) 710. — Reaction of propane with carbon monoxide in the presence of aluminum chloride36) : 1337-39. — Reactions of isopropyl alcohol in the presence of catalysts containing magnesium oxide16)36): 2888-93. — Reaction of methylcyclopentane with propene in the presence of AlBr 3 -HBr 36) : 70 ('48) 531 f. Potassium permanganate test for detection of unsaturation43)36) : 1658f. — Hydrogen transfer, 1 : Reaction of p-cymene with olefinic hydrocarbons in the presence of sulfuric acid and hydrogen fluoride catalysts 36 ) 33 ): 212328 ; ~ 2 : Reaction of diisopropyltoluene and isopropylcyclohexyltoluene with methylcyclohexene36)47) : 3859-62; ~ 3: Reaction of p-ethyltoluene and p-propyltoluene with methylcyclohexene; synthesis of diarylalkanes 35)42). 7 1 (>49) 3534_39 ; _ 4 : Reaction of pisobutyltoluene and of p-s-butyltoluene with methylcyclohexene36)42): 72 ('50) 1563-68. Destructive hydrogénation of indan and hexahydroindan36)28): 71 ('49) 2685-87. - Influence of the walls of the autoclave on the hydrogénation of p-cymene36)28) : 2934f. -Synthesisof 1,3di(tert.-butyl)benzene and l,3-di(tert.-butyl)cyclohexane7)36) : 3798f. — Composition of W-6 Raney nickel catalyst 36 ): 72 ('50) 5320f. — Reaction of m-cymene and o-cymene with methylcyclohexene in the presence of hydrogen fluoride35)42): 5521-23. - 9,9,10,10Tetramethyldihydroanthracene and 9,9,10,10tetramethylperhydroanthracene2)35): 73 ('51) 5507. — Hydrogénation of organo-tin and -lead compounds under pressure16): 7 4 ('52) 1540-42. — Investigation of the prep « ration of bromides from 1-, 2- and 3-pe-O tanol. Synthesis of pure bromopentanes36)37): 406367. — Synthesis of 2,2,4-trimethyl-4-phenylpentane and 2,2,4-trimethyl-4-cyclohexylpentane. Reactions of 2,2,4-trimethyl-4phenylpentane36)31): 75 ('53) 937-39. - Highpressure thermal reactions of propyl- and isopropylbenzene, p-cymene and s-butylbenzene. Isomerization of alkyl groups26)28) 3 6 ): 3323-26. The structure of di(methylcyclohexyl)benzenes from the cycloalkylation of 4-methylcyclohexene with benzene in the presence of hydrogen fluoride14)36): 6056f. — Synthesis of cyclobutane by the dehydroxymethylation method36)36): 6065. — Dehydro xymethylation of primary alcohols36)36) : 76 (' 54) 771 f. — Oxidative condensation of p-cyme ne, isopropylbenzene and chloroisopropylbenz ene 3s ) st6 ): 77 ('55) 343-46. Migration of double bonds in olefinic and diolefinic hydrocarbons catalyzed by sodium: Dehydrogenation of Dlimonene to p-cymene36)46): 347f.; Sodium

2176

Ipat'ev, Vladimir N-

catalyzed reactions, 2: Side-chain ethylation 171-73. — Catalysis - the chemistry of the of alkyl aromatic hydrocarbons catalyzed by future: 36 ('37/38) Nr. 29, 13f., 16. - Catalytic refining methods: 37 ('38/39) Nr. 46, sodium 36 ) 45 ): 554-59. 86-93. — Catalytic dehydrogenation process J. chem. Educat. Modern science in Russia: (gaseous paraffins to olefines)16)10)2»): 38 ('39/ 20 ('43) 159-66. - Early work on the displace- 40) Nr. 28, S. 53, 55, 56. ment of metals and metal oxides : 30 ('53) 110Organic Syntheses Cyclohexylbenzene (phe15. nylcyclohexane) 6 ): 19 ('39) 36f. J. org. Chemistry Conjunct polymerization Perfumery and essent. Oil Bee. Unter— the influence of temperature, concentration and quantity of sulfuric acid on polymeriza- suchungen in der Terpenreihe, zyklische Iso14 tion of olefines 35 ): 1 ('36/37) 464-89. - New merisation von Limonen. Strukturbeweis ) metal halide catalysts for hydrocarbon reac- 43)35). 42 ('51) 415 [engl.]. tions 16 ) : 559-66. — Reaction of cycloparaffins Petroleum [Berlin] Polymerisationsbenzin with aromatic hydrocarbons: Decycloalkyla- aus Crackgasen 10 ): 31 ('35) Nr. 29, 1-7. 16 tion ) : 2 ('37) 447-58. - Reactions of paraf- Die Katalyse in der Erdölindustrie: 33 ('37) fins with aromatic hydrocarbons, 1: Various Nr. 45, 1-5. — Katalyse - die Chemie der paraffins with benzene 1 «) 2 '): 3 ('38) 137-45; Zukunft: 34 ('38) Nr. 7, 1-4. - Mischpoly~ 2: Various aromatic hydrocarbons and merisation von Butenen durch feste Phosphor2,2,4-trimethylpentane : 448-55. — Isomeriza- säurekatalysatoren 38 ) : Nr. 24, 1-5. tion accompanying alkylation, 2: Alkylation Petroleum Engr. Polymer gasoline from of benzene with olefines, naphthenes, alcohols and alkyl halides35)41) : 5 ('40) 253-63. - cracked gases10): 6 ('35) Nr. 10, 29-32. Reaction of hexahydroaromatics with olefines Catalytic dehydrogenation process (gaseous in the presence of aluminum chloride 35 ): 6 paraffins to olefines)16)10)2»): 11 ('39) Nr. 2, ('41) 242-51. — Condensation of ketones with S. 114. alcohols in the presence of mixed catalysts 17 ) : Petroleum Times Polymer gasoline from 7 ('42) 189-98. - Alkylation of paraffins with 10 olefines. Identification of the paraffins formed cracked gases ): 33 ('35) 673-77. " ) : 8 ('43) 438-47. — Terpene series, 6 : Cyclic Proc. amer. Petroleum Inst., Sect. IQ The isomerization of limonene35)8)33)38) : 12 ('47) problem of the rational utilization of petro34r-42; ~ 12: Cyclic isomerization of limo- leum and of petroleum distillates: 17 ('36) nene ; proof of the structure of a new bicyclo- 13-16. terpene 14 ) 43 ) 36 ): 17 ('52) 272-85; ~ 13: ReRefiner and natur. Gasoline Manufacturer action of benzene and p-cymene with 2,610 dimethylbicyclo[3,2,l]-2-octene 35 ): 485-87; ~ Polymer gasoline from cracked gases ): 14 ('35) 249-54. — The problem of the rational 15: Cycloisomerization of a- and /3-pinene, a-terpineol, and 1,8-terpin hydrate 7 ) 35 ): 1431- utilization of petroleum and of petroleum distillates: 15 ('36) 481-84. — Catalytic de36. hydrogenation process (gaseous paraffins to 16 10 2 J. physic. Chem. Copper as catalyst for the olefines) ) ) »): 18 ('39) 478-85. - Mixed 8 24 catalysts for benzene hydrogénation: 19 ('40) hydrogénation of benzene ) ): 43 ('39) 589604. — Mixed Cu-Cr 2 0 3 hydrogénation 250-55. catalysts 6 ) 24 ): 44 ('40) 670-79. - Activation Revue pétrolifère Essence de polymérisaand poisoning of copper hydrogénation cata- tion fabriquée à partir des gaz de craquage 6 lysts ): 45 ('41) 431-40. - Mixed copper 10) : 1935, 791-95. hydrogénation catalysts 6 ): 440-43. Revue univ. Mines, Métallurgie, Trav. publ., National Petroleum News Polymer gasoline Sei. et Arts appl. Industrie Le problème de 10 from cracked gases ): 27 ('35) Nr. 20, 24 G - l'utilisation rationnelle du pétrole et de ses 24 M. — Dehydrogenation, polymerization, distillais : (8) 13 ('37) 343-47. hydrogénation; new catalytic process in motor Science [USA] Mixed catalysts: 91 ('40) fuel production16)10)2»): 31 ('39) Nr. 48, Refin. 605-08. Scientific apparatus and laboratory Technol., 520f. — Mixed catalysts for ben- methods.—An apparatus for the determination zene hydrogénation: 32 ('40) Nr. 32, Refin. of the solubilities of gases at high temperatures Technol., 280-82. and high pressures30) : 94 ('41) 423f. - The tri17 Oel- u. Fett-Ztg. Die Katalyse in der Erdöl- pentane process ): 98 ('43) 495f. industrie: 34 ('37) 574-76. Trans, electrochem. Soc. "True" and "conOil and Gas J. Polymer gasoline has higher junct" catalytic polymerization of olefines: blending value than pure iso-octane10) : 33 71, Preprint 27 ('37) 9 S. ('34/35) Nr. 52, 31 f., 99. - The problem of World Petroleum Catalysis offers accurate the rational utilization of petroleum and of control of hydrocarbon decomposition: 8 ('37) petroleum distillates: 35 ('36/37) Nr. 26, Nr. 11, 45-48.

Ipat'ev, Vladimir N. - - Ipat'ev, Vladimir V. Z. anorg. u. allg. Chem. Die Oxydation von Phosphor mit Wasser bei erhöhten Drucken und Temperaturen 1 2 ): 215 ('33) 388-414. Z. Elektrochem. u. angew. physik. Chem. Die Elektrolyse des Wassers unter hohem Druck 21 ) 40 ): 40 ('34) 713-24. 2. obsßej Chim. Die Reaktion der doppelten Umsetzung und der Oxydation von anorganischen Verbindungen unter Druck. Die Umwandlung von Schwerspat in Bariumcarbonat 12 ): 5 ('35) 580-82. - Oxydation von Phosphor mit Wasser bei hohen Temperaturen und Drucken in Gegenwart von Alkali. Gewinnung von phosphoriger Säure 44 ): 609-13. — Die Polymerisation von Äthylen unter Druck und in Gegenwart von Phosphorsäure 36 ): 1407-14. — Die Polymerisation von Äthylen unter hohem Druck in Gegenwart von Phosphorsäure bei 250-300° 36 ): 6 ('36) 321-26. - Die Polymerisation von Olefinen: Die Polymerisation des Propylens: 327-34. — Katalytische Polymerisation der 6 Butylene in Gegenwart von Phosphorsäure ): 335-39. — Reaktion von Paraffinen und Naphthenen mit Olefinen. Alkylierung 16 ): 423-32. - Die Alkylierung von Naphthenen mit Olefinen in Gegenwart von Katalysatoren 2 3 ) 1 6 ): 433-38. - Reaktion von Paraffinen mit aromatischen Kohlenwasserstoffen; die destruktive Alkylierung 16 ): 1514-18. — Einfluß der Konzentration der Schwefelsäure auf die Umsetzung zwischen Olefinen und Benzol 6 ) 36 ): 1519-24. - Phosphorsäure als Katalysator für die destruktive Alkylierung von Kohlenwasserstoffen 23 ) 36 ): 1525-27. — — Alle Arbeiten russ.

Mit: ») B . M . A b r a h a m ; ! ) H . R . A p p e l l ; ') E. A r i s t o f f ; «) G. M. B6; s ) R. L. B u r w e l l , jr.; •) B. B. Corson; ') G. J. C z a j k o w s k i ; s ) V. D v o r k o v i t z ; ') A. E d e l e a n u ; 10) G. E g l o f f ; ») L. E. F i s c h e r ; ") C . F r e i t a g ; ") B. S. F r i e d m a n ; ") J. E. Germain; ") L. L. G e r s h b e i n ; ") A. V. Grosse; ") V. H a e n s e l ; ") N. E. H o f f m a n n ; ") W. D . H u n t s m a n ; ") E.F. J e n k i n s ; ") S. J u r i e f f ; ") L . S . K a s s e l ; »») V. I. K o m a r o w s k y ; ") I . D . K u r b a t o v ; ") B. K v e t i n s k a s ; ") J. D. L a z e r t e ; ") J. M. M a v i t y ; ") E. E. M e i s i n g e r ; ••) J. C. Morrell; 3°) G. S . M o n r o e ; al ) R. M y e r h o l t z , jr.; ") M. S. N e m c o v ; ") R.C. Olberg; ") F. J. P a v l i k ; >s ) H. P i n e s ; ") H. G. R o d e n b e r g ; ") A. R u d i n ; 3S ) M. S a v o y ; ••) R. E. S c h a a d ; ") V. S o h i s c h k i n ; ") L . S c h m e r l i n g ; ") D. R. S t r e h l a u ; ") W . W . T h o m p s o n ; ") P. V. U s a o h e v (UsaCcv); «) J. A. V e s e l y ; ") R. C. W a c k h e r ; **) A. W e i z m a n n .

vi IPAT'EV, Vladimir Vladimirovic. Chem. (anorg., physikal.). — Bis 1925 Studium, Univ. Moskva; danach leitender Chemiker, Hochdruck- u. Hochtemperatur-Labor. d. Akad. d. Wiss. d. UdSSR; Abteilungsleiter anorg. Chem., Staatl. Hochdruck-Inst., Leningrad; Dr. d. chem. Wiss.; '38- ord. Prof. anorg. Chem., Staatsuniv. Leningrad; '53- ord. Prof. anorg. Chem., Holztechn. Akad. „S. M. Kirov", Leningrad; Laborleiter, For-

2177

schungsinst. f. Rohölverarbeitg. u. f. d. Gewinng. synthet. flüss. Brennstoffe, Leningrad. ([g]) *1897,Dez. [oder Nov. ?]25 (12), Petersburg; j-1955, Nov. 17, Leningrad. Sohn v. Vladimir Nikolaevic Ipat'ev (Ipatieff)iv-viib Nekr. 2. prikl. Chim. 29 ('56) 809f. (m. Bildn.). HZ. (Redakt.) Uc. Zap. leningr. gos. Univ. Nr. 175 (Ser. chim. Nauk, Nr. 14) ('54). S. Trudy VI Vsesojuznogo mendeleevskogo s-ezda po teoreticeskoj i prikladnoj chimii [Arbeiten des 6. Mendeleev-Unions-Kongresses für theoretische und angewandte Chemie] Char'kov 1932, 2 , 1 (Char'kov-Kiev '35) 26064: Die Bekämpfung der Korrosion von Kesseln und Hochdruckapparaturen [russ.]; 266-73: Zur Frage der Laugenbrüchigkeit 28 ) [russ.]. Ber. dtsch. chem. Ges. Löslichkeit des Wasserstoffs in Wasser unter Druck 8 ) 41 ): 65 ('32) 568-71. — Oxydation von Chromhydroxyd und Chromeisenstein durch Luftsauerstoff in Gegenwart von Alkali 29 ): 572-75. — Zur Theorie der Verdrängung der Metalle durch Wasserstoff unter Druck, 2: Abscheidung der Metalle der 5. Gruppe aus den Lösungen ihrer Chloride unter Druck 40 ): 575-79. Bjul. nauino-techn. Informacii po Rezul'tatam naugno-issled. Rabot, Leningr. lesotechn. Akad. im. Kirova Oxydation von Eisen in Schwefeldioxid bei hohen Temperaturen 2 ): Nr. 47 ('57) 16-21 [russ.]. - Kinetik der Zunderbildung auf Kupfer, das an Luft und in Schwefeldioxid erhitzt wird 16 ): 22-26 [russ.]. Chimija i Technol. Topliv i Masel Die Löslichkeit von Schwefelwasserstoff in Benzol bei hohen Drucken und Temperaturen 22 ) 31 ): 5 ('60) Nr. 1, 17f. [russ.]. Chimija tverd. Topliva Das Gleichgewicht zwischen Flüssigkeit und Gas bei hohen Drucken und Temperaturen, 2: Löslichkeit von Gasen in Erdölprodukten 2 2 ): 8 ('37) 86675 [russ.]. — Wasserstoff- und Methandiffusion in einigen Erdölprodukten bei hohen Temperaturen und hohem Druck 40 ): 113749 [russ.]. Destruktivnaja Gidrogenizacija Topliv Löslichkeit und Diffusion von Wasserstoff und Erdgasen in den verschiedenen Erdölfraktionen und einigen aromatischen Kohlenwasserstoffen bei hohen Drucken und Temperaturen 40 ) 22 ): 1 ('34) 182-91 [russ.]. Dokl. Akad. Nauk SSSR Über den Mechanismus der Verdrängung von Edelmetallen aus Lösungen ihrer Salze durch Wasserstoff unter Druck, 1: Die Verdrängung des Palladiums

2178

Ipat'ev, Vladimir V.

aus Lösungen des Palladiumchlorürs 42 ): 1935I, 622-26 [russ. u. deutsch]; ~ 2: Verdrängung von Edelmetallen aus Lösungen von H 2 PtCl 6 , H 2 IrCl 6 , Na 3 IrCl 6 und lva 3 RhCl 6 42 ): 627-32 [ ~ ] . — Über die Trennung der Platinmetalle durch Wasserstoff unter Druck 42 ): 1935 II, 29-35 [ ~ ] . — Oxydation von Eisen an der L u f t bei hohen Temperaturen 4 1 ): 94 ('54) 50508 [russ.]. — Oxydation von Eisen in Wasserdampf, Dampf-Wasserstoff- und D a m p f Sauerstoff-Gemischen bei hohen Temperaturen 41 ) 11 ): 95 ('54) 305-08 [russ.]. J. physic. Chem. Adsorption of hydrogen b y palladium black under high pressure 42 ): 38 ('34) 623-33. Metallovedenie i Obrabotka Metallov Die Oxydation von Nickel in Schwefeldioxidgas bei hohen Temperaturen 4 4 ): 1958, Nr. 12, 42-45 [russ.]. Neftjanoe Chozjajstvo Latente Verdampfungswärme der Erdölfraktionen, erhalten bei einmaliger Verdampfung 40 ) 22 ): 25 ('33) Nr. 9, 24 f. [russ.]. Trudy leningr. lesotechn. Akad. im. Kirova Oxydation von Kobalt und einer Eisenlegierung mit 13% Kobalt an der Luft 26 ) 43 ): Nr. 80 I I ('58) 47-56 [russ.]. - Ursachen für die Bildung von abblätterndem Zunder auf Stahlblechen 18 ) 12 ) 44 ): 57-64 [russ.]. Trudy, Vses. nauino-issled. Inst, nefteehim. Processov Verwendung von Phosphaten bei der Abtrennung von Schwefelwasserstoff aus Benzol, 2: Abtrennung von Schwefelwasserstoff aus einer flüssigen Propan-PropenFraktion 3 ) 7 ) 40 ): Nr. 5 ('62) 217-55 [russ.]. Ui. Zap. leningr. gos. Univ. Geschwindigkeit der Oxydation des Eisens in Luft und in Sauerstoff bei hohen Temperaturen 4 1 ): Nr. 175 (Ser. chim. Nauk, Nr. 14) ('54) 7-20. - Geschwindigkeit der Oxydation des Eisens in Wasserdampf und in Kohlendioxid bei hohen Temperaturen 11 ) 41 ): 21-35. — Geschwindigkeit der Oxydation des Eisens in Mischungen von Wasserdampf mit Sauerstoff oder Wasserstoff 41 ) 11 ): 36-51. — Mikrographische Untersuchungen der Kinetik der Eisenoxydation u 41 ) ) : 52-70. — Geschwindigkeit der Oxydation des Eisens in Schwefelwasserstoff bei erhöhten Temperaturen 19 ): 71-79. — Geschwindigkeit der Oxydation von Nickel und von Legierungen des Nickels mit Eisen an der Luft bei erhöhten Temperaturen 1 3 ): 80-87. — Zunderbildung auf den Chromstählen E 2 1, EZ 2 und E 2 4 an der Luft 25 ) 33 ): 88-116. Oxydation des Chromstahls E 2 2 durch Wasserdampf und Kohlendioxid 26 ): 117-27. — Oxydation von 6%igem Chromstahl an der Luft bei hohen Temperaturen 2 '): 128-54. — Oxydation von Chrommolybdänstahl [3,2% Cr, 0,5% Mo] in Wasserdampf und in Luft 33)39)32)41). i 5 5 f . _ Kinetik der Schlackenbildung in Eisen-Chrom-Legierungen bei

hohen Temperaturen in einer Wasserdampfatmosphäre 33 ) : Nr. 227 (Ser. chim. Nauk, Nr. 17) ('57) 5-47. — Zunderbildung auf einem 2,5%igen Nickelstahl in Luft, die Wasserdampf und Schwefeldioxid enthält 13 ) 24 ): 4858. — Zusammensetzung und Struktur des Zunders auf Eisen-Nickel-Legierungen 13 ) : 5 9 76. — Kinetik der Manganoxydation bei hohen Temperaturen in trockener Luft und in Wasserdampf- und Kohlendioxid-Atmosphären 36 ) : 77-99. — Geschwindigkeit der Zunderbildung auf Mangan-Eisen-Legierungen in trockener Luft und in einer Dampf-Atmosphäre 36 ) : 100-25. — Einfluß von Dampf und Schwefeldioxid auf die Geschwindigkeit der Eisenoxydation in Luft bei hohen Temperaturen 41 ) 14 ): 126-42. — Homogenitätsbereich von Wüstit bei 980° 41 ) 21 ): 151-62. Alle Arbeiten russ. Usp. Chim. Katalytische Hydrierung von Zwei- und Mehrstoffgemischen 22 ) 16 ): 8 ('39) 481-528 [russ.]. Z. anorg. u. allg. Chem. Diffusion der Gase in Flüssigkeiten 40 ) 8 ): 216 ('34) 66-74. 2 . chim. Promysl. Elektrolyse von Wasser unter Druck 34 ) 46 ): 1932, Nr. 3, 27-34; Nr. 4, 30-42 [beide Arb. russ.]. 2 . fiziß. Chim. Diffusion von Gasen in Flüssigkeiten unter Druck, 1 40 ) 8 ): 5 ('34) 46672 ; ~ 2 : Der Einfluß der Temperatur auf die Diffusion von Gasen in Flüssigkeiten unter Druck 40 ): 10 ('37) 712-18. - Der Druckfaktor bei der Erscheinung der Wasserstoffüberspannung 34 )») 30 ): 5 ('34) 1114-24. Das Gleichgewicht zwischen Flüssigkeit und Gas bei hohen Drucken und Temperaturen, 1 : Die Löslichkeit von Wasserstoff in individuellen Kohlenwasserstoffen der aromatischen und der Naphthenreihe 2 2 ): 6 ('35) 632-38. Kinetik der Oxydation von Eisenchlorid durch 17 20 Luftsauerstoff unter Druck ) ) : 1043-50. Untersuchungen im Gebiet überhoher Drucke, 1: Gleichgewicht zwischen der flüssigen und der Dampfphase im System WasserstoffBenzol bei Drucken bis zu 3000 Atmosphären 40)5)1). 22 ('48) 833-45. Übertragungserscheinungen in komprimierten Gasen, 1 : Bestimmung der Wärmeleitfähigkeitskoeffizienten in komprimierten Gasen (H 2 , N 2 , CH 4 , Luft und COa)38)40): 24 ('50) 166-76. Alle Arbeiten russ. 2 . obsiej Chim. Die Löslichkeit von Wasserstoff in Wasser unter Druck 8 ) 41 ): 1 ('32) 594-97. — Die Löslichkeit des Wasserstoffs und Heliums in flüssigem Ammoniak 40 ): 2 ('32) 305-10. - Über die Wasserstoffabsorption von Palladiumschwarz bei hohem Druck 42 ): 3 ('33) 78-86. - Die Löslichkeit von Wasserstoff in Wasser unter Druck bei hohen Temperaturen 40 ): 4 ('34) 395-99. — Die Verdrängung von edlen Metallen aus den Lösungen ihrer Salze durch Wasserstoff bei nor-

Ipat'ev, Vladimir V. - - Iredale malem~|Und erhöhtem Druck, 1: Die Verdrängung von Palladium aus PdCl2-Lösungen 42 ): 5 ('35) 643-52; ~ 2: Die Verdrängung von Platin aus H2PtCl6-Lösungen42): 661-66. — Über die Hydrierung von binären organischen Gemischen, 1: Hydrierung des Gemisches von Allylalkohol und Oleinsäure1): 6 ('36) 1651-58. Alle Arbeiten russ. 2. prikl. Chim. Zur Oxydationstheorie des Chromoxids durch Luftsauerstoff unter Druck in wäßrigen Lösungen42): 6 ('33) 832-38. Dmitrij Viktorovic Alekseev: 8 ('35) 186-88. — Methode zur Bestimmung der Qualität von Arsen-Soda-Lösungen, 1: Über Arbeiten auf dem Gebiete der Reinigung der Gase von Schwefelwasserstoff nach der Arsen-SodaMethode10)40)6): 26 ('53) 657-60. - Kinetik der Oxydation von Ferrosilicium in Luftatmosphäre bei hoher Temperatur27): 29 ('56) 811-18. — Oxydation von Chromsiliciumstählen an der Luft bei hohen Temperaturen 27 ): 819-28. Oxydation von Nickel in Schwefeldioxidgas bei hohen Temperaturen 44 ): 80 ('57) 1281-86. Untersuchung der Geschwindigkeit der Absorption von Schwefelwasserstoff durch Arsenat-Soda-Lösungen41) 37 ): 31 ('58) 1472-77. Untersuchung der Geschwindigkeit der Entkohlung von Rohren aus Stahl 30 ChMA in Wasserstoff23)40): 189194. — Entkohlung von kohlehaltigen Stählen durch Wasserstoff bei hohen Temperaturen und Drucken36)10): 1894r-97. - Physikalischchemische Eigenschaften von Trikaliumphosphat, l 3 ) 40 ): 32 ('59) 2392-97. - Extraktion von Schwefelwasserstoff aus einer verflüssigten Propan-Propen-Fraktion durch Kaliumphosphat in einer Gegenstromkolonne, 23)7): 35 ('62) 1715-22. Alle Arbeiten russ.

2179

Australian J. Sei. A modified form of the Allen hydrogen arc6)7): 12 ('50) 143f. J. amer. chem. Soc. Photoreaction of chlorine monoxide and hydrogen8): 59 ('37) 761. — Quantum yield in the photoreaction between methyl iodide and nitric oxide16): 68 ('46) 144f. J. chem. Physics Nuclear quadrupole resonance of some bromine and iodine compounds2) 4 ): 30 ('59) 344f. — Nuclear quadrupole and electron spin resonance spectra of some chlorine compounds including (MejPhNXFeCli)1): 34 ('61) 340f. J. chcm. Soc., London Influence of inert gases on the photodecomposition of gaseous acetone15): 1944, 588-90. — Absorption spectra of substances containing the carboniodine bond, l 7 ) 12 ): 1950, 1181-84; ~ 26): 1952, 1592-97. — Polarographic behaviour of iodo-compounds, l1»): 1951, 13-15; ~ 210): 3502-07. — Low-temperature absorption and phosphorescence spectra of some iodo-compounds9): 1953, 2959-66. — Polarographic behaviour of disubstituted benzenes. Relation of Ei's to electron densities and activa2

tion energies for electrophilic substitution10): 3226-32. — The phosphorescence spectra of naphthalene and some simple derivatives*)21): 1954, 3160-65. J. physic. Chem. The thermal decomposition of gaseous ethylene iodide18): 38 ('34) 365-76. — Kinetics of the reaction between silver perchlorate and methyl iodide19): 48 ('44) 224-30. — Thermal decomposition of ethylene iodide catalysed by iodide ions20): 49 ('45) 595-601. Nature [London] Absorption spectrum of Mit:') V. S. Artemovii; ")P. I.s Asoskova; 3)L. S. Bezdel'; ') I. F. Bogdanov; ) A. P. Brestkin; mercuric sulphide11): 133 ('34) 985. - Iso«) N. I. Brodskaja; ') B. X. Brounätejn;10 •) S. I. topes and molecular asymmetry: 138 ('36) Druiina-Artemoviü; •) I. A. Dubkov; ) M. I. Gerber; ") I. A. Gofman; ") D.Ja. Gurevii; ") 292. — Thermal decomposition of ethylene M. A. Ivanova; ") O. V. Il'inBkaja; «) A. I. bromide17): 140 ('37) 24f. — Photo-enolizaKarlblom; ") L. I. Klejmenova; ") V. A. Ko- tion of ketones: 150 ('42) 579. - Photochemmarov; ") V. A. Korbut; ") K. V. Kostrjukova; '•) D. K. Kurmanaev; ") A. G. Lagutina; '•) M. I.istry in retrospect: 154 ('44) 326f. — Methyl Levina; ") O. P. Merkulova; ") G. B. Miljuc; iodide flame bands3): 157 ('46) 229. — Anom") M. P. Morozova; ") V. F. Niiel'skij; ") G. M. alous absorption and photolysis of iodobenOrlova; ") N. M. Ostroumova; ") M. N. Platonova; ,0 ) G. A. Polev; ") N. I. Postnov; ") Ju. D. zene7)14): 164 ('49) 786. - Role of oxygen in Red'ko; ") V. V. Sibirskaja; ") V. V. Siäkin; the photolysis of iodides13): 166 ('50) 156 f. ") S. L. Skop; ••) B. K. Smirnova; ") N. F. Soboleva; ••) E. A. Stoljarov; 3») M. G. Taubina; «•)Correlation of nuclear quadrupole interaction V. P. Teodorovi 6; ") V. I. Tichomirov; ••) V. G. frequencies with polarographic half-wave poTronev; ") M. G. Vladimirova; ") D. V. Zeltu- tentials: 177 ('56) 36f. chin; ») S. I. Jur'ev. Trans. Faraday Soc. Photodecomposition of iodoform and the alkyl and alkylene io™ IREDALE, Thomas. Chem. (phy- dides11): 32 ('36) 571-76. - The photoreaction sik.). — 1927-47 Lecturer, '47-62 Eeader, of hydrogen iodide and methyl iodide23): 33 Univ. of Sydney, New South Wales. ('37) 800-05. — The influence of nitric oxide *1897, Juni 11, Castle Hill, New South on the photodecomposition of methyl iodide: Wales, Australien. 35 ('39) 458-63. — Emission bands from the discharge in carbon tetrabromide Australian J. appl. Sei. A method for the electrodeless vapor7): 44 ('48) 806-08. — The electronic detection of photoelectric emission from hy- states of monohalogen-substituted naphthadrocarbons6): 4 ('53) 329-34. lenes22): 56 ('60) 1719-31. - Nuclear quadru-

2180

Iredale

Irvine

pole spectra of iodine, iodic acid, and carbon tetrabromide 2 ): 62 ('66) 1370-77. Z. physik. Chem., Abt. B Die Absorption der Halogenderivate des Methans im nahen Ultraviolett und ihre Dissoziationsenergien: 20 ('33) 340-44.

Soc. 75 ('53) 253-56 (m. Bildn.); Yearb. roy. Soc. Edinburgh 1951/62 ('53) 22-24. - J . B e a d , J . chem. Soc., London 1954, 476-91; Nature [London] 170 ('52) 13 f.; Obituary Notices Fellows roy. Soc. London 8 ('52/53) 459-89 (m. Bildn., Faks. u. Schr.verz.). Mit: ») C. D. A k o n ; ») D. S. A l d e r d i c e ; 3) R. C. Chemical and Engng. News 30 ('52) 3030. — B l a k e ; •) R. J. C. B r o w n ; •) 8D. J. C a r s w e l l ; •) Chemistry and Industry 1952, 564.

T. M. D u n n ; ') uR. A. Durle; ) T . G . E d w a r d s ; •) J. F e r g u s o n ; ) E. Gergely; ") K. E. G i b s o n ; ") J. M. S. J a r v i e ; ") S. H a e o b i a n ; ») A. H. K i n g s b u r y ; ") L . E . L y o n s ; ") E . R . McCartn e y ; ") A. Maccoll; ") L. W. O. Martin; ») M. F. R e d i e s ; ») T . R . S t e p h a n ; ") J . A . T a y l o r ; ") J. W. W h i t e ; »•) D. S t e p h a n .

iv-vi IRVINE, Sir J a m e s Colquhoun. Chem. — 1920 Principal, '21-52 ViceChancellor, Univ. of St. Andrews, Scotland; '20-44 Chairman, Scottish Univ. Entrance Board; '25-31 Chairman, Advisory Council of the Scottish Education Departm.; '27-29 Chairman, Adult Education Committee for Scotland; '27-39 Chairman, Forest-Products Res. Board of the Departm. of Scientific and Industr. Research; '36 Chairman, the Viceroy's Committee on the Indian Inst, of Sei.; '44 Chairman, Committee on Higher Education in the West Indies; '46-51 Chairman, Inter-Univ. Council on Higher Education in the Colonies. — '22 Pres., Sect. B of the British Assoc. for the Advancem. of Sei.; '22-25 Vice-Pres., Roy. Soc. Edinburgh. — Further honorary degrees [cf. Pogg. VI]: '35 Hon. LL.D. (Columbia Univ. in the City of New York); '35 Hon. LL.D. (New York Univ.); '38 Hon. D.C.L. (Oxford Univ.); '44 Hon. D.Sc. (McGill Univ., Montreal, Que., Can.); '47 Hon. LL.D. (Univ. of Wales, Cardiff, Wales); Hon. LL.D. (Union College, Schenectady, N.Y.). — '25 Davy Medal (Roy. Soc. London); '26 Willard Gibbs Medal (Amer. Chem. Soc.); '28 Elliott Cresson Medal (Franklin Inst., Philadelphia, Pa.); '33 Longstaff Medal (Chem. Soc. London); '40 Gunning Victoria Jubilee Prize (Roy. Soc. Edinburgh). *1877, Mai 9, Glasgow; tl952, Juni 12, St. Andrews, Schottland.

W. Citizenship in a scientific age (Sackville, N. B. '37) 12+77 S. (Josiah Wood lectures, 1935). — Dedication of Elmer Ellsworth Brown House for English Studies (New York '38) 20 S. - The chair of chemistry in the United College of St. Salvator and St. Leonard. Centenary lecture (Edinburgh '41) 27 S. — The academic burden in a changing world. P. J . Anderson memorial lecture (Aberdeen '42) 15 S. (Aberdeen Univ. studies, 119). — The aim and the end; being lectures and addresses (Edinburgh-London-New York '56) 11+313 S. (m. Bildn.). Annual Rev. Biochem. The chemistry of carbohydrates and the glycosides8): 4 ('35) 59-78. Chemistry and Industry Molecular structure of polysaccharides: 10 ('32) 263. — Rewards and fairies: 16 ('38) 382-86. - The late professor G. G. Henderson 1 ) 2 ) 3 ) 6 )') 9 ) 13 ) 16 ): 20 ('42) 472. J. amer. chem. Soc. A possible source of error in determining the constitution of diand polysaccharides 1 ): 54 ('32) 356-63, 2567f. — Further attempts to synthesize sucrose 14 ): 1079-85. — Heptamethylsucrose: a correction 14 ): 1486-91. — Synthesis of 2.3.6-trimethylglucose 11 ): 1491-95. — The methylation and constitution of inulin 8 ): 55 ('33) 1988-94. — The constitution of isosucrose10): 57 ('35) 1411-14. J. chem. Soc., London George Gerald Henderson (1862-1942) 12 ): 1944, 202-06. J. Franklin Inst. Dedication of the Benjamin Franklin memorial lectures. Benjamin Franklin in St. Andrews: 226 ('38) 271-79. Nature [London] Molecular structure of polysaccharides: 129 ('32) 470f. — Isomerism of sucrose and iso-sucrose10): 134 ('34) 143.

Obituary Notices Fellows roy. Soc. London Gilbert Thomas Morgan: 3 ('39/41) 355-62. George Gerald Henderson: 4 ('42/44) 491-96. — Earl Baldwin of Bewdley: 6 ('48/49) 3-5. Proc. roy. philos. Soc. Glasgow Citizenship in a scientific age: 70 ('45) 1-12. Becueil Trav. chim. Pays-Bas The interconversion of simple sugars 8 ): 57 ('38) 575-81. Scots Mag. Crabbed age and youth: Zur Biogr. Chemistry and Industry 10 ('32) 1948, Febr.-H. 876f. (m. Bildn.). Mit: ») A. D a v i d s o n ; s ) I. M. H e i l b r o n ; 3) W.M. u m s d e n ; ') R. P. Mc Glynn; •) B. G. M c L e l l a n ; Nekr. E. L. H i r s t , Advances Carbohy- L •) T . N . M o n t g o m e r y ; ') Wm. R a l s t o n ; ') G.J. drate Chem. 8 ('53) X I - X V I I ; J . amer. chem. R o b e r t s o n ; •) J. R o g e r s ; ») D. R o u t l e d g e ; ")

Irvine - - Isbell J . K . R u t h e r f o r d ; " ) J . L. S i m o n s e n ; " ) S t e e d m a n ; " ) E . T. S t i l l e r ; » ) P . T a i n s h .

G.

YI ISBELL, Horace Smith. Chem. (org.). — 1927-57 Research Chemist, '57- Chief, Organic Chem. Sect., U.S. National Bureau of Standards, Washington, D.C.; '68- Senior Research Scientist, Dept. of Chem., American Univ., Washington, D.C. — '50 Meritorious Service Award (U.S. Departm. of Commerce); '51 Hillebrand Award (Amer. Chem. Soc., Washington Sect.); '52 Alumni Award for Distinguished Service (Univ. of Denver, Colo.); '54 Hudson Award (Amer. Chem. Soc., Division of Carbohydrate Chem.). *1898, Nov. 13, Denver, Colo.

Zur Biogr. Capital Chemist 1952, Marz-Nr., 67-71 (m. Bildn.). — Chemical a n d Engng. News 30 ('52) 1112 (m. Bildn.); 32 ('54) 3827. S. Tritium in t h e physical and biological sciences. Proc. Symposium on the detection a n d use of tritium in the physical and biological sciences, Vienna 1961, 2 (Wien '62) 9 3 101: Utilization of tritium and carbon-14 in studies of isotope effects 10 ) 37 ) [m. engl., franz., russ. u. span. Zusammenfassg.]. — Methods in carbohydrate chemistry (R. L. Whistler, M. L. Wolfrom) 1 (New York '62) 127-30: aL-Galactose 10 ); 135 f.: D-Gulose; 145-47: a-DMannose 10 ); 157-59: D-Talose 40 ); 273-75: Branched-chain higher sugars 2 '); 276-80: "C-labeled sugars: a-D-Glucose-l- 14 C 14 ) 10 ); 281-85: D-Glucose-6- 14 C a n d L-idose-6- 14 C derivatives 2 9 ); 409-19: Isotopic methods of analysis 1 0 ); 524-34: Optical rotation 3 8 ) 1 0 ); 2 ('63) l l f . : Aldonic acids: F r o m aldoses b y hypoiodite oxidation; calcium 2,3-0-isopropylidene-D-lyxonate dihydrate 2 9 ); 13f.: ~ : B y oxidation of aldoses with bromine; lead D-xylonate; 14 f.: —: B y electrolytic oxidation of aldoses; calcium D-gluconate dihydrate 1 0 ); 16-18: Lactonization of aldonic acids; D-glucono-l,5-lactone, D-glucono-1,4lactone, and lactobiono-l,5-lactone 1 0 ); 5 ('65) 249f.: Molecular weight determinations: Determination of reducing end-groups b y reaction with 14 C-labeled cyanide. Analytical Chem. Preparation a n d analysis of carbon-14-labeled cyanide 2 3 ): 29 ('57) 39396. — Micromethylation of polysaccharides 10 ) 4)20)44). 1523-28. - Structural analysis of clinical dextrans b y periodate oxidation and isotope dilution techniques 2 3 ): 1862-66; 30 ('58) 957. — Determination of reducing sugars a n d reducing end groups in polysaccharides b y reaction with carbon-14-labeled cyanide 2 3 ): 1975-78; 3 1 ('59) 139. - Absence of a n isot o p e effect in t h e fractional recrystallization

2181

of a-D-glucose-l-t 10 ) 14 ) : 38 ('61) 225f. - Determination of isotope effects b y "double labeling". Oxidation of D-glucose with iodine 3 ') 1 0 ): 34 ('62) 982-84. - Isotope effect in the recrystallization of D-mannose-l-t phenylhydrazone 46 ) 33 ) 19 ) 37 ): 1753-55. Annual Bey. Biochem. Chemistry of t h e carbohydrates and glycosides: 9 ('40) 65-92. — Chemistry of the carbohydrates: 12 ('43) 205-32; ~ 1 0 ) : 22 ('53) 107-24. Bur. Standards J. Res. The preparation of crystalline methyl-D-gulosides b y means of coordination compounds with calcium chloride: 8 ('32) 1 - 8 . — The course of the oxidation of the aldose sugars b y bromine water 1 5 ): 327-38. — Manufacture of calcium gluconate b y t h e electrolytic oxidation of dextrose 1 0 ) 1 ): 571-77. - A s t u d y of t h e mutarotation and hydrolysis of glycosyla- VI IZGARYSEY, Nikolaj Alekseeviô. mines 10 ) : 72 ('50) 1043 f. — Observations on the forms of allose and its phenylosazone 46 ) 30 ) 16 ): 76 ('54) 5816f. - Synthesis of maltose- 1- 14 C, v V I ISHIHARA, [nicht Ishiwara wie in maltobiono-•) N. ") K. Yagi; ">) T. Yamaguchi; ") I. phite, 1: The solubility and the transition Watanabe; Yamaryo; ") Sh. Yamazaki; ") T. Yoshida; ") point of ammonium sulphite 23 ): 201-19; ~ 2: K. Yoshimura; «•) H. Haga. Equilibrium in the system ammonium sulphite — ammonium sulphate - water 23 ) : 220-34 ; ~ 3: Equilibrium in the system S 0 2 - N H 3 - H 2 0 8 ) : ™ ISHIKAWA, Seiichi. Chem. (org.). 235-43; ~ 4: Heat of solution of ammonium — 1930 D.Sc., Tohoku Imperial Univ.; sulphite and bisulphite 23 ) : 244-48. — Thermo- '38-50 Prof., Tokyo Univ. of Educat.; dynamic studies of mercurous bromide 34 ): '51-65 Prof., Jissen Women's Univ.; '66249-62. — Thermodynamic studies of cadmium bromide 34) : 263-87. — On the equilib- 68 Pres., Ichimura Gakuen Junior College. rium in the reduction of silver chloride by — '68 Third Order of Merit with the hydrogen 36 ): 393-406. - Studies of fluorine, Order of the Sacred Treasure (Minister of 1 2S ): 1155-62; ~ 2: Reactions of oxygen fluoride with water and solutions of sodium Education). *1889, Jan. 12, Hamamatsu, Shizuokahydroxide 23 ) 8 ): 23 ('34) 431-48; ~ 3: On the stability of oxygen fluoride 27 ): 24 ('35) 91-97; ken. — 4: On the reactions between oxygen fluoride 31 Annual Rep. Studies, Jissen Women's Univ., and some inorganic salt solutions ): 98-106. dornest. Sci. Studies on the Kreis — Studies of the system cadmium bromide - Natur,3:and Kreis test for substances related to ethyl alcohol 21 ) 23 ): 22 ('33) 1163-78. - Studies test, of vitamin A 4 ) 13 ): 3 ('55) 1 - 3 ; ~ 4: of reactions between chlorine and solid car- synthesis Peroxide values of aldehydes 8 ): 4-8; ~ 5: bonates, 1: Reaction between chlorine and Comparison among tests of rancidity in fats 23 8 sodium carbonate ) ): 1179-96; ~ 2: Reoils62)18): 4 ('57) 1-4; ~ 6: Indole, Kreis, actions between chlorine and carbonates of and thiobarbituric acid tests 30 ): 5 ('58) 5-9. — potassium, lithium, and magnesium 8 ): 1197- and F a t t y acid components of glycerides in the 206; ~ 3: The velocity of decomposition of distillate the molecular distillation of sodium and potassium perchlorates 8 ) : 1207-28. shark liverfrom oils26): 1-4. — — Alle Arbeiten ja— Thermodynamic studies of sodium bromide pan. and potassium bromide 30 ): 23 ('34/35) 103-14. — Studies of cuprous iodide and cuprous broBull. Inst, physic, and chem. Res. [Tokyo] mide cells with reference to the potential Melting points of hydrocarbons, 1: Melting 40 difference between copper and its amalgam ) point formula for normal paraffins 36 ): 22 ('43) 23 ): 115-28. — On the adsorption of water va- 360-66. — Composition of lubricating oil for pour by magnesium oxide26) : 129-38. — Ther- airplane motors, 1: Average molecular weight modynamic studies of thallous bromide 33 ): and structure of Texaco airplane oil No.120 46 ):

2186

Ishikawa, Seiichi

596-604; ~ 2: Partial condensation of Texaco airplane oil No. 12044)47): 28 ('44) 319-27. Synthesis of branched long-chain hydrocarbons, 1: Synthesis of 2,6,15,19-tetramethyl9,12-bis(l,5-dimethyIhexyl)eicosane 36 ) 10 ) : 22 ('43) 769-74; ~ 2: Synthesis of 17,18-dibutyltetratriacontane 65 ): 23 ('44) 47-51. - Synthesis of lubricating oil from alcohols, 1 : Lubricating oil from cetyl alcohol 28 ): 22 ('43) 854-60; ~ 2: Dehydration of cetyl alcohol and polymerization of resulting olefines28)16) : 23 ('44) 373-81. - Synthesis of alkylnaphthalenes, 1: Composition of a fat splitter 42 ): 22 ('43) 903-07; ~ 2: Synthesis of butylnaphthalene from naphthalene and butanol: 90812; ~ 3: Synthesis of butylnaphthalene from naphthalene and butyric acid 1 ) 5 ): 23 ('44/47) 196-201. — Synthesis of esteric lubricating oils, 2 : Synthesis of oleyl alkyl phthalates 47 ) : 292-95. — Synthesis of lubricant from squalene, 1 : Polymerization of squalene with aluminium chloride 47 ): 431-39. — Synthesis of lubricating oil from natural rubber, 1 : Depolymerization of latex 47 ): 512-16; ~ 2: Decomposition distillation of latex 47 ): 24 ('47) 18-24. — — Aile Arbeiten japan. Rep. sci. Res. Inst. [Tokyo] Synthesis of branched long-chain hydrocarbons, 3: Catalytic reduction of citronellal and synthesis of 2,6,11,15-tetramethylhexadecane 11 ): 24 ('48) 113-17. — Perkin reaction, 5: Reaction between enanthole and acetic anhydride 37 ) : 18284 ; ~ 6 : Reaction between benzaldehyde and acetic anhydride 31 ): 28 ('52) 307-09; ~ 7: Reaction between anisic aldehyde and acetic anhydride 31 ) : 310-12. — Synthesis of lubricating oils from fatty acids4')14)63)58)67): 24 ('48) 239-43. — Synthesis of lubricating oils from squalene, 2 : Polymerization of squalene with boron-fluoride 50 ): 244—46; ~ 3: Polymerization of squalene and its partially reduced products with active clay 47 ): 398-400; ~ 4: Copolymerization of squalene and its partially reduced products with mono-olefines 47 ) : 40104. — Diffusion-pump oils, 1 : Average molecular structure and distillation of hydrocarbon diffusion-pump oils 11 ): 25 ('49) 42-45; ~ 2: Synthesis of hydrocarbon diffusion-pump oils 11 ): 46-49; ~ 3: Synthesis of diffusionpump oils of ester series 12 ): 26 ('50) 29598. — Aldehydic perfumes, 6: Synthesis of so-called C 16 -aldehyde and its homologs6«): 170-74. — Ketonic perfumes, 3: Synthesis of C-dimethyl-y-caprylolactone and 2-isobutyl-4-methyl-2-cyclopenten-l-one 49 ) : 25861. — Natural graphite, 1 : Purification 7 ) : 27 ('51) 482-85; ~ 2: Preparation of colloidal graphite 7 ): 28 ('52) 313-15. - Synthesis of compounds related to vitamin A, 1: 3-Oxo1-butanol 48 ) 34 ) : 45-49. - Synthesis of acetylenic perfumes, 1: Butyl- and isoamylacetylene-carboxylates 56 ) : 50-54; ~ 2: Methylheptyne-carboxylate 5 ') : 257 f. — — Allé Arbeiten japan.

J. ehem. Soc. Japan, Industr. Chem. Sect. Molecular distillation of sperm blubber oil40)19): 52 ('49) 21 f. - Studies on vitamin A, D and related substances by molecular distillation, 3: Analytical distillation of vitamin A in the whale liver oil40)46): 22 f.; ~ 6: Molecular distillation of elm seed oil and analytical distillation of xanthophyll 6 ): 53 ('50) 166. — — Alle Arbeiten japan. J. chem. Soc. Japan, Pure Chem. Sect. Capric acid and its derivatives, 1: Constituents of the Manchurian wild elm seed oil 47 ): 70 ('49) 381-84; ~ 2: Syntheses of a-phenoxyand a-naphthoxycapric acids 2 ) 47 ): 442-44. — — Beide Arbeiten japan. Köryö Synthesis of methylional: Nr. 3 ('48) 7-11. — So-called C 16 -aldehyde, strawberry aldehyde and its homologs6«): Nr. 13 ('50) 2 8 30. — Syntheses of acetylenic perfumery. Synthesis of heptynecarboxylic acid methyl ester5«): Nr. 33 ('54) 14f. Alle Arbeiten japan. Science Rep. Tokyo Bunrika Daigaku, Sect. A Untersuchungen über die Perkinsche Reaktion, 1: Über die erste Phase der Perkinschen Reaktion 26 ): 1 ('34) 289-96; - 2: Über die Kondensation von /J-Methylcrotonsäureanhydrid mit Aldehyden 22 ): 297-305; ~ 4: Über die Kondensation von Carbonsäuren mit Aldehyden 61 ): 3 ('37/40) 231-37. - Untersuchungen über organische Schwefelverbindungen, 2: Über die Wirkung von Ozon auf Thioamide und Thioanilide 23 ): 2 ('34) 17-26. — Kondensation von Alkoholen mit Benzol in Gegenwart von Aluminiumchlorid 33 ): 3 ('37/40) 157-64. - Synthese der Äther des Eugenols und Isoeugenols 29 ): 165-71. — Synthese der aldehydischen Isomeren des Methyljonons 32 ): 173-79. — Über die katalytische Synthese von Anisol und p-Kresolmethyläther 29 ): 249-55. — Untersuchungen über die aldehydischen Riechstoffe, 2: Synthese von Pelargonaldehyd 35 ): 257-63; ~ 3: Synthese von /?-Oxypelargonaldehyd 41 ): 287-89; ~ 4: Synthese von T. Matsuura; ") G. Mayeda; ") K. Mihara; ") A. (R.) Miyata; "•) T. Motoda; ") S. Moyamoto; «) - ; »•) E. Okamoto; 40) Y. Omote; ") T. Sakurai; ") K. Sano; ") - ; ") M. Shimada; ") S. Shimada; ") Y. Soma; ") A. Someno; ") - ; ") K. Suga; ») M. Takeda; ") H. Takeuchl; ") K. Terasaki; •') A. Tomonari; ••) T. Tosimitu; ") M. Tsutsui; «•) E. Yamamoto; ") M. Asai; ") A. Kaneko; '•) Y. Tsuruoka; •") H. Endo; •') A. Hida; •') T. Soma.

n ISHIKAWA, Tetsuya. Chem. (physik.). — 1922-36 Advanced student, Inst, of Physic, and Chem. Research, Tokyo; '28- Member of the staff, Physico-Chem. Industries Co., Tokyo; '37-41 Dir., Ohtaki Natural Gas Co., Tokyo; '41-45 Dir., Japan Special Salt Manufacture Co., Tokyo; '51-57 Prof., Junior Commercial College of Nagasaki Prefecture, Sasebo; '57-63 Prof., Junior Commercial College, Nagasaki Univ., Nagasaki; '63Prof., Seinan Gakuin Univ., Fukuoka. *1895, Okt. 14, Osaka.

2187

the intrinsic viscosity of polymers: 33 ('60) 256-58. — An analysis of Ishikawa's equation of state as applied to the critical region of isopentane 3 ): 34 ('61) 1329-34. — Supplementary note on the author's equation of state: 35 ('62) 1895f. J. ceram. Assoc. Japan By-product gypsum from salt manufacture used for ceramic molds 2 4 6 ) ) ) : 59 ('51) 187-91 [ ]. J. chem. Soc. Japan (Pure Chem. Sect.) The new iodine manufacturing industry in J a p a n : 63 ('42) 164-82. — Dissolving process of solutes: 64 ('43) 1467-79,1495-502; 65 ('44) 55763, 782-88, 788-93. - Density of aqueous solution of hydrating salts: 69 ('48) 1 - 3 ; 72 ('51) 385-90. Alle Arbeiten japan. J. Soc. chem. Industry, Japan A contribution to the origin of petroleum from a study of the brines from oil fields in Japan 1 ) : 35 ('32) 1419-26 [japan.; engl.: Suppl. Binding S. 568 B f . ] . Mit: ») T. Baba; «) H. Hiroo; ') M. Ikeda; «) Y. Miyazaki; *) I. Tanida. VI

ISHIMOTO, Mishio. Geophysik. Since 1925 Member, '28-40 Prof, and '33-39 Dir. of the Earthquake Research Inst., Tokyo Imp. Univ.; '38 Exchange Prof, in Italy; Vice-Chairman of the Division of Geophysics, Nation. Research Council of Japan. — Award (Imp. Acad, of Japan). S. Complete books of inorganic chemistry *1893, Sept. 17, Tokyo; [japan.] 3 (Tokyo '58) 234-38, 254-69: tl940, Febr. 5, Tokyo. Industrial methods of iodine recovery [japan.].

W. The theory of viscosity of liquid mixtures [japan.] (Tokyo '68). Bull. chem. Soc. Japan The fish oil theory of the origin of petroleum from a study of brine waters from widely different oil fields in Japan 1 ): 7 ('32) 362-73. - A viscosity formula for binary mixtures, the association degrees of constituents being taken into consideration, 7: 8 ('33) 280-92; 9('34) 61; ~ 8: 8 ('33) 293-96; ~ 9: 9 ('34) 155-61; ~ 10: The viscosity of aqueous solutions of electrolytes 1 ): 10 ('35) 153-67; ~ 11: 248-52; ~ 12 1 ): 11 ('36) 8-18; ~ [13 i] 1 ): 64-101. The viscosity of mixed salt solutions: 12 ('37) 16-24. — Ideal mixture law for viscosity: 25 ('52) 38-40. — An equation of state in analytical form: 26 ('53) 78-83; ~ 3 ) : 516-18; 27 ('54) 226-28, 570-74. - Application of the new equation of state to the Joule-Thompson effect: 26 ('53) 529-31. - Constancy of s in the new equation of state: 28 ('55) 89f. — New equation of state as applied to the critical region: 515-18. — Ideal mixture law for viscosity: 31 ('58) 524-29. — Viscosity of ideal solutions: 791-96. — Solvent effect on

Nekr. B. T a k a h a s i , Bull. Earthquake Res. Inst., Tokyo imp. Univ. 18 ('40) Nr. 2, 4 S. [engl. u. japan.] (m. Bildn., Faks.). — Disin 12 ('40) Nr. 3, 1-14 [japan.] (m. Bildn., Paks.). Bull. Earthquake Res. Inst., Tokyo imp. Univ. Comparaison accélérométrique des secousses sismiques dans deux parties de la ville de Tôkyô: 10 ('32) 171-87. - Existence d'une source quadruple au foyer sismique d'après l'étude de la distribution des mouvements initiaux des secousses sismiques: 449— 71. — Echelle d'intensité sismique et accélération maxima: 614-26. — Détermination de la limite perceptible des secousses'): 11 ('33) 113-21. — La déformation de la croûte terrestre et la production des ondes sismiques au foyer: 254-74. — Construction d'un sismographe accélérométrique pour la composante verticale: 717-23. — Construction d'un appareil analyseur en fréquence et son application aux inscriptions sismographiques 4 ): 12 ('34) 19-34. - Observations accélérométriques des secousses sismiques dans les villes de Tôkyô et Yokohama, 1: 234-48

2188

Ishimoto — Ising

[japan, m. franz. Zusammenfassg.]; — 2: 13 ('35) 592-607 [ ~ ] . — Analogie des secousses sismiques aux mouvements de l'eau dans un bassin: 12 ('34) 706-10. - La diffusion des secousses sismiques dans la couche superficielle du terrain: 13 ('35) 130-36. - Observation des périodes prédominantes dans les secousses sismiques à Dewa-mura et à Hamamatu-tyô : 14 ('36/37) 240-47 [japan. m. franz. Zusammenfassg.]. — Construction d'un microsismographe mécanique: 248-58. — Expériences sur le sol 2 ): 534-42 [japan. m. franz. Zusammenfassg.]. — Etudes statistiques sur les séismes observés à Tôkyô depuis 1876: 610-15 — Determination of elastic constants of soils by means of vibration methods, 1: Young's modulus 2 ): 632-56; ~ 2: Modulus of rigidity and Poisson's ratio: 15 ('37) 67-86. — Observations des périodes prédominantes dans les secousses sismiques dont la distance épicentrale est assez grande: 536-43 [japan. m. franz. Zusammenfassg.]. — Observations sur les secousses d'une petite amplitude: 697-705. — Construction d'un microsismographe mécanique pour la composante verticale 2 ) 5 ): 17 ('39) 144-50. Observations sur les séismes enregistrés par le microsismographe construit dernièrement, l 2 ): 443-78 [japan. m. franz. ZusammenfasBg.]. Bull. Earthquake Res. Inst., Tokyo imp. Univ., Suppl. Vol. The Tunami considered as a phenomenon of sea-water overflowing the land 1 ): 1 ('34) 17-24. Contemporary Japan Seismology in J a p a n today: 2 ('33/34) 94-103. Disin On the deformation of the earthcrust: 8 ('36) 181-87 [japan.]. - The earthquake faults and the movements of crustal blocks: 9 ('37) 350-54 [japan.]. J. Geography [Tokyo] Some problems concerning the median line of the structure of Japan 7 ) 3 ): 49 ('37) 23-34 [japan.]. Japanese J. Astron. and Geophysics Preliminary notes on the Tunami of March 2, 1933 [G. M. T.] and an outline of the investigations now being made concerning it at the Earthquake Research Institute: 11 ('33) 1-9. Proc. imp. Acad., Tokyo Sur le mécanisme de la production des ondes sismiques au foyer : existence d'une source quadruple au foyer: 8 ('32) 36-39. - Caractéristique de la faille sismique et la cause de sa production: 15 ('39) 36-38. Mit: *) T. Hagiwara; ') K. Iida; ") T. Kato; 4') M. Kimura; •) Z. Kinosita; ') M. Ootuka; ) K. Watanabe. V VI

ISHIWARA, Jun HABA, J u n

Y VI

VI

ISIHARA, Tomimatu. Chem. (Metallurg.). — 1921-26 Assist. Prof., '26- Prof., Töhoku Imperial Univ., Sendai; '23-39 Guest Research Worker, Research Inst, for Iron, Steel and other Metals, Sendai; '39-46 Pres., College of Technol., Morioka; '51-53 Prof., Research Inst, of Mineral Dressing and Metallurgy, Töhoku Univ., Sendai. *1889, Juli 26, Furukawa, Miyagi; tl957, Sept., Sendai. Bull. Bes. Inst. Mineral Dressing and Metallurgy, Töhoku Univ. Grundlegende Untersuchungen über die metallurgische Behandlung von Manganerzen, l 2 ): 8 ('52) 77-81; ~ 2: Über die thermische Dissoziation von Mangancarbonat 2 ): 83-87; ~ 3: Einige Versuche mit Manganferrit 2 ): 197-203; ~ 4: Untersuchungen über die elektrolytische Abscheidung von Mangan 1 ): 205-12; ~ 5: Kathodisches Potential und kritische Stromdichte bei der elektrolytischen Abscheidung von Mangan 1 ): 9 ('53) 1 - 7 ; ~ 6: Sulfatisierendes Rösten "von Mangandioxid 2 ): 17788; ~ 7: Prüfungen der Stabilität des Elektrolyten 1 ): 189-99. — Über den Dissoziationsdruck von Pyrit 6 ): 8 ('52) 189-96. Alle Arbeiten japan. m. engl. Zusammenfassg. Einzoku no Kenkyu The polarization potential of zinc deposited from aqueous solutions 3 )«): 9 ('32) 244-78 [japan, m. engl. Zusammenfassg.]. — The effect of the addition of some colloidal substances on the polarization potential in the electrodeposition of zinc from aqueous solutions of zinc sulfate 4 ) 6 ): 10 ('33) 365-82 [ ~ ] . Science Rep. Bes. Inst., Töhoku Univ., Ser. A On the estimation of commercial values of iron ores: 4 ('52). — Über den Dissoziationsdruck von Pyrit 6 ): 6 ('53) 561-72. - Fundamental research on metallurgical treatment of manganese ores, 1: On the equilibrium in the reduction of Mn 3 0 4 with CO 2 ): 5 ('53). Mit: S. Fukusima;«) A. Kigoshi; •) K. Mihara; 4 ) T. Onoda; •) K. Sudo; ') K. Umetsu. VI

ISING, Gustav Adolf. Physik. 1919-28 Doz., '20-28 stellvertr. Prof., '29-36 Laborator, '34- Titularprof., Stockholms Högskola; '35-60 Dir. d. Museums f. Gesch. d. exakten Naturwiss. u. Dir. d. Physikal. Kabinetts, Kungl. Svenska Vetenskapsakad., Stockholm; '36-60 Leiter eines eig. geophysikal. Labor., Djursholm; '45-54 Lektor geoISHI- physikal. Erkundung, Kungl. Tekniska Högskolan, Stockholm. — '54 Svante-

Ising — Issoglio

2189

Arrhenius-Medaille in Gold (Kungl. Sven- VI ISMAILSKI, Wsewolod — VI IZska Vetenskapsakad.). MAIL'SKIJ, V s e v o l o d Aleksandrovic *1883, Febr. 19, Finja; VI ISS0GLI0, Giovanni. Nahrungsfl960, Febr. 5, Djursholm. mittelchem. — 1902-04 Assist., '03 Nekr. A. B e c k m a n , Kosmos [Stockholm] Dottore in Chim. e Farmac., '04-10 38 ('60) 6 - 9 (m. Bildn.). S. C.R. 2 e Congrès mondial du pétrole, Primo Preparatore, '09-48 Libero Doc. Paris 1937, 1 (Paris '37) 5 S . : The astatized Chim. bromatol., Fac. Farmac., Univ. di pendulum as a static instrument for gravity Torino; Ispettore region., Ist. Nazion. measurements. - Kurs i mätteknik (Stockholm per le Conserve Alimentari; '10-35 Perito '44) 15-27: Galvanometrar och elektrometrar - nagra drag av deras teori och allmänna Chimico Igienista, Labor. Chim. Municipale, Torino; '20-25 Pres. della Soc. di egenskaper. Annalen Physik Natürliche Empfindlich- Farmac. di Torino. — Medaglia di Arkeitsgrenzen bei Meßinstrumenten, 3 : Das gento al Merito (Ministero della Educapraktische Erreichen der Empfindlichkeits- zione Nazionale); Medaglia di Bronzo al grenze des Galvanometers: (5) 14 ('32) 755-89. Merito della Sanità Pubblica. Arkiy Mat., Astron. och Fysik Röntgen*1879, Mai 2, Mondovi, Cuneo; spektroskopie und Abbildung mittels getl948, Apr. 23, Giaveno, Torino. krümmter Kristallreflektoren: 23 B, Nr. 5

('32) 2 S. — Einige Schweremessungen im südlichen Schonen mit einem astasierten Quarzpendel 1 ): 25A, Nr. 13 ('36) 22 S. Zur Theorie statischer Schweremessungen: Nr. 25 ('37) 14 S. - Über die Eichung von astasierten Gravimetern: 27 A, Nr. 4 ('40) 13 S. — On the magnetic properties of varved clay, 1: Line of investigation; measurements on a varve series from Viby in southern Sweden: 29A, Nr. 5 ('43) 37 S. - Die physikalische Möglichkeit eines tierischen Orientierungssinnes auf der Basis der Erdrotation : 32 A, Nr. 18 ('46) 23 S. - Coil galvanometers with some novel features: 36A, Nr. 13 ('48) 5 S. — Attempts to replace the elastic comparison force in gravimeters by capillary or electrostatic forces: 36B, Nr. 7 ('48) 8 S. Geologiska Foren. Stockholm Förh. Magnetische Eigenschaften des Schichttons: 64 ('42) 126-42 [schwed.]. Jernkontorets Ann. Moderna malmletningsmetoder: 121 ('37) 509-12. Kosmos [Stockholm] Högspänningsmetoder för atomsprängning: 11 ('33) 141-98. — Om jordrotationen sâsom den möjliga grundvalen för fàglarnas orienteringssinne: 23 ('45) 8 3 106. Nature [London] Nuclear photo-electric effect in deuterium 2 ): 137 ('36) 273. Technical Publ., Amer. Inst. Mining and metallurg. Engr. Use of astatized pendulums for gravity measurements: 828 ('37) 14 S. Teknisk Tidskr. Nya metoder for magnetometri: 76 ('46) 1299-306. Z. Geophysik Die Bestimmung der Apparatkonstanten bei astasierten Gravimetern: 16 ('40) 27-30. Mit: ') T. Eeg-Olofsson; >) M. Heide. 139 Poggendorff

Nckr. C. P e r t u s i , Chimica e Industria 30 ('48) 218 (m. Bildn.). HZ. Giorn. Farmac., Chim. e Sci. affini 1915-1936. S. Atti I Congresso internazionale di panificazione, Roma 1932 (Roma '33) 308-11: L'ergometro delle farine dei cereali. — Atti X Congresso internazionale di chimica, Roma 1938, 4 (Roma '39) 524-31: La quiescenza o narcosi microbiologica alimentare e le bibite a base di sciroppi di agrumi. W . Le applicazioni chimiche nella autarchia economica delle industrie agrarie (Torino '36) 18 S. (Società di Cultura e Propaganda Agraria, Collana di quaderni agrari). — La chimica moderna del pane quotidiano e l'autarchia (Torino '40) 23 S. Nr. 24). — Raccolta e conservazione dei prodotti ortofrutticoli (Torino '43 [?]). Annali R. Accad. Agric. Torino II glutine della farina di frumento italiano: 76 ('33) 11-55. - Frumento e segale: 77 ('34) 57-72. — La conservazione delle banane coll'essiccamento: 147-50. — La visita della Reale Accademia di Agricoltura alla Stazione Alpina dell'Istituto Zootecnico e Caseario per il Piemonte e la Liguria: 78 ('35) 129-34. Sull'alterazione delle derrate alimentari conservate in scatola: 79 ('36) 77-92. — La mineralizzazione delle acque e gli impasti da pane: 80 ('37) 35-49. — Pneumodinamometro ed ergometro: 82 ('38/39) 7-19. — La forza della farina in rapporto alla struttura del glutine: 217-25. — Sciroppi e mieli di sorgo saccarino: 83 ('39/40) 47-56. - L'agricoltura grande produttrice di microbromi: 85 ('41/42) 99-114. — Di alcuni grani di forza: 115-18. — I n memoria del Dott. Giovanni Possetto: 50110. — Commemorazione dell'Accademico Prof. Luigi Mascarelli: 511-20.

2190

Issoglio — v a n Itallie

Annali Chim. appi. Le proprietà fisicomeccaniche degli impasti da pane: 25 ('35) 274-92. Atti Congr. nazion. Chim. pura ed appi. La viscosità meccanica delle farine di frumento: 5.1935 I I ('36) 758-62. - Controllo chimico delle acque di piscina: 762-72. Autarchia aliment. Il biscotto italiano e l'autarchia: 1939. — Il pesce conservato secondo le direttive di Lazzaro Spallanzani: ibid. Chimica e Industria I minerali cobaltiferi di Usseglio : 18 ('36) 456-59. Chimica Industria, Agric., Biol., Realizzaz. corporat. I microbromi e l'alimentazione u m a n a : 17 ('41) 505-15. — Analisi di cioccolato al latte ed alle nocciole paragonato colla sua preparazione tecnica: 18 ('42) 401-04. Giorn. Farmac., Chim. e Sci. affini Indici di salubrità del latte: 81 ('32) 207-12. - Alchimisti antichi e moderni: 82 ('33) 100-15. Le ceneri vulcaniche del Quizapù: 179-82. — Orientamenti farmaceutici: 83 ('34) 67-75. — Le prove meccaniche in chimica bromatologica: 304-09. — La consistenza dei sol gelatinizzanti: 85 ('36) 8-10. Industria chim. [Milano] L'ergometro delle farine di frumento: 7 ('32) 421-27. — Potere distasico dei malti secondo Pollak: 8 ('33) 702 f. — Le più notevoli sofisticazioni delle farine di frumento: 1359-68. Miihle Die mikrographische Kleberstrukt u r in Brotteigen: 76 ('39) Mùhlenlabor. 9, 21-24. Officina I protidi e le neoformazioni: 5 ('32) 22-31. Panificazione Frumento, farine e pane: 18 ('34). Revista Centro Estudiantes Farm, y Bioquim. Das Ranzigwerden der Butter und ihre Oxydationszahl: 22 ('32) 77-83 [span.]. Risicoltura Utilizzazione autarchica dei cascami della lavorazione del riso: 31 ('41) 73-81. — Il riso e i suoi microbromi: 205-10. — Struttura biochimica del glutine di frumento: 32 ('42) 73-77. Rivista agraria La microfauna e la microflora del terreno agrario : 1939. Rivista Agric. Approvvigionamento idrico delle case rurali marmellate e gelatine di f r u t t a : 44 ('39). VI

van ITALLIE, Leopold. Chem. (pharmazeut., toxikol.). — 1907-36 Prof. Pharmazie u. Toxikol., Univ. Leiden; '10-34 Vorsitzender d. Niederlànd. Arzneibuch-Kommission; '21-35, '45-47 Vorsitzender der Verwaltung d. Keichs-

instituts f. pharmakotherapeut. Untersuchungen. — '33 Dr. h. c. (Univ. de Paris) ; '34 Dr. med. h. c. (Univ. de Liège) ; Dr. h. c. (Univ. de Strasbourg). - '32 Flückiger Medaille ; '37 Médaille Pasteur (Soc. Chim. biol., Paris). *1866 [nicht 1886],März 12,Maastricht; fl952, Mai 2, Heelsum. Zur Biogr. A. J . S t e e n h a u e r , Pharmaceutisch Weekbl. 78 ('36) 866-68. - Ibid., 923-26. Nekr. E. H 0 s t - M a d s e n , Archiv Pharm, og Chem. 59 ('52) 554f. - A. J . S t e e n h a u e r , Pharmaceutisch Weekbl. 87 ('52) 381. — Schweizerische Apotheker-Ztg. 90 ('52) 472f. (m. Bildn.). W. (Mitbearb.) R . J . O p w i j r d a , Algemeene en bijzondere recepteerkunst ten dienste van apothekers, artsen en veeartsen "(Amsterdam '35) 8 + 338 S. — De digitalis, en hare therapeutische toepassing (m. U. G. Bijlsma, L. W. van Esveld, C. L. C. van Nieuwenhuizen) 2 ('s Gravenhage '38) 144 S. — De behandeling van worminfeeties (m. U. G. Bijlsma, L. W. van Esveld, C. D. de Langen, J . J . Lijnst Zwikker) ('s Gravenhage '39) 59 S. Annales pharm, franç. Recherches sur les pavots: 4 ('46) 156-60. Archiv Pharm, u. Bcr. dtsch. pharm. Ges. Rauwolfia serpentina Benth. 6 ): 270 ('32) 313-22. Bull. Acad. Méd. Paralysie causée par l'éther tri-ortho-crésylphosphorique: 107 ('32) 278-80. Bull. Soc. Chim. biol. Les taches de sang: 19 ('37) 413-33. Chemisch Weekbl. Prof. Dr. E. W. Goester f : 31 ('34) 316f. J. Pharm, et Chim. L'eau distillée de lauriercerise: (8) 22 ('35) 452-54. — Soma-Haoma, la plante sacrée des Indiens et des Perses: 25 ('37) 49-53. — La fixation du moment de l'administration du poison en cas d'intoxication chronique par l'arsenic: 97-101. — Deux cas d'intoxication arsénicale: 26 ('37) 289-92, 414. - Une réaction du soufre: 27 ('38) 46567. — La réaction du soufre libre: 29 ('39) 97-100. - Calomel : 30 ('39) 305-07. Natuurwetenschappelijk Tijdschr. SomaHaoma, die heilige Pflanze der Inder und Perser: 19 ('37) 9-11. - Die Entwicklung der Toxikologie: 21 ('40) 218-22. - - Beide Arbeiten niederländ. Naunyn-Schmledebergs Arch. exper. PathoL u. Pharmakol. Die Untersuchung von Abortiv», besonders „Apiol" 3 ) 2 ): 165 ('32) 84-100. Pharmaceutisch Weekbl. Über das F e t t von Varanus salvator Laur. 3 ) 1 ): 69 ('32) 271-76. — Rauwolfia serpentina Benth. 5 ) : 334-48. —

v a n Itallie — Itano Über Pithecolobium saman Benth.: 941-63. — Der Arsengehalt von Haaren und Nägeln: 1134-47. — Ein internationales Verfahren zur Bestimmung des Morphingehaltes im Opium: 71 ('34) 4-9. — Soma-Haoma, die heilige Pflanze der Inder und Perser: 74 ('37) 5-9. — Bestimmung des Zeitpunktes, in dem bei chronischer Arsenvergiftung das Gift beigebracht wurde: 206-09. — Eine subakute Arsenikvergiftung 6 ): 231-33. — Auf dem Wege zur Internationalen Pharmakopoe: 1121-26. — Eine chronische Arsenikvergiftung 4 ): 1498 f. — Eine Reaktion auf freien Schwefel: 75 ('38) 278-80. — Die Bestimmung von Ekgoninbase in rohem Cocain und in Cocablättern: 909-16. — Die Farbreaktion auf Schwefel: 1445-48. - Kalomel: 76 ('39) 1010-17. — Das „ K i n o " von Myristica glabra Bl. (Horsfieldia glabra [Bl.] Warb.): 78 ('41) 1145-49. — Untersuchungen eines BenzoinHarzes aus Sumatra 3 ): 81 ('46) 123-28. Eine chronische industrielle Arsenikvergift u n g : 213-15. — Chemische Bestandteile und Stellung der Pflanzen im botanischen System: 86 ('51) 65-69. Alle Arbeiten niederländ. Pharmazeutische Mh. Der Arsengehalt der Haare und der Nägel: 13 ('32) 220-23. Pharmazeutische Presse Apiol und Apiolvergiftungen: 37 ('32) 89 f. Sammlung von Vergiftungsfällen NovocainAdrenalin-Vergiftung, tödliche, medizinale 5 ): 8 A ('32) 63 f. — Apiolvergiftung durch ein mit Tri-ortho-kresylphosphat verfälschtes Produkt 3 ) 2 ): 85-88. - Tödliche Kohlenoxydvergiftung in einer Leuchtgasfabrik 5 ): U l f . — Dial-Vergiftung (Selbstmord) 5 ): 141 f. Scopolamin-Blausäure-Vergiftung 6 ): 6A ('35) 223 f.

Mit: x ) W. J. van Eerde;») L. W. van E s v e l d ; s ) A. H a r m s m a ; *) T. P o t j e w i j d ; •) A. J. S t e e n k a u e r ; •) U. G. B i j l s m a .

ITANO, Arao. Biochem., Bodenmikrobiol. — 1924-39 Head of Chem. Departm., Ohara Inst, for Agric. Research, Kurasiki, Okayama; '39-45 Head of Soil Departm., Continental Research Inst., Shanshung, China, '45-60 Chief, Soil Research, Peking Agricultural Acad.; '60- living in retirement in Japan. — '68 Prize (Japanese Soc. Soil and Manure). *1887, Apr. 21, Hadamura, Kibigun, Okayama. S. Proc. and papers. 2 nd International congress of soil science, Leningrad 1930, 3 (Moskva '32) 279: Winogradsky's Azotobacter test applied to rice-field soils in Japan 1 ). Ber. Öhara-Inst.landwirtsch. Forsch. [Japan] Nitrate reduction by Azotobacter 1 ): 5 ('32/33) 281-89. — Investigations on cellulose de139*

2191

composition in soils, 1: Re-examination of some stock cultures as to their physiological activities 1 ): 291-97. — Modified MorseKopeloff anaerobic culture method 1 ): 299f. — [Studies on the nodule bacteria of Astragalus sinicus (Genge), 1:] Studies on soil reaction and the growth of Astragalus sinicus (Genge) 4 ): 421-26; 2] 4 ): 6 ('33/35) 259-67; ~ 3: Fermentation of carbohydrates with special reference to the carbon and nitrogen source: 341-69; Studies on nodule bacteria, 5: Influence of plant extract as accessory substance on the growth of nodule bacteria 4 ): 7 ('35/37) 185-214; ~ 6: Influence of different parts of plant on the growth of nodule bacteria 4 ): 35977; ~ 7: Influence of the extract of nodules on the growth of nodule bacteria 4 ): 379-401; ~ 8: Influence of ash content of the nodules on the growth of nodule bacteria with special reference to the titanium salts 4 ): 501-15; ~ 9: On the electrical properties of the accessory substance 4 ): 517-27; ~ 10: Influence of some stimulating chemicals, with special reference to the alkaloids, upon the growth and morphology of nodule bacteria 4 ): 8 ('38) 53-68; ~ 11: Influence of some stimulating chemicals, with special reference to alkaloids, upon the fixation of nitrogen 4 ): 69-81; ~ 12: Influence of various iron compounds on the nodule bacteria of Astragalus sinicus (Genge) 6 ): 273-81. — Microbiological investigation of organic fertilizers, 1: Decomposition of rape cake 1 ): 6 ('32/33) 427-46. - Investigation on the influence of aerial-earth circuit on t h e biological activities, 1: Influence on Azotobacter chroococcum; ~ 2: Mechanism of the influence on Azotobacter chroococcum as to its potential: 6 ('33/35) 41-52; ~ 3: Mechanism of the influence on Azotobacter chroococcum as to its electrophoresis: 255-57. — A quantitative method for determination of iodine: 53-58. — General survey and investigation of agar: 59-72. — Influence of iodine on physiological activities of microorganisms 4 ): 73-81. — Electromedical determination of magnesium by the use of antimony electrode 6 ): 269-73. — Investigation on the iodine contents in the soils in J a p a n [, l] 6 ) ; 371-81; ~ 2: Influence of natural conditions and fertilizing on the iodine contents'): 7 ('35/ 37) 103-14. — Influence of ultra-violet rays on the physiological activities of Azotobacter, 1: Lethal action on A. chroococcum 4 ): 6 ('33/ 35) 383-92; ~ 2: Stimulation of A. chroococcum by ultra-violet rays 4 ): 561-73; ~ 3 : Influence of ultra-violet and monochromatic rays on the pigment production 4 ): 7 ('35/37) 175-83. — Investigation on agar, 2: Physicochemical properties of agar and their influence on the growth of micro-organisms 8 ): 6 ('33/35) 575-86; ~ 4: Influence of various chemicals on the melting point, solidity, p H values and hydrolysis of agar 6 ): 8 ('38) 249-71. — Direct p H determination of soil under its

2192

Itano

natural state by quinhydrone method, 1: Determination of p H in the paddy-field soil®): 6 ('33/35) 587-606; ~ 2: Description of a new electrode and its use 6 ): 7 ('35/37) 214-25; ~ 3: Determination of pH of soils in the dry farm®): 8 ('38) 83-95. — Investigation on tea as to its iodine contents 6 ): 7 ('35/37) 153-55. — Studies on thermophilic bacteria with special reference to cellulose decomposition, 1: Distribution of the bacteria in surface soil, on the rice-straw and unhulled rice by different seasons 4 ): 157-74. — Spontaneous studies of soils, 1: A method for collecting soil samples to be studied in the laboratory: 289-91; ~ 2: Influence of temperature on micro-organisms 6 ): 409-14. — Microbiological studies on tea, 1: Quantitative determination of micro-organisms on fresh tea leaves and those at different stages of manufacturing 6 ): 403-08; ~ 2: Influence of tea extract on soil micro-organisms 6 ): 491-500. — Agar solidity tester 6 ): 529-33. — A new microanalytical method for iodine 6 ) 2 ) 6 ): 8 ('38) 97101. — Influence of sea water on the iodine contents of rice, rice-bran and wheat 6 ) 2 ) 5 ): 103-06. — A new portable quinhydrone microelectrode: 181-84. — — [Mehrere Arbeiten japan, m. engl. Zusammenfassg.]. Bull, agric. chem. Soc. Japan Investigation on cellulose decomposition in soils, 2: Detection and estimation of a number of principal aerobic cellulose-decomposing bacteria 1 ): 8 ('32) 7. — Investigations on the influence of aerial-earth circuit on the biological activities, 1: Influence on Azotobacter chroococcum: 9 ('33) 31; ~ 2: Mechanism of the influence on Azotobacter chroococcum as to its potential: 132-36. — Investigation on the influence of ultra-violet rays on the physiological activities of Azotobacter, 1: Lethal action on A. chroococcum 4 ): 10 ('34) 81; ~ 2: On the stimulation of A. chroococcum by ultra-violet rays 4 ): 101; ~ 3: Influence of ultra-violet and monochromatic rays on the pigment production 4 ): 11 ('35) 106 f. — Agar-agar, 2: Physicochemical properties of agar-agar and their influence on the growth of micro-organisms 6 ): 10 ('34) l l l f . — Investigation on tea as to its iodine contents 6 ): 11 ('35)103-05. - Direct p H determination of soil under its natural state by quinhydrone method, 1: Determination of p H in the paddy-field soil 6 ): 11 ('35) [oder 12 ('36) ?]; ~ 2: Description of a new electrode and its use 6 ): 12 ('36) 51 f. — Agar solidity tester 6 ): 13 ('37) 26.

Influence of ultra-violet rays on the physiological activities of Azotobacter, 3: Effect of ultra-violet rays and monochromatic rays on pigment production 4 ): 564-73. — Nodule bacteria, 9: Electrical properties of the accessory substance in the nodule 4 ): 12 ('36) 457-66; ~ 10: Influence of some stimulating chemicals, with special reference to the alkaloids, upon the growth and the morphology of the nodule bacteria 4 ): 604-21. — Agar solidity tester 6 ): 13 ('37) 236-40. [ ]. J. Sci. Soil and Manure [Japan] Microbiology of organic manures, 1: Decomposition of rape cake by various stock cultures 1 ): 6 ('32) 35-52; ~ 2: The decomposition of soybean cakes by various stock cultures 1 ): 30111. — Relation between hydrogen ion concentration in the soil and cellulose decomposing organisms 1 ): 6 ('32) Nr. 2. — Electrometrical determination of magnesium by the use of the antimony electrode 6 ): 7 ('33) Nr. 1. — Investigation on the determination of the buffer capacity and the standard buffer index of acid soil 4 ): ibid. — Influence of iodine on the physiological activities of micro-organisms 4 ): Nr. 2. — Influence of ultra-violet rays on the physiological activities of Azotobacter, 3: The relation between the development of colouring matter and the monochromatic light 4 ): 9 ('35) Suppl., 71 f. — On the nodule bacteria of leguminous plants, 5: The plant juice as the accessory factor of the growth of nodule bacteria 4 ): 72-; Studies on the nodule bacteria, 8: Influence of ash content of the nodule on the growth of nodule bacteria with special reference to titanium salts 4 ): 10 ('36) 63-75; ~ 12: Influence of various iron compounds on the nodule bacteria of Astragalus sinicus (Genge)6): 12 ('38) 339-46. - Spontaneous studies of soils, 2: Influence of temperature on micro-organisms of soil 6 ): 11 ('37) 43. — Preliminary report on the investigations of the niter soils in Manchukuo 3 ): 14 ('40) 393-402. -

-

[ ] •

Proc. imp. Acad., Tokyo Investigation on the influence of aerial-earth circuit on the biological activities, 1: Influence on Azotobacter chroococcum: 9 ('33) 47-50; ~ 2: Mechanism of the influence on Azotobacter chroococcum as to its potential: 309-12; ~ 3: Mechanism of the influence on Azotobacter chroococcum as to its electrophoresis: 59295. — Investigation on agar as to its iodine content: 398-401. — Investigation on the iodine contents in the soils in Japan 6 ): 10 ('34) C.R. Trav. Labor. Carlsberg, S6r. chim. 524-27. — Investigation on tea as to its A new micro portable quinhydrone electrode: iodine contents 6 ): 11 ('35) 141-43. 22 ('38) 235-38. J. agric. chem. Soc. Japan Cellulose deProc. int. Soc. Soil Sci. Determination of composition in soils, 2: Detection and estima- chloride in soils4): 7 ('32) 273 [ ]. - Electrotion of a number of principal aerobic cellulose- metrical determination of magnesium by decomposing bacteria 1 ): 8 ('32) 589-95. — means of the antimony electrode 6 ): 8 ('33) Iodine content of tea 6 ): 11 ('35) 545-51. - 165 [ ].

Itano — v a n Itterbeek

2193

Mineralogical Mag. and J. mineral. Soc. Rep. Inst. sei. Res. Manchukuo Preliminary report on the investigations of the niter soils Scorodite from Kiura mine, Japan 1 2 ) : 23 ('32) 3 130-36. in Manchukuo ): 4 ('40) 273 [ ]. Mit: S. A r a k a w a ; *) sT. H a s e g a w a ; 3) K. KaNature [London] Structure of vivianite and wase; *) A. M a t s u u r a ; ) T. Moriya; •) Y. Tsuji. symplesite: 164 ('49) 449f. — A general powder x-ray photography: 755f. VI ITO, Tei-ichi. Mineral., Kristallogr. Proc. imp. Acad., Tokyo A possible form of — 1939 D.Sc., Tôhoku Imperial Univ., Si 3 0 8 groups in silicates: 9 ('33) 53-55. — Sendai; '24-25 Instructor, '25-43 Assist. The Si 3 0 8 -chains in space groups V¿6 and C| h : Prof., '43-59 Prof., '59 Prof. Einer., 528-30. - The structure of epidote 7 ): 21 ('45) Tokyo Imperial Univ.; '55-63 Prof., 67-69. Proc. Japan Acad. Parasymplesite, a new Kyoto Imperial Univ. — '45 Imperial polymorphous with symplesite 1 ) 6 ) : 30 Acad. Prize ; '68 Roebling Medal (Mineral. mineral ('54) 318-24. - The crystal structure of Soo. America). axinite revised8)15)13)11)14) : 45 ('69) 490-94. *1898, Sept. 27, Osaka. Z. Kristallogr., Kristallgeom., Kristallphysik, Zur Biogr. M. J . B u e r g e r , American Kristallcliem.10 The structure of hemimorphite Mineralogist 54 ('69) 586-89; 589-92 eig. (H 2 Zn 2 Si0 6 ) ): 83 ('32) 1-8. -10 The structure Beitr. : Acceptance of the Roebling Medal (m. of bertrandite (H 2 Be 4 Si 2 0„) ): 384-93. — The structure of epididymite (HNaBeSi 3 0 8 ) : Bildn.). 88 ('34) 142-49. - On the symmetry of the W. Beiträge zur Mineralogie von Japan, rhombic pyroxenes: 90 ('35) 151-62. — Neue Folge 1: Gedenkband für N. Fukuchi A microphotometric study of x-ray powder [japan. m. engl. Zusammenfassg. 18 S.] (Tokyo diagrams of certain felspars 16 ): 95 ('36) 404'35) 259 S.; 2 [ ~ 22 S.] ('37) 168 S. - Japanese 07. — The existence of a monoclinic soda minerals in pictures 1 (Tokyo '37) 14 + 152 S. felspar: 100 ('38) 297-307. - The determina[japan. m. engl. Index u. engl. Anmerkungen]; tion of lattice constants of triclinic crystals 2 - 4 ('38/39 [?]). - x-Ray studies on poly- from one crystal setting - a special case : 437morphism. Being a collection of papers con- 739. — The crystal structure of tellurite (Te0 2 ) cerning submicroscopic twinning in crystals, ): 102 ('39) 13-25. -4 Nakaséite, an an): 113 ('60) 94-98. •with appendices (m. R. Sadanaga, Y. Ta- dorite-like new mineral Mit: H. M i n a t o ; s ) H . M o r i ; ') N. M o r i m o t o ; keuchi) (Tokyo '50) 7 + 231 S. •) H. Muraoka; ') R. S a d a n a g a ; ") K. S a k u r a i ; Acta crystallogr. The structure of vivianite ') H. S a w a d a ; 8) Y. T a k e u c h i ; •) T. W a t a n a b c ; and symplesite 2 ): 3 ('50) 1-6. — The crystal 10 )J. W e s t ; ")T. Z o l t a i ; 1 ! )T. S h i g a ; " ) T . A r a k i ; structures of warwickite, ludwigite and ") J. J. F i n n e y ; ") T. Ozawa; ") H. I n u z u k a . pinakiolite») 8 ): 98-107. - An electron-diffraction study of chalcopyrite film grown on VI enargite 7 ): 434f. — The crystal structure of van ITTERBEEK, A u g u s t i n u s boracite 3 ) 5 ): 4 ('51) 310-16. - A Fourier Franciscus. Physik. — 1932-35 Doz., 6 analysis of the structure of tourmaline ) : 38590. — Crystal structure of ludlamite 2 ) : 412- '35- Prof. u. Dir. d. Inst. f. tiefe Tem16. — The crystal structure of axinite 8 ): 5 peraturen u. techn. Physik, Univ. Catho('52) 202-08. — The crystal structure of mila- lique de Louvain; '49-60 außerord. Prof., rite 3 ) 5 ): 209-13. - The lamellar structure of '60- Honorarprof., Rijks-Univ. te Leiden; certain microcline and anorthoclase 5 ) : 44149. — The crystal structure of realgar 3 ) 5 ): '60- Lektor Festkörperphysik, Univ. de 775-82. — The crystal structure of datolite 2 ) : Liège ; Gastprof. an zahlreichen europ. u. 6 ('53) 24-32. - Structure of epidote 3 ) 6 ): 7 amer. Universitäten. — '47-50 Vizepräs., ('54) 53-59. '50- Präs., Inst. Internat, du Froid; VorAmerican Mineralogist Structure of epidote : 32 ('47) 309-21. - Structure of eudidymite : 442-53. Bull. geol. Soc. America Pseudo-twin of augite and pigeonite 3 ): 69 ('58) 1616. J. Fac. Sei., Univ. Tokyo, Sect. II The symplesite problem 2 ) : 9 ('54) 201-04. J. geol. Soc. Japan On the resemblance of tellurite (Te0 2 ) and brookite (Ti0 2 ): 40 ('33) 613-16 [japan.]. Japanese J. Geol. and Geogr. On the resemblance of tellurite (TeO a ) and brookite (Ti0 2 ) : 11 ('33/34) 10.

sitzender verschiedener wissenschaftlicher Kommissionen. *1904, Aug. 14, Aalst, Ostflandern; tl968, Apr. 28, Louvain. Zur Biogr. Jaarb. Rijksuniv. Leiden 1950, 92 f. Nekr. L. van G e r v e n , Nederlands Tijdschr. Natuurkunde 34 ('68) 259-62. - J . van den H a n d e l , Cryogenics 8 ('68) 195. — R. P l a n k , Kältetechnik 20 ('68) 205. H. De wetenschappelijke bibliotheek. Rubriek: Natuurkunde (Amsterdam '30ff.). —

2194

v a n Itterbeek

Physics of high pressures and the condensed frigeration science and technology. Proc. th phase (Amsterdam '65) ; darin eig. Beitr. : 297- 10 International congress of refrigeration, 357: The velocity of sound in dense fluids 23 ). Kebenhavn 1959, 1 (Oxford-London '60) 8086 : Measurements on field dependence of the HZ. Bull. Inst. int. Froid, Suppl., 1960, electrical resistance in thin ferromagnetic films Annexe 1 ('62) [ = Problems of low tempera- at very low temperatures 31 ) 126 ); 229-31: Preture physics and thermodynamics, 1]; 1961, liminary measurements on the density of Annexe 5 ('63) [ = ~ 2], liquefied gases under high pressure 23 ) 103 ); d'adsorption aux maS. Proc. 3 rd International congress of 274-78: Isothermes 23 66 44 rd phonetic sciences, Ghent 1938 (Ghent '39): tériaux isolants ) ) ). - Proc. 3 International congress on acoustics, Stuttgart Sur l'absorption du son dans le gaz. — Grenslaagverschijnselen. Symposium gehouden te 1959 (L. Cremer) 1: Principles (AmsterdamBrüssel 1946 (Antwerpen '47): Adsorptie van London-New York-Princeton, N.J. '61) 460gassen aan vaste Stoffen. — Colloquium over 65: Acoustical measurements carried out a t ultrasonore trillingen. Koninklijke Vlaamse the Physical Laboratory of the University of Academie voor Wetenschappen, Letteren en Louvain; 2: Applications ('61) 1124-28: 66 Schone Künsten van België. Bruxelles 1951 Acoustical measurements on Belgian ships ). (Bruxelles '51) 61-73: Ultrasonic absorption in — Magnetic and electric resonance and regaseous hydrogen at low temperatures 105 ); laxation. 11e Colloque Ampère, Eindhoven 220-33: Attenuation of sound in aqueous 1962 (Amsterdam '63) 495-500: Some experielectrolyte solutions 105 ). — Proc. 8tl1 Inter- mental results on ferromagnetic resonance in national congress of refrigeration, London nickel films 109 ) 34 ) 71 ) [m. franzòs. Zusammen1951 (London '52) 211-14: Thermal diffusion fassg.]. — Paramagnetic resonance. 1 st Intera t low temperatures 6 )' 5 ) [ ]. — Proc. Congress national conference on paramagnetic reof the European Brewery Convention, Nice sonance, Jerusalem 1962 (W. Low) 2 (New 1953 (Amsterdam-London '54) 67-73: Etude York-London '63) 684-86: A phase-selective de la bière par le microscope électronique1®) X-Y-recorder for magnetic resonance ex101 ). — Progress in low temperature physics periments 37 ) 86 ); 905-18: Low field E P R meas(C. J . Gorter) 1 (Amsterdam '55) 355-80: urements in D P P H at low temperatures 37 ) 65 ). Velocity and attenuation of sound measure- — Electronic magnetic resonance and solid ments a t low temperatures. — C.R. 9 6 Congrès dielectrics. 12e Colloque Ampère, Bordeaux international du froid, Paris 1955, 1/2 (Paris '55) 2019-28: Mesures récentes faites au 1963 (Amsterdam '64) 198-: A low temperaphenomenon laboratoire cryogénique de Louvain sur la ture paramagnetic relaxation 37 120 116 conductibilité thermique des matériaux iso- due to impurities in Cu2Cl2 ) ) ) ; 513-: spin wave resonance in permlants ; mesures sur le flux de chaleur à travers Ferromagnetic 109 80 2 des structures complexes 66 ) 38 ). — Proc. Inter- alloy films ) ) ). — Progress in refrigerath national symposium on transport processes in tion science and technology. Proc. 11 International congress of refrigeration, Munich statistical mechanics, Bruxelles 1956 (New 1963, 1 (London-Karlsruhe '65) 141-44: York-London '58) 387-93: Measurements on very pure thermal diffusion combined with ordinary Purification method for obtaining 85 103 92 diffusion in gas mixtures. — Proc. Joint hydrogen at high pressure ) ) ); 159-62: for double resoconference on thermodynamic and transport A metallic helium120cryostat 37 123 115 properties of fluids, London 1957 (London '58) nance experiments ) ) ) ); 169-71: Pararesonance in y-irradiated Donetz 195—97: Measurements on thermal diffusion magnetic 109 34 89 in hydrogen-nitrogen mixtures as a function coal ) ) ); 177-80: Physical aspects of of pressure"). — Proc. 5 t h International con- bubble formation in hydrogen and thermo103 ference on low temperature physics and 9dynamical properties of liquid n-hydrogen ) ); 193-97: The velocity of ultrasonic pulses chemistry (J. R. Dillinger), Madison, Wis., 60 and 90 °K as a func1957 (Madison, Wis. '58) 206-09: New devel- in hydrogen between 23 21 opment of an acoustic thermometer; 537-39: tion of pressure ) ); 219-25: Equipment for The transversal relaxation time of para- producing pulsed magnetic fields of high measuremagnetic electron resonance in diphenyl- intensity and magneto-resistance 45 66 e picrylhydrazyl between 1,5 °K and 300 °K ments on germanium ) ). — Rapports. 5 Congrès international d'acoustique, Liège 1965 37 110 ) ); 551 f.: Magnetic susceptibilities of Ag/Mn alloys 30 ) 33 ). — Solid state physics in (Liège '65) (Les congrès et colloques de l'Unielectronics and telecommunications. Proc. of versité de Liège, 35) D 15 (4 S.): Measurean international conference of the Inter- ments on the absorption of ultrasonic waves 40 8 national Union of Pure and Applied Physics, in aqueous manganous sulfate solutions ) ); Bruxelles 1958, 3 : Magnetic and optical D 52 (4 S.): Molecular corresponding states of the sound velocity in dense properties (London-NewYork '60) 503-07: treatment 23 relaxation La résonance paramagnétique dans du char- media ); D 62 (4S.): Rotational 112 u ) ) ; H 65 (4 S.): bon au moyen de radiofréquences et d'ondes times in p-H 2 and 0 - D 2 measurements centimétriques 37 ) 34 ) 83 ). — Progress in re- Sound velocity and absorption in a circular resonator tube 23 ). — Trans. Inter-

v a n Itterbeek national vacuum congress, Stuttgart 1965 (H. Adam) 1 (Oxford-London '66) 17-: Excitation of spin waves and Kerr effect on thin ferromagnetic films109)108). — Progress in refrigeration science and technology. Proc. 12 th Congress of the International Institute of Refrigeration, Madrid 1967, 1 (Paris '68) 35966: Viscosity of A - 0 2 , A-N 2 and N 2 - 0 2 mixtures in the liquid phase 43 ) 112 ). — Proc. 2 nd International cryogenic engineering conference, Brighton, Engl., 1968 (London '68) 184—86: Some measurements on the superconducting properties of thin mercury foils 14 117 ) ). — — Einige weitere Beiträge in Kongreßberichten. W . Experimentele resultaten en theoretische beschouwingen over gasvormig helium, waterstof en zuurstof bij läge en zeer läge temperaturen (Gent '32) 10 + 58 S. - De opleiding van de student in de physica in het gebied der lagere temperaturen (Leiden '50) 17 S. — Appareils pour la mesure du coefficient de conductibilité thermique des matériaux isolants (Bruxelles '50) 12 S. (Communication du Centre Belge des Constructions Navales). — Appareillage et méthodes de mesures acoustiques (m. P. Märiens, H. Myncke) (Bruxelles '50) 15 S. ( ~ ) . - Etude sur l'amortissement de la vibration de tôles par l'application d'un enduit (m. H. Myncke) (Bruxelles '57) 19 S. (Publications "Ceberena" Sect. I I , 3). — Essais sur cloisons coupe-feu (m. H. Myncke) (Bruxelles '57) 16 S. 4). Isolation acoustique aux bruits aériens de cloisons, ponts et murs (m. H. Myncke) (Bruxelles '59) 20 S. ( ~ 5). — Mesures acoustiques et lutte contre le bruit à bord des navires (m. H. Myncke) (Bruxelles '60) 32 S. ( ~ 6).

2195

propagation du son dans l'air et dans des mélanges azote-hydrogène aux basses températures. Calcul des chaleurs spécifiques 98 ): 19 ('44) 88-104. — Sur l'élévation du point d'ébullition de l'oxygène liquide sous l'action d'un champ magnétique 8 ): 20 ('45) 231-40. — Mesures sur la résistance électrique de films en bismuth sous l'action d'un champ magnétique 8 ): 636-46. Applied sei. Bes., Sect. A The liquidhelium plant of the Physical Laboratory of the University of Louvain39)6«) : 3 ('53) 429-32. — Measurements on the second virial coefficient of nitrogen between 90 and 65 °K with t h e use of ultrasonics 68 ) 34 ): 6 ('56) 15-20. Measurements on the velocity of sound in air under pressures up to 20 atmospheres combined with thermal diffusion"): 21-28. — Measurements on the velocity of sound in nitrogen under high pressure") 3 4 ): 421-32. — Measurements on the velocity of sound in oxygen gas under high pressure 113 ): 7 ('58) 375-85. Applied sei. Bes., Sect. B Measurements on thin iron films 39 ) 46 ): 2 ('52) 320-24. - Measurements on the formation of thin tin films 39 ) 46 ) : 352-60. — Measurements on the coercive force of ticonal down to liquid helium temperatures 63 ) 6 ): 3 ('53/54) 451-55. - Magnetic susceptibility measurements on germanium between room temperature and liquid hydrogen temperature 39 ) 30 ): 4 ('55) 300-08. - Measurements on the magnetic susceptibilities of silver-manganese and copper-manganese alloys' 3 ) 70 ): 7 ('59) 329-37. - Magnetic absorption phenomena in germanium a t low temperatures 37 ) 66 ): 345-54. — Susceptibility measurements of Nb between room temperature and liquid helium temperatures 70 ) 87 ): 8 ('60) 177-82. — The magnetic susceptibility of Ag-Mn and Cu-Mn solid solutions between 1,2 and 369 °K 87 ) 70 ): 337-48. - Resistivity measurements on permalloy films 31 ) 12 ) : 9 ('63) 470-76. — Investigation of the structure of thin metallic layers by means of the replicamethod 34 ) 49 ) : 10 ('63) 1-6. - A phase-selective X-Y-recorder for magnetic resonance experiments 37)86) : 243-46. — Bombardment of copper and germanium surfaces by low energy argon ions34)109)2)49): 11 ('64/65) 3f., 286-92. — Measurements of the intensity of high pulsed magnetic fields by the Faraday effect in flintglass 72 ) 66 ) 46 ) : 433-41. - The construction of a coil to produce high pulsed magnetic fields 28 ) 119 ): 18 ('67) 105-11.

Âcustica Vibration of plates covered with a damping layer 66 ) : 3 ('53) 207-12 [m. französ. u. deutscher Zusammenfassg.]. — Measurements on thermal diffusion in hydrogenhelium mixtures by using ultrasonics 68 ) : 5 ('55) 142—45 — Measurements on thermal and ordinary diffusion in gas mixtures (H 2 -He, H 2 -N 2 and H 2 - 0 2 ) by using ultrasonics 68 ): 7 ('57) 180-84 [ ~ ] . — Velocity of acoustical waves in liquid-filled capillary tubes at low temperatures 1 1 3 ): 12 ('62) 299-302 Influence of the shape of the neck of the Helmholtz-resonator on its absorbing properties 33 ) 66 ): 14 ('64) 212-15. Advances cryogen. Engng. Properties of some cryogenic liquids from velocity of sound data 2 3 ): 9 ('64) 207-16. — Measurements on the sound velocity in the critical region of Archives Sei. [Genève] Sur la forme généargon 23 ) 91 ): 12 ('67) 754-61. - An experimental apparatus to determine the effects of rale des raies d'absorption paramagnétique champs transversaux (champ H F alpha irradiation at liquid helium temperature dans des 14)74)94). 1 3 ('68) 92_. faible) 37 ): 14 ('61) Fasc. spéc. (10e Colloque Ampère) 117—22 [m. engl. Zusammenfassg.]. Annales Physique Mesures sur l'adsorption activée par des lames de nickel entre 200° et Brennstoff- u. Wärmewirtsch. Die Zu5 0 0 o 64)69). ( n ) 1 8 ('43) 135-44. _ Vitesse de kunftsmöglichkeiten von verflüssigten Gasen

2196

van Itterbeek

als Brennstoff für Motorfahrzeuge: 25 ('43) Measurements on the velocity of sound in fluids 23 ) 34 ): 1961, Annexe5 ('63) 167-78 [ ~ ] . 54-56. — Density variation of liquefied gases (H a , Bull. Inst. int. Froid, Suppl. The "Collins" 0 2 , N2, A) with pressure up to 850 kg/cm 2 103) : liquid-helium plant used in a closed cycle at 179-89 [ ~ ] . — Commissions of the Interthe University of Louvain: 1954, Annexe 2, national Institute of Refrigeration: Work of 57-60 [m. französ. Zusammenfassg.]. — Me- Commission 1: Development of the science sure de l'influence de l'humidité sur la varia- and technology of very low temperatures: tion du coefficient de conductibilité et de la 1963, 712-15 [auch französ.] (m. Bildn.). transmission thermique 66 ): Annexe 4, 167-77 Some considerations on a non-steady state [m. engl. Zusammenfassg.]. — Application des method for the measurement66of126the heat conultrasons à la mesure de la thermodiffusion ductivity of moist materials ) ): 1964, Andans des mélanges gazeux et de la chaleur nexe 2, 61-69 [m. französ. Zusammenfassg.]. spécifique de l'hélium gazeux aux tempéra- — La conductibilité thermique du cuivre autures de l'hélium liquide: 1955, Annexe 2, dessous de 1 °K 3 1 ): 1965, Annexe 2, 45-48 99-106 [ ~ ] . — Appareil pour la condensation [m. engl. Zusammenfassg.]. — Method for the des métaux aux basses températures. Quelques simultaneous measurements of the thermal résultats sur la supraconductibilité de l'étain conductivity of insulating materials at differ39 ): 175-83 [ ~ ] . — Mesures sur la supra- ent mean temperatures 66 ): 1966, Annexe 2, conductivité de couches minces d'étain et les 15-22 [m. französ. Zusammenfassg.]. — Depropriétés ferromagnétiques de couches enni- scription of two cryostats for continuous reguokel39)31)80) : 1955, Annexe 3 ('56) [ - ] . - Mesu- lation of temperature of 4 to 300 °K 103 ) n8 ) s ) : res sur la susceptibilité magnétique du germa- Annexe 5, 171-83 f Sonderbände nium 30 ): 1956, Annexe 2, 83-89 [ ~ ] . - Para- "Proc. International congressDie of refrigeration" magnetic electron resonance in coal and resonance in germanium 110 ) 37 ): 125-32 [m. fran- sind unter S. aufgeführt. Bull. int. Inst. Eefrigerat. Liquid-helium zös. Zusammenfassg.]. — Measurements on the velocity of sound in air under high plant at the laboratory of the Louvain Unipressure combined with thermal diffusion versity (Belgium) : 24 ('43) Annex 9, 1-6. ") S4 ) : 207-14 [ - ] • - Détermination de Bull. Soc. beige Physique Evaporation l'équation d'état pour des mélanges gazeux de couches minces dans l'ultra vide108) : 3 68 34 37 H j - H e par la méthode acoustique ) ) ): ('62/63) 189-. — Etude de la structure des 215-25 [m. engl. Zusammenfassg.]. — In- couches minces métalliques et des surfaces de fluence des gaz inclus sur la conductivité métaux par la technique des répliques 34 ) 49 ): thermique de matériaux isolants66)39) : 241-49 192-. — Measurements on the superconductiv[—]. — Temperature measurements with an ity of In films 34 ) 14 ): 4 ('64/65) 7-11. - Inacoustical thermometer 34 ) 82 ) 87 ): 1958, Annexe fluence of a magnetic field on the transport 1 ('59) 155-63 [m. französ. Zusammenfassg.]. properties in gases112)11): 78-81 [flam.]. — — The coercive force of cold-rolled nickel-, Measurements on the Faraday rotation in iron- and cobalt-strips 31 ): 187-92 [—]. — The pulsed magnetic fields of high intensity 28 ) 66 ) : influence of cold rolling on the coercive force 389-94. — Kerr effect measurements on thin of thin iron plates 4 ) 102 ): 199-202 [ - ] • - The ferromagnetic films108)109): 399-405. - Equipinfluence of the density on the thermal diffu- ment for the production of high pulsed magsion in gas mixtures of gases at low tempera- netic fields and some measurements of the tures 32 ) 6 ): 275-78 — Viscosity measure- Faraday-rotation 28 ) 119 ) 66 ): 5 ('66/67) 188-. ments of gases between 20 and 80 °K 2 2 ) 6 ) l u ) : The influence of neutron- and alpha-irradia281-87 [ ~ ] , — The influence of the density on tion on the superconductive properties of thin the viscosity of helium gas at liquid hydrogen foils' 4 ) 14 ): Nr. 4/5. temperatures 22 ) 6 ) 111 ): 289-92 - MeasureBull, techn. Union Ing. Louvain L'obtenments on the velocity of sound in liquid oxygen and nitrogen and mixtures of nitrogen tion de températures de un cent millième de 23 and oxygen under high pressures ): 295-306 degré absolu et la physique nucléaire aux très [ ~ ] . — Measurements on the velocity of sound basses températures: 88 ('60) No. 1, 25-28 in gaseous normal hydrogen up to 75 atm 23)34) [m. fläm. Zusammenfassg.]. — Etude expéri28 ): 1960, Annexe 1 ('62) 91-97 [ ~ ] . - Study mentale sur le mécanisme de66 l'absorption 113 of the magnetic shielding properties of some acoustique dans les résonateurs ) ) : No. 3, 21-26 [ ~ ] . — L'absorption acoustique dans materials at low temperatures by means of 66 113 paramagnetic electron resonance37)86) : 203-14 des tubes capillaires ) ): 90 ('62) No. 1, 11[ ~ ] . — Comparaison du mouvement amorti 15 [ ~ ] . — Nouvelles applications techniques d'un disque horizontal et d'un disque ver- de la supraconductibilité: No. 4, 29-32 [ ~ ] . tical dans les gaz68): 243-50 [m. engl. Zusam- — Toepassingen van de supergeleiding in de menfassg.]. — Moisture absorption on thermal elektronica en de kernphysica 74 ) : 92 ('64) insulating materials 66 ) 23 ) 41 ): 1961, Annexe 3, No. 3/4, 31-38 [m. französ. Zusammenfassg.]. 107-22 [m. französ. Zusammenfassg.]. — Colloques int. Centre nation. Rech. sei. Mesures sur les propriétés électriques et magné-

v a n Itterbeek tiques de couches minces à basse température : 61.1955 ('56) 78-81 [m. engl. Zusammenfassg.]. — Mesures sur la variation de la vitesse du son dans l'hélium gazeux en fonction de la pression au moyen de sons audibles 54 ) 34 ) : 77.1957 ('59) 543-47. - Une installation de production de champs magnétiques intenses puises 28 ) 119 ) 86 ): 166. 1966 ('67) 379-83. Communications Kamerlingh Onnes Labor. Univ. Leiden Measurements about the velocity of sound in hydrogen gas at liquid hydrogen temperatures 5 1 ): 216 ('32) 17-26. - Measurements about the velocity of sound in oxygen gas 51 ) 59 ): 29-38. — Measurements on the viscosity of oxygen gas at liquid oxygen temperatures 51 ) : 235a ('35) 7 S. — Measurements on the viscosity of helium gas between 293 and 1.6 °K 51 ) : 252a ('39) 13 S. - Influence of a magnetic field on the electrical resistance of iron films 36 ) 6 ) 63 ): 290b ('53) 9 S. - Measurements on the viscosity of mixtures of helium and argon 76 ) 6 ): 292a ('55) 8 S. - Measurements of the viscosity of helium gas at liquid helium temperatures as a function of temperature and pressure' 9 ) 6 ) 3 ) : 294b ('55) 5 S. - Measurements on the coercive force of ticonal down to liquid helium temperatures 63 ) 6 ): 295a ('55) 5 S. — Apparatus to measure the velocity of sound in liquids down to liquid helium temperatures with the optical method 6 ) 62 ): 295d ('55) 4 S. Communications Kamerlingh Onnes Labor. Univ. Leiden, Suppl. On the dependency of Cp/Cv on pressure for hydrogen gas deduced from measurements of the velocity of sound a t liquid hydrogen temperatures : 70 ('33) 7-12. — Le second coefficient du viriel et les chaleurs spécifiques de l'hélium aux températures de l'hélium liquide: 13-18. Cryogenics Density of liquid oxygen as a function of pressure and temperature 1 0 3 ): 1 ('60/61) Nr. 2. - The velocity of sound in liquid argon and liquid nitrogen at high pressures 23 ): 199-202, 226-28 [m. franzos., deutscher u. russ. Zusammenfassg.]. — Measurements of the pressure dependence of liquid normal hydrogen 103 ): 2 ('61/62) 17-19, 21 f. — The variation of the density of liquid nitrogen and liquid oxygen as a function of pressure 103 ): 79f. — Viscosity measurements in liquefied gases112)6»): 205-08, 210f. [m. franzôs., deutscher, ital. u. russ. Zusammenfassg.]. — A cryostat for temperatures between 14 and 300 °K adaptable for experiments a t high pressure 103 ) 85 ) 92 ): 4 ('64) 8-11, 50-53 [ ~ ] . — The use of graphite thermometers in heat conductivity experiments below 1 °K 3 1 ) 65 67 ) ): 354-57, 396-400 [ - ] . - A sensitive design for pressure measurements up to 3,000 kg/cm 2 92)103)85): 5 ('65) 85-88, 102-06 — Velocity of sound in liquid hydrogen 23 ) 21 91 ) ) : 207-12, 221-24 [ - ] . - Nuclear spin-

2197

lattice relaxation time in copper below 10 - 2 °K 3i)72)i24). 7 ( . 6 7 ) 336-40. Experientia Measurements on the electrical resistivity of thin nickel films 39 ): 3 ('47) 278f. [m. französ. Zusammenfassg.]. Industrie chim. belge Les ultrasons utilisés comme méthode de mesure des grandeurs thermodynamiques des gaz et des liquides: 17 ('52) 562-64. — Analyse de gaz de mines de la Campine Belge 69 ): 579f. — Les recherches aux basses températures et la physicochimie: 20 ('54/55) No. spéc. 1 (27e Congr. de Chim. industr.) 399-402. — Liquéfaction de l'air avec pré-refroidissement au fréon 2266) : 403. — La conductivité thermique de l'état solide aux basses températures 6 7 ): 29 ('64) 905-10 [m. fläm., engl. u. deutscher Zusammenfassg.]. — Mesures de la conductibilité thermique à des températures inférieures à 1 °K 65 ) 31 ) 67 ): 128688. J . acoust. Soc. America Measurements with ordinary sound and ultrasonics carried out in the Physical Laboratory of the University of Louvain: 29 ('57) 584-87. J . Physique et Radium Mesures sur les propriétés cinétiques et calorifiques de l'hélium gazeux aux températures de l'hélium liquide: (7) 9 ('38) 313-18. - Mesures sur la viscosité de l'oxygène dans un champ magnétique et pour des très basses pressions 18 ): 457-61. — Résultats d'expériences de désorption 26 ) : (8) 1 ('40) 25-28. — Résonance paramagnétique électronique dans du charbon du "Donetz" 3 7 ) 110 ) : 17 ('56) 140-42. - Mesures sur les propriétés électriques et magnétiques de couches minces à basse température: 241-49 [m. engl. Zusammenfassg.]. — Le temps de relaxation transversale de la résonance paramagnétique électronique du diphénylpicrylhydrazyl entre 1,5 °K et 300 °K 37 ) 110 ): 18 ('57) 417-21. Mesures sur la variation du champ coercitif en fonction de l'angle dans des couches en nickel condensées dans le vide 31 ): 19 ('58) 113-18. — Résonance ferromagnétique dans les films de permalloy 34 ) 83 ) 109 ): 21 ('60) 81-84 [m. engl. Zusammenfassg.]. — Résonance ferromagnétique dans un alliage Fe-Ni sous forme de oouches minces 83 ) 34 ) 109 ): 22 ('61) 19-22 [•—]. — Résonance ferromagnétique dans les couches minces de permalloy 109 ) : 24 ('63) 31518 — Expérience de désaimantation nucléaire 31 ) 12 ): 577-80 [ ~ ] . Jaarb., Eoninkl. vlaamse Acad. Wet., Letteren en schone Künsten België In memoriam H. A. Kramers (1894-1952): 1952, 268f. Mededelingen koninkl. vlaamse Acad. Wet., Letteren en schone Künsten België The absorption of sound in gases applied to collision kinetics: 1940, Nr. 2, 22 S. - Over de adsorptie van H 2 0 - en D 2 0-damp aan glas104) : Nr. 9, 15 S. — Over het verband tussen adsorptie en catalytische werking van metalen:

2198

v a n Itterbeek

3 ('41) Nr. 10, 20 S. — Expansie- en desorptieproeven in verband met de koude-techniek der kleine laboratoria: 5 ('43) Nr. 1, 17 S. [m. französ. Zusammenfassg.]. — Over de nieuwe installatie voor vloeibaar helium in het Natuurkundig Laboratorium der Leuvense Universiteit: Nr. 10, 13 S. — Eigenschappen van zeer dünne metaallaagjes als functie van de temperatuur, 1: Electrische weerstand van koperlaagjes als functie van de temperatuur 3 9 ): Nr. 15 [a], 21 S.; ~ 2: Verandering van den electrischen weerstand van dunne koperlaagjes onder den invloed van een magneetveld 8 ): Nr. 15 [b], 35 S. — Enkele meetingen over zeer dunne metaallaagjes verkregen door rechtstreekse verdamping 76 ): 6 ('44) Nr. 9, 25 S. — Metingen over actieve adsorptie aan nikkel en zilver: 8 ('46) Nr. 1, 1-7. — Measurements on van der Waals- and activated adsorption on nickel and silver sheets®4)107): 8-24. — Measurements on the electrical resistivity of iron films at low temperatures 39 ) 6 '): 12 ('50) Nr. 1, 7 S. — A small helium liquefier of the expansion type 39 ): Nr. 10, 3-6. — Measurements on the helium content of monazite of Belgian Congo' 9 ): 7-9. — Measurements on the oxidation of thin metallic films (nickel, iron, and lead) 39 ) 35 ): Nr. 16, 17 S. - De physica van heden is de techniek van morgen: Nr. 18, 8 S.

Mémoires Soc. roy. belge Ing. et Industriels, Sér. B La recherche scientifique dans le domaine du froid: 1945, Nr. 1, 13-. - L'état supraconducteur des métaux: 47-51. Nature [London] Viscosity of nitrobenzene: 130 ('32) 399f. - A method of determining the state of degeneration of a gas: 137 ('36) 109. — Determination of the relaxation time for the vibrational energy of carbon dioxide 64 ) : 140 ('37) 850f. - Viscosity of light hydrogen gas and deuterium between 293 °K and 14 °K 1 8 ): 142 ('38) 793 f. - Liquefaction of helium: 143 ('39) 560. — Adsorption of helium gas on active charcoal between 4.2° and 1.78 °K 26 ) 10 ): 144 ('39) 249. - Activated adsorption of hydrogen in the neighbourhood of the Curie point 64 ) 107 ): 156 ('45) 668. - Resistivity of thin nickel films at low temperatures 39 ): 158 ('46) lOOf. - Sound velocity and temperature change of molecular association 8 ) : 162 ('48) 61 I f . - Velocity of sound in liquid hydrogen 105 ): 163 ('49) 399. - Ultrasonic absorption in normal and para-hydrogen 106 ) : 167 ('51) 477 f. — Thin glass layers as supports for electron microscopy39)101)9«): 170 ('52) 795f. Measurements on superconductivity in thin tin films 39 ) 37 ) 80 ): 171 ('53) 834. - Determination of the structure factor of thin tin films from superconductivity measurements 39 ) 37 ) — Liquid air plant with propane precooling o°): 172 ('53) 952. - Prof. W. H. Keesom: 177 circuit««): 13 ('51) Nr. 3,12 S. - Measurements ('56) 825 f. on superconductivity of thin tin layers, l 38 ) 37 Natuurwetenschappelijk Tijdschr. Het ver): 14 ('52) Nr. 5, 3-16; ~ 2: Critical current 39ja7). 17_28. - Charakteristische elektrische krijgen van lage temperaturen en de belangund magnetische Eigenschaften dünner Me- rijkste ontdekkeningen gedaan dank zij deze tallschichten«): 15 ('53) Nr. 3, 15 S. [m. fläm. nieuwe techniek: 15 ('33) 21-27. - De inZusammenfassg.]. — De Kirchhoff-Helm- stallatie voor vloeibaar helium in het Natuurholtz absorptie van hoorbaar geluid in cylin- kundig Laboratorium te Leuven: 21 ('39/40) dervormige buizen« 4 ) 41 ): 16 ('54) Nr. 7, 15 S. 233-39. — Over het verband tussen catalyse en adsorptie: 25 ('43) 15-23. — Experimented opstellingen voor het meten Nederlands Tijdschr. Natuurkunde Acoustivan paramagnetische relaxatie en resonantie, alsmede van magnetische kernresonantie in sche relaxatieverschijnselen in fluida bij lage het Leuvens Laboratorium, 1: Paramagne- temperaturen: 21 ('55) 349-63. tische relaxatie 37 ): 17 ('55) Nr. 1, 22 S.; ~ 2: Physica Measurements on the viscosity of Paramagnetische elektronenresonantie in oxygen gas at liquid oxygen temperatures 61 ) : 37 110 zwakke magneetvelden ) ): 19 ('57) Nr. 6, 2 ('35) 97-103. — Mesures sur la viscosité de 43 S.; ~ 3: Paramagnetische kernresonantie l'oxygène gazeux à basses températures 1 8 ): 3 37)8«). 22 ('60) Nr. 2, 44 S. [m. engl. Zusam- ('36) 275-81. — Preliminary experiments on menfassg.]. — Opstelling voor adiabatische the Simon desorption method between temdemagnetisatie in het Leuvens Laboratorium peratures of 90 and 40 °K 104 ): 666-71. voor Lage Temperaturen 7 ) 3 1 ): 21 ('59) Nr. 13, Further experiments on the Simon desorption 9 S, [ ~ ] . — Vraagstukken ontstaan bij de method between temperatures of 90 and 40 °K opbouw van een metalen apparatuur voor (Influence of equilibrium pressure) 104 ): 954adiabatische demagnetisatie* 5 ) 31 ): 26 ('63) Nr. 58. — Measurements with ultrasonics on the 6, 12 S. — Opstelling voor het opwekken velocity and absorption of sound a t ordinary en het meten van zeer hoge magnetische vel- and low temperatures« 4 ): 4 ('37) 207-15. den of pulsvelden 45 ) 66 ) 72 ): 26 ('64) Nr. 6, 16 S. Determination of adsorption isotherms of [ ~ ] . — Pressure dependence of the volume hydrogen on charcoal between 90 and 50 °K, of a cylindric thick walled pressure bomb with in connection with desorption experiments 26 ): parallel closed ends 103 ) 50 ): 27 ('65) Nr. 3, 15 S. 389-402, 617 f. — Measurements on the veloc[m. fläm. Zusammenfassg.]. — Analysis of the ity and absorption of sound in various gases equation of state of liquid normal and para- between + 1 0 0 °C and - 1 0 0 °C. Influence of hydrogen. Calculation of the thermodynamic pressure on the absorption« 4 ) : 609-16. — Measquantities 103 ) 50 ) 92 ) 9 ): 28 ('66) Nr. 2, 29 S. urements on the absorption of oxygen on

van Itterbeek glass at liquid oxygen temperatures 26 ): 63138. — Adsorption isotherms and heats of adsorption of oxygen and carbon oxide on charcoal in the temperature range 90-50 °K 26) : 1169-80. — Measurements on the absorption of sound in carbon dioxide gas. Determination of the relaxation time for the vibrational energy as a function of the temperature 64 ): 5 ('38) 153-60. — Measurements on the viscosity of helium gas between 293 and 1.6 °K 61 ): 257-69. — Influence of a magnetic83 field on the absorption of sound in oxygen gas ): 298-304. — Adsorption isotherms and heats of adsorption of helium gas on charcoal between 20 and 6 °K. New desorption experiments 26 ): 529-40. — Measurements on the velocity of sound as a function of pressure in oxygen gas at liquid oxygen temperatures. Calculation of the second virial coefficient and the specific heats6*): 593-604. — Measurements on the velocity and the absorption of sound in gaseous nitric oxide in a magnetic field"): 640-42. — Measurements on the velocity of sound in gaseous argon and deuterium, respectively, at liquid oxygen and hydrogen temperatures. Calculation and discussion of the second virial coefficient of argon69): 845-54. — Measurements on the absorption and the velocity of sound in hydrogen, deuterium, helium and neon gas93): 889-97. — Measurements on the viscosity of hydrogen and deuterium gas between 293 and 14 °K 18 ): 938-44. — Measurements on the viscosity of argon gas at room temperature and between 90 and 55 °K 69 ): 1009-12. Measurements on the adsorption of light and heavy 26hydrogen on charcoal between 90 and 17 °K ): 6 ('39) 49-58. - Measurements on the absorption of sound in C0 2 gas, in C0 2 containing small quantities of H 2 , D2, H 2 0, D a O and also in 13mixtures of C0 2 and 0 2 ; colli64 sion efficiencies ) ): 511-18. — Liquefaction of helium26): 728-36. — Measurements on the adsorption of helium gas on active charcoal between 4.22 and 1.78 °K 26 ) 10 ): 951-60. Measurements on the adsorption of different gases on copper at liquid oxygen and liquid hydrogen temperatures and at low pressures10): 7. ('40) 17-28. — Measurements on the absorption of sound in 0 2 gas and in C0 2 gas containing small quantities of H 2 0, D 2 0 and Ne. Relaxation times for the vibrational 64 energy69 ): 125-30. — Viscosity of liquid deuterium ): 208. — Measurements on the viscosity of neon, hydrogen, deuterium and helium as a function of the temperature between room temperature and liquid hydrogen temperatures 69 ) : 265-72. — Measurements on the viscosity of gases for low pressures at room temperature and at low temperatures 69 ): 27383. — Measurements on the surface tension of liquid deuterium: 325-28. — Bestimmung der inneren Reibung von schwerem und leichtem Methan zwischen 322 und 90 °K: 831-37. — Die StoBanregung intramolekularer Schwin-

2199

gungen in C02-Gas unter dem Einfluß von Fremdgasen als Funktion der Temperatur 64 ): 909-20. — Sound absorption in light gases64) : 938-44. — Bestimmung der inneren Reibung von flüssigem Wasserstoff und Deuterium 6 ') : 8 ('41) 133-43. — Some remarks concerning the viscosity of liquid hydrogen and deuterium in connection with the theory of EwellEyring 69 ): 522-24. — La formation du méthane en rapport avec l'adsorption activée par le nickel et le cuivre de l'hydrogène et de l'oxyde de carbone26) : 810-24. — Détermination de la constante diélectrique du deutérium liquide84): 9 ('42) 339-44. — Mesures sur l'absorption et la vitesse de propagation du son dans l'hydrogène 196 léger et l'hydrogène lourd entre 300 et 60 °K ): 345-55. - Détermination expérimentale du rendement de la liquéfaction de l'hélium par la méthode d'expansion69)64) : 10 ('43) 90-96. - Mesures sur la constante diélectrique de quelques gaz non polaires (H 2 , DJ, He, 0 2 et l'air) et CO entre la température ordinaire et 20 °K M ): 173-84. — Mesures sur la vitesse de propagation du son dans CO et D 2 en fonction de la pression aux températures de l'oxygène et de l'hydrogène liquide. Second coefficient du viriel de D298) : 481-92. — Mesures sur la constante diélectrique de C0 2 gazeux jusque 10 atm. 84 ) : 11 ('44/ 46) 43-48. — Mesures sur la résistance électrique de 39 films minces en cuivre, en argent et en plomb ) : 78-90. — Mesures sur la résistance39 électrique de films métalliques superposés ) : 465-69. — Quelques mesures sur des films minces de nickel39): 470-74. — Mesures sur la constante diélectrique de l'anhydride carbonique, de l'ammoniaque ainsi que de mélanges20): 12 ('46) 97-104. - Résistance électrique de films en argent dans un8 champ magnétique aux basses températures ): 16376. — Mesures sur la vitesse du son dans l'ammoniaque gazeux60): 241-44. — Measurements on the viscosity of gas mixtures69)61) : 13 ('47) 88-96. — Measurements on the thermal diffusion in gas mixtures at low temperatures 69 61 ) ) : 231-39. — Measurements on the thermal molecular pressure difference for hydrogen and deuterium gas at low temperatures 38 ) : 289-304 [m. franz. Zusammenfassg.]. — Measurements on the thermal molecular pressure difference in gases (H 2 , D 2 , He and Ne) at elevated temperatures 38 ) : 422-28. — Measurements on the dielectric constant of carbon dioxide as a function of pressure and temperature 20 ) : 459-64. — Measurements of the dielectric constant of gaseous ammonia, carbon oxide and hydrogen as a function of pressure and temperature 20 ): 14 ('48) 349-56 [m. — Velocity of sound franz. Zusammenfassg.]. in liquid oxygen8): 542-44. — Measurements on the velocity of sound in some organic liquids at low temperatures 8 ): 609-16. — Measurements on 39 the electrical resistivity of thin metallic films ): 15 ('49) 80-82. - Measure-

2200

v a n Itterbeek

ments on the negative temperature coefficient mixtures with helium at the boiling point of of nickel films 39 ) 17 ): 433-36. - Velocity of hydrogen 5 ) 100 ): 25 ('59) 9-24. - Viscosity of sound in liquid nitrogen 8 ) 105 ): 624-26. — Meas- binary mixtures of hydrogen isotopes and urements on the absorption of ultrasonics in mixtures of helium and neon 75 ) 102 ): 205-16. — water 81 ): 897-905. - Nickel films used as Measurements on the velocity of sound in thermometers at low temperatures and super- argon under high pressure 23 ) 40 ): 640-44. — conductivity of lead films 39 ) 67 ) 17 ): 962-70. - Sound velocity measurements in liquid argon Further experiments on the thermal diffusion under high pressure 40 ) 23 ) 34 ): 1255-58. - Denof gases at low temperatures 95 ): 16 ('50) 329- sity of liquid nitrogen and argon as a function 32. — Measurements on the thermal diffu- of pressure and temperature 103 ): 26 ('60) 931sion of Ne-H 2 , Ne-D 2 and Ne-He mixtures at 38. — Velocity of ultrasonic waves in liquid liquid hydrogen temperatures 95 ) 6 ): 669-77. — normal and para-hydrogen 23 ) 21 ): 27 ('61) 111Measurements on the electrical resistivity of 16. — The specific heats and compressibilities thin iron films at liquid helium tempera- of liquid normal and para-hydrogen 23 ): 1202tures 57 ) 6 ): 907-14. — Measurements on the 08. — On the increase of the boiling temperaviscosity of liquid helium by means of the ture of liquid oxygen in a magnetic field 31 ) 12 ): oscillating disc method 95 ) 6 ): 17 ('51) 50-62. - 28 ('62) 353-56. - Magnetic susceptibility of Thermal diffusion in H 2 -D 2 - and H 2 -He-mix- zinc and brass between room temperature and tures at low temperatures 95 ) 75 ): 938-42. — 1.2 °K 5 3 ): 721-25. - Velocity of sound in Measurements on the current sensitivity of liquid oxygen and liquid nitrogen as a functhe electrical resistance of condensed iron tion of temperature and pressure 23 ): 861-70. films at low temperatures 57 ) 36 ) 6 ) 63 ): 18 ('52) 137-44. — Influence of a magnetic field on the — Temperature dependency of the112rotationalelectrical resistance of iron films 36 ) 6 ) 63 ): 771- relaxation frequency of hydrogen ): 29 ('63) 79. — Measurements on the viscosity of mix- 370-77. — Measurements on the equation of argon and methane up to tures of helium and argon 75 ) 6 ): 19 ('53) 517-24. state of liquid 2 300 kg/cm at low temperatures 103 ) 85 ): 742-54. — Measurements on thermal diffusion with 34 64 — Pressure dependence of the resistivity of the use of ultrasonics ) ): 525-34. — Meas103 92 urements on the viscosity of helium gas at germanium ) ): 757-63. — The velocity of and para-hydrogen as liquid helium temperatures as a function of sound in liquid normal 23 21 temperature and pressure 79 ) 6 ) 3 ): 1158-62. — a function of pressure ) ): 965-73. - Static of D P P H between 294 Measurements on the electrical resistivity of magnetic susceptibility 53 thin nickel films at very low temperatures 39 ) and 1.2 °K ): 30 ('64) 157-60. - The ad37 78 ) ): 20 ('54) 1-6. - First sound measure- sorption of normal and equilibrium hydrogen at liquid hydrogen temperaments in liquid helium 34 ): 133-38. — Appara- and deuterium44 23 tus to measure the velocity of sound down to tures on glass ) ): 324-32. - The difference liquid helium temperatures with the optical in vapour pressure between normal and equiof normal method 6 ) 62 ): 307-10. — Measurements on the librium hydrogen. Vapour pressure 103 92 85 velocity of sound in helium gas at liquid he- hydrogen between 20 and 32 °K ) ) )'): 34 1238-44. — Vapour pressure of saturated lium temperatures ): 767-72. — Determina85 103 92 - Vapour tion of the velocity of ultrasonic waves in liquid methane ) ) ):9 1896-900. 6 1 47 pressure of liquid argon ) 103 ) 92 ) 85 ): 2119-22. liquid helium by the optical method ) ) ): 21 ('55) 860-66. — Further measurements on the Low temperature adsorption of normal and and deuterium on silver magnetic susceptibility of germanium down equilibrium hydrogen 44 23 to liquid helium temperatures 30 ): 22 ('56) 649- and graphite ) ): 31 ('65) 709-18. - Sound velocity measurements in liquid methane 23 ) 56. — Measurements on the viscosity of neon- 91 21 7S argon mixtures between 300 and 70 °K ): ) ): 1643-48. — The influence of neutron irradiation on the superconductive properties 785-90. — Measurements on the velocity of 74 68 94 ultrasonic waves in helium at 1 °K with of tin and indium foils ) ) ): 32 ('66) 484-88. 34 90 different frequencies ) ): 23 ('57) 63f. - — Viscosity of liquefied gases at pressures Measurements on the magnetic susceptibility above one atmosphere 112 ) 43 ): 489-93. — of white tin and copper down to liquid helium Electron paramagnetic resonance in neutrontemperatures 3 0 ): 169-72. — Viscosity of mix- irradiated DPPH 1 0 9 ) 2 ) 6 8 ): 494-96. - Sound tures of H 2 and H D between 300 and 14 °K 7 5 ): velocity measurements in liquid argon, oxygen 838—42. — Measurements on the velocity of and nitrogen 23 ) 21 ) 91 ): 611-20. - Measurements ultrasonic waves in liquid helium 34 ) 90 ): 905f. of the thermal diffusion factor in the pres— Measurements on the velocity of sound in sure range 1-400 torr 2 3 ) 1 6 ): 621-24. - The helium gas at liquid helium temperatures. molar volume of liquid normal hydrogen Calculation of the specific heats 56 ): 24 ('58) in the temperature range between 21 and 59-67. — The viscosity of gaseous helium, 40 °K at pressures up to 150 atm 103 ) 92 ) 50 ): 1591neon, hydrogen and deuterium below 80 °K 22) 600. — Electron spin resonance studies of 5 52 1U ) ) ): 557-76. - The viscosity of gaseous neutron-irradiated DPPH 109 ) 2 ) 88 ) 68 ): 2115-22. H D below 80 "K 22 ) 5 ) 52 ) 111 ): 1102-04. - The — Measurements on the magnetic anisotropy isotherms of the hydrogen isotopes and their of single crystals of Bi Te , Sb Te and com2 3 2 3 pounds of them, between room temperature

v a n Itterbeek and 1.3 °K 24 ) 48 ): 2123-28. - Viscosity of liquefied gases at pressures between 1 and 100 atm 4 3 ) 1 1 2 ) 1 5 ): 2171 f. Demagnetizing effects in paramagnetic resonance. The g37 89 factor of D P P H ) ): 33 ('67) 207-11. The influence of alpha-irradiation on the transition temperature of superconductive tin, indium and thallium foils 74 ) 14 ) 118 ): 34 ('67) 361-64. — The adsorption of helium, argon and nitrogen on graphite 44 ) 23 ) : 429-37. — Electron spin resonance of single crystals of monoethylenediamine copper(II) sulfate88)109)121) 122 ) : 456-60. — Sound velocity measurements in liquid methane as a function of pressure 91 ) 21 23 ) ) : 35 ('67) 162-66. - Properties of epitaxially grown silver and gold films and the influence of alpha-irradiation 114 ) 49 ): 40 ('68) 77-90. Physics Letters Heat conductivity of copper below 1 °K 31 )« 5 ): 8 ('64) 99f. - Rotational relaxation times in para-hydrogen 112 ) 11 ): 13 ('64) 131 f. — Rotational relaxation in oxygen gas 112 ) 11 ): 16 ('65) 34. - Rotational relaxation time for hydrogen-helium system 11 ) 112 ): 19 ('66) 642f. Portugaliae Physica Mesures sur des films minces en argent 39 ) : 2 ('46) 125-37. — Mesures sur les courbes de résonance ultrasonores dans les liquides 8 ): 235-42. Proc. physic. Soc. Velocity of sound in mixtures of argon, helium, and hydrogen at low temperatures 2 '): 58 ('46) 615-23. Proc. physic. Soe., Sect. B Measurements on the velocity of sound in mixtures of hydrogen, helium, oxygen, nitrogen, and carbon monoxide at low temperatures 27 ) : 62 ('49) 62-69. Measurements of the velocity of sound in liquid argon and liquid methane 106 ): 800-04. Proc. Univ. Durham philos. Soc. Measurements on the absorption of sound in water at 358, 540, 1074 and 1790 kc/sec 8 ) : 10 ('38/50) 547-55. Rapport annuel, Inst, interuniversit. Sci. nucléaires Research program in the field of nuclear magnetism with the Louvain 70 kW electromagnet: 9 ('61) 142-47. — Application du phénomène d'adsorption à la technique du vide: 10 ('61) 207-16. Rep., Nation. Bur. Standards Current sensitivity and other characteristics of metal films a t low temperatures: 1952, 4 S. Revue Acoustique Méthode expérimentale de mesure de la vitesse de propagation du son à basse température: 2 ('33) 81-. Revue, Soc. roy. belge Ing. et Industriels Excitation d'ondes de spin dans des couches minces ferromagnétiques 109 ) 2 ): 1965, 228-30 [m. engl. Zusammenfassg.]. Suppl. NUOTO Cimento Déterminations des grandeurs thermodynamiques et cinétiques des gaz et des gaz condensés aux basses tem-

2201

pératures: (9) 7 ('50) 218-28. - Velocity of sound in liquid helium: (10) 9 ('58) 291-96. Technisch-wetenschappelijk Tijdschr. Toekomstmogelijkheden van vloeibaar gemaakte gassen als brandstof voor motorvoertuigen: 10 ('41) 80-83. — Prospects of the problem of synthetic oils in Belgium: 11 ('42) 37-44 [ ]. — Over de techniek der zeer läge temperaturen: 13 ('44) 21-28. — Atoomkernverschijnselen: 14 ('45) 57-62. — Physica van het atoom: 16 ('47) 47-51. Wis- en natuurkund. Tijdschr. Viscositeitsmetingen met nitrobenzol: 6 ('32) 135-43. — Over de twee vloeistoftoestanden: 144-47. — Over de traagheid van een electromagnetisch relais: 7 ('34) 101-. — Massabepaling van moleculen op grond van viscositeitsmetingen 18 ): 8 ('36) 44-48. — Absorptie van het geluid in lichtgassen: 10 ('40) 17-21. Z. angew. Physik Über die Bestimmung des inneren Feldes in Festkörpern mit Hilfe einer statischen Methode: 24 ('68) 302-05 [m. engl. Zusammenfassg.]. Z. Instrumentenkunde Verfeinerung der elektrostatischen Methode zur Messung der Dielektrizitätskonstanten von Gasen 84 ): 63 ('43) 167-69. Z. physik. Chem., Abt. B Messungen über die van der Waalssche Adsorption von Gasen (N2, Ar, CO, CH 4 , H 2 0 , D 2 0 usw.) an Glasplatten 1 » 4 ): 48 ('41) 131-47; ~ ( H „ D 2 , CH 4 , N 2 und Ne) an Nickelblättchen 10 ): 50 ('41) 128-42. — Über die katalytische Wirkung von Nickel und Kupfer-Thorium bei der Bildung von Methan und schweren Gasen 26 ): 341-60. Ferner einige kleinere Schriften, Lehrkurse usw.

Mit: *) G. M. V. van Aardenne;4 *) R. vanAndekercke; *) H. J. M. van Beek; ) H. van Beelen; •) J. J. M. Beenakker; •) G. J. van den Berg; ') J. 10 van Biesen; ') A. de Bock; *) J. de Boelpacp; ) J. Borghs; ") T. K. Bose; ") G.Brandt; ») P. deBruyn; ") Y. Bruynseraede; ") M. van Cauteren; ") H. Cauwenbergh; ") R. Celis; ") A. Claes; ") J. deClerck; ") K. de Clippeleir; ") A. Cops; ") J. M. J. Coremans; «') W. van Dael; ") N. vanDeynse; ") - ; ") W. van Dingenen; ") W. van Doninck; ••) W. van Driessche; ") G. Droogmans; 8t) W. Duchateau; ") A. Dupri; "*) H. vanEe; >a) H. van Engelen; »*) G. Forrez; ••) M.Francois; ») B.Franken; ") L. van Gerven; **) E. de Grande; ") L. de Greve; ") W. Grevendonk; ") P. Godeniv; ") - ; ") J. Hellemans;") R. Hellemans; ") H. Hendrickx; ") F. Heremans; ") J. Herfkens; ") C. van Herinokx; *•) W. (Hendriks-)van Itterbeck; ") V. Jansoone; ") W. H. Keesom; ") H. F. P. Knaap;")M. Labro;") J. de Laet;")L. de Laet; ") W.deLaet;") R.Lambeir;") H. van Lambert; ™) J. A. van Lammeren; ,0) L. Lauwers; •') J. van Lierde;•*) W. Limburg;") D. A. Lockhorst; •') P. Mariens; ") L. Michiels; ••) H. Myncke; «') L. van Neste; ••) J. Nihoul; •») O. vanPaemei; *•) W. Peelaers; ") B. Peeters; ") G. Pitsi; ») R. Pollentier; ")L. vanPoucke; ")A. O. Rietveld; '•) J. Roose; ") W. de Rop; '•) K. Sabbe; ") F. W. Schapink; ") J. Schepers; ") P. Slootmakers; ") C. G. Sluijter; ") J. Smits; ") J. Spaepen; ••) K. Staes; ") L. Stals; ") F. Steffens; ••) S.

2202

van Itterbeek — Ivanenko

S u b r a m a n i a n ; M) J. T a l p e ; ••) M. T e i r l i n c k ; ") J. T h o e n ; ") F. T h e e u w e s ; •») L. T h y s ; ") W. T h y s ; ••) A.M d e T r o y e r ; ••) C. A. F. T u1My n m a n ; ") Q. V a e s ; ) W. Y a n d o n i n c k ; »•) - ; ) F. H. V a r e k a m p ; M1) G. F. van V e e l e n ; 1 0 ! ) C.1MA. V e l d s ; "") O. V e r10b c k e ; »«) W. Y c r e y c k e n ; ) L. Verh a e g e n ; ") R. V e 10 r m a e l e n ; "') I.1MV e r p o o r t e n ; "•) R. V r a m b o u t ; ')11!J. W i t t e r s ; 1IS ) E. de W o l i ; m ) P. Z a n d b e r g e n ; ) H. Zink; ) J. Zink; »') R. C o p p e n s ; "') G. van D a m ; "•) J . D a v i d ; 1M "') E. D e p r e z ; »•) P. D i r v e n ; "•) I. de Grave; ) P. G r o b e t ; "») J. Moreau;1 ! s"«) Z . R a h m a n ; "•) Y. H. Tohao; H. V r e y s ; ) J. U y t t e n b r o c o k ; "•) P. Gepts. VI

IYANENKO, D m i t r i j Dmitrievic. Physik (theoret.). — Dr. d. physikal.math. Wiss.; seit 1927 Tätigkeit an Forschungs- u. Unterriehtsinstituten in Leningrad, Char'kov, Tomsk, Sverdlovsk u. Kiev; '42- Prof., Univ. Moskva; außerdem '49- wiss. Mitarbeiter, Inst. f. Geschichte d. Naturwiss. u. Techn., Akad. d. Wiss. d. UdSSR; Gastvorlesungen: Polen, Bulgarien, DDR, CSSR, Frankreich, Italien, Indien, Schweiz. — Staatspreis (UdSSR). *1904, Juli 29 (16), Poltava. Bildn. Wissenschaft u. Fortschr. 15 ('65) 514. Zum 60. Geb.tag A. F. K o n o n k o v , Fizika v Skole 1965, Nr. 1, 12f. (m. Bildn.). - A. A. S o k o l o v , P. A. K o r o l e v , Vestn. mosk. Univ., Ser. I I I 1964, Nr. 5, 93f. - Izvest. vyssich ucebnych Zavedenij, Tomsk, Fizika 1964, Nr. 6, 3-5 (m. Bildn.). H. (Redakt.) B. G. K u z n e c o v , Lomonosov, Lobacevskij, Mendeleev. Ocerki zizni i mirovozzrenija [Lebenslauf und Weltanschauung Lomonosovs, Lobacevskijs und Mendeleevs] (Moskva-Leningrad '45). — (Redakt.) Sdvig urovnej atomnych elektronov i dopolnitel'nyj magnitnyj moment elektrona soglasno novejsej kvantovoj elektrodinamike. Sbornik statej [Termverschiebungen der Atomelektronen und magnetisches Zusatzmoment des Elektrons entsprechend der neuesten Quantenelektrodynamik. Sammlung von Aufsätzen] (Moskva '50); darin eig. Beitr.: Einleitung [russ.]. — (Redakt.) Novejsee razvitie kvantovoj elektrodinamiki. Sbornik statej [Neueste Entwicklung der Quantenelektrodynamik. Sammlung von Aufsätzen] (Moskva '54); darin eig. Beitr.: Einleitung [russ.]. — (Redakt.) Nelinejnaja kvantovaja teorija polja. Sbornik statej [Nichtlineare Quantentheorie des Feldes. Sammlung von Aufsätzen] (Moskva '59); darin eig. Beitr.: Einleitung [russ.]. — (Redakt.) Novejsie problemy gravitacii. Sbornik statej [Neueste Probleme der Gravitation. Sammlung von Aufsätzen] (Moskva '61); darin eig. Beitr.: 5-56: Einleitung [russ.].

MH. (Redakt.) Principy otnositel'nosti G. A. Lorenc, A. Puankare, A. Ejnstejn, G. Minkovskij. Sbornik rabot klassikov reljatfvizma [Relativitätsprinzipien von H. A. Lorentz, H. Poincaré, A. Einstein und H. Minkowski. Sammlung von Arbeiten der Klassiker der Relativität] (Moskva-Leningrad '35). S. Atomnoe jadro. Sbornikdokladovl Vsesojuznoj jadernoj konferencii [Der Atomkern. Sammlung von Berichten der 1. Kern-Konferenz der UdSSR] (Leningrad-Moskva '34) 5164: Das Modell des Atomkerns [russ.]. — Ocerki po istorii fiziki v Rossii [Studien zur Geschichte der Physik in Rußland] (A. K. Timirjazev) (Moskva '49) 297-302: Allgemeiner Abriß (Sowjetische Physik) [russ.]. — Dmitrij Ivanovic Mendeleev. 2izn' i trudy [Leben und Werk D. I. Mendeleevs] (S. I. Vol'fkovic u. a.) (Leningrad '57): Das periodische System der chemischen Elemente und der Atomkern [russ.]. — Max-Planck-Festschrift 1958 (B. Kockel, W. Macke, A. Papapetrou) (Berlin '59) 353-69: Bemerkungen zu einer einheitlichen nichtlinearen Theorie dèr Materie. — Ocerki razvitija osnovnych fiziceskich idej [Skizze der Entwicklung der physikalischen Grundideen] (A. T. Grigor'jan, L. S. Polak) (Moskva '59) 288-322: Grundgedanken der allgemeinen Relativitätstheorie [russ.]. — Iz istorii francuzskoj nauki. Sbornik statej [Aus der Geschichte der französischen Wissenschaft. Sammlung von Arbeiten] (B. G. Kuznecov, A. T. Grigor'jan) (Moskva '60) 156-81 : Die französische Schule der theoretischen Physik [russ.]. — Atti del Convegiio sulla relatività generale, Firenze 1965 (Firenze '66) (Pubblicazioni del Comitato nazionale per le manifestazioni celebrative del IV centenario della nascita di Galileo Galilei, II, 1): Gravitation and unified picture of matter [ ]. — Einstein-Symposium. Entstehung, Entwicklung und Perspektiven der Einsteinschen Gravitationstheorie (H.-J. Treder) (Berlin '66) 300-11 : Cosmology and local phenomena. Vorworte bzw. Einleitungen zu russischen Übersetzungen einiger ausländischer Fachbücher über Relativitätstheorie. W. Klassiceskaja teorija polja. Novye problemy [Die klassische Feldtheorie. Neue Probleme] (m. A. A. Sokolov) (Moskva-Leningrad '49) 432 S.; 2('51) 480 S.; deutsch: (Berlin '53) 12 + 347 S.; auch ungar., chines, u. rumän. Acta physica Acad. Sei. hung. A new conception of the gravitational field4)34): 14 ('62) 21-25 [m. russ. Zusammenfassg.]. Astrofizika Hypothesis concerning quark stars 18 ): 1 ('65) 479-82 [russ.]. Bol'sevik Zu den Ergebnissen der Diskussion über das Buch von B. M. Kedrov: Engels und die Naturwissenschaft: 1948, Nr. 8, 66-71 [russ.].

Ivanenko C.R. (Dokl.) Acad. Sei. IJRSS Constitutive parts of atomic nuclei: (N.S.) 1933, 50-54 [russ. u. engl.]. — Two remarks on the theory of jS-radioactivity: 19341, 537-39 [ ~ ] . On the transmutation of hydrogen into neutron: 1 9 3 4 I I , 155-57 [ ~ ] . Alpha particles in light nuclei 8 ): 1934IV, 275-77 — Electrodynamics and Dirac's theory of holes: 19351, 464-66 [ ~ ] . - Das Kraftgesetz zwischen schweren Teilchen 36 ): 12 ('36) 361—64. — Some remarks on the equations of the theory of showers 35 ): 19 ('38) 681 f. Simple applications of the Proca potential: 21 ('38) 31-33. — Generalized wave equation and classical mesodynamics 35 ): 26 ('40) 37-40. — Classical theory of the scattering of mesons: 28 ('40) 411-14. — Dipole character of mesons and polarization of vacuum 35 ): 35 ('42) 107-09. Dokl. Akad. Nauk SSSR Die Verteilung des Phosphors in den einzelnen Pflanzenteilen bei Versuchen mit dem radioaktiven Isotop 3 2 P 14 1 29 ) ) ): 58 ('47) 93-95. - Über metastabile Verbindungen elementarer Teilchen 35 ): 132932. — Neue Konsequenzen aus der Quantentheorie der Gravitation: 1633-36. — Zur Theorie des „leuchtenden" Elektrons 36 ): 59 ('48) 1551-54. — Zur Dynamik des Ionenaustausches2®)»)8): 60 ('48) 1189-92. - Zur Theorie der para- und ortho-Zustände der Elementarteilchen 35 ): 61 ('48) 51-53. - Statistisches Kernschalenmodell 30 ): 70 ('50) 60508. - Einfluß des Kernfeldes auf die Elektronenbewegung 30 ): 801-04. — Zur Theorie der Kernschalen 35 ): 74 ('50) 33-36. - Mehrfachbildung von Mesonen 21 ): 80 ('51) 357-60. — Über die Stabilität astronomischer Systeme 4 u ) ) : 565-67. - Doppelter ß-Zerfall 15 ): 81 ('51) 771-73. — Mehrfachprozesse und Nichtlinearität der Elementarteilchen 4 ): 84 ('52) 683-86. — Hypothese über neue Teilchen, das Elektrino 16 ): 87 ('52) 923-25. - Zur Theorie des periodischen Systems der Elemente 20 ) : 88 ('53) 45-48. — Bemerkungen zur nichtlinearen Mesodynamik 18 ) 20 ): 245—47. — Zur Theorie der IsotopenVerschiebung 16 ): 89 ('53) 253-56. - Volumeneffekt bei der Isotopenverschiebung in Wasserstoff und Deuterium 16 ): 91 ('53) 47-50. - Wechselwirkung zwischen Gravitation und Vakuum 4 ): 92 ('53) 731-34. — Anwendung der radiochromatographischen Methode zur Untersuchung der Dynamik der Austauschadsorption von Phosphationen auf anorganischen Adsorbentien 8 2e ) ): 95 ('54) 567-70. - Die Fundamentalgleichungen der Mesodynamik 18 ): 96 ('54) 39-42. — Theorie der Teilchen mit beliebigem Isotopenspin und die Fusionsmethode 34 ): 97 ('54) 635-37. - Kernmodell 16 ) 20 ): 100 ('55) 37-40. — Massenungleichheit bei den Elementarteilchen 4 ) 17 ): 105 ('55) 1192-95. Nichtlineare Verallgemeinerung der Dirac26 schen Spinorgleichung ): 106 ('56) 413 f. — Über die Anregung makroskopischer Schwingungen durch Quantenfluktuationen 35 ) 37 ): 111

2203

('56) 334-37. — Zur nichtlinearen Theorie der Elementarteilchen 4 ): 120 ('58) 995-98. — Alle Arbeiten russ. C.R. hebd. Séances Acad. Sei., Paris Sur la Constitution des noyaux atomiques: 195 ('32) 439-41. Istorija i Metodol. estestvenn. Nauk Zum Briefwechsel von P. N. Lebedev und B. B. Golicyn 38 ): 4 ('66) 307-09 [russ.]. Izvest. vyssich uiebnych Zavedenij, Tomsk, Fizika Bemerkungen zur Quantentheorie des nichtlinearen Mesonenfeldes 18 ) : 1961, Nr. 3, 109-21. — Zur Klassifizierung der Elementarteilchen 18 ) : 1963, Nr. 3,153-65. - Zur Theorie der nicht relativistischen Streuung zusammengesetzter Teilchen: 1964, Nr. 6, 130-35. Die Möglichkeiten einer einheitlichen Theorie : 1965, Nr. 3, 5-10. — Eine mögliche Interpretation der Hypothese von Dirac über die Abnahme der Gravitationskonstante auf der Grundlage einer neuen Lösung der EinsteinGleichungen 3 ) 7 ): 1966, Nr. 6, 119-21. - Einheitliche Symmetrieklassifizierung der Leptonen 26 ) 36 ) 7 ): 1967, Nr. 9, 49-53. - Fünfzig J a h r e sowjetische Gravitationsforschung: Nr. 10, 30-38. — Heuristische Hypothese über die Beziehung zwischen Kosmologie und Elementarteilchen: Nr. 11, 124f. — — Alle Arbeiten russ. J. Physics, Acad. Sei. USSR Zur klassischen Mesodynamik 36 ): 3 ('40) 57-64. — Remarks on the meson theory: 417-19. — The scattering of mesotrons by neutrons and protons according to Proca's theory 36 ): 4 ('41) 278. — Dipole character of the meson and the polarization of vacuum 36 ): 6 ('42) 175-79. Nature [London] The neutron hypothesis: 129 ('32) 798. — Recalculation of mass defects : 130 ('32) 892. — Interaction of neutrons and protons: 133 ('34) 981 f. — Interaction. of heavy nuclear particles 36 ): 138 ('36) 246. — Self-interaction of neutrons and protons 36 ): 684. — Classical dynamics of the meson: 144 ('39) 77. Naturwissenschaften Zur Bestimmung der Isotopenzahl 8 ): 20 ('32) 792f. Nuclear Physics On a possible connection between isobaric spin and strangeness and inversion properties of spinors 4 ): 13 ('59) 447-50. NUOYO Cimento Unified description of ordinary and isotopic space 34 ): (10) 6 ('57) 226-29. — On the influence of weak interactions on electromagnetic properties of fermions 4 ): 16 ('60) 556-59 [m. ital. Zusammenfassg.]. — On mesonic decays of t h e hypernucleus 3 H^ 2 2 ): 582-84. — Cosmology and elementary particles: 51 A ('67) 244f., Physical Rev. On the mathematical formalism of the theory of showers 36 ) : 53 ('38) 910. — Dipole character of the meson and the

2204

Ivanenko

difficulties of the meson theory 35 ): 60 ('41) 277 f. — Maximal energy attainable in a betatron") : 65 ('44) 343. - Further remarks on the difficulties of the meson theory: 66 ('44) 157. Physikalische Z. Sowjetunion Neutronen und Kernelektronen: 1 ('32) 820-22. — Zur Bestimmung der Isotopenzahl8): 2 ('32) 99f. — Zur Neutrinotheorie des Lichtes 36 ): 9 ('36) 692-95. — Bemerkungen zur zweiten Quantelung der Dirac-Gleichung36): 11 ('37) 590-96. — Bemerkungen zur Theorie der Wechselwirkung: 13 ('38) 141-50.

Vesta, mosk. Univ., Ser. Mat., Mech., Astron., Fiziki, Chim. Eindrücke vom Stand der physikalischen Wissenschaft in Italien: 12 ('57) Nr. 1, 196-98 [russ.]. Vesta, mosk. Univ., Ser. III Über die Hypothese der Ausdehnung der Erde 32 ): 16 ('61) Nr. 6, 83-87 [russ.]. — Vereinheitlichte Beschreibung der Isotopie- und der Raum-ZeitEigenschaften der Elementarteilchen7): 22 ('67) 106-08 [russ.].

Vopr. Filos. Die Entwicklung der Physik der Elementarteilchen: 1958, Nr. 5, 74-87 [russ.]. — Über ein einheitliches physikalisches Progr. theoret. Physics [Japan] On mesons Weltbild, die Unerschöpflichkeit der Materie and cosmology: 1965, Suppl. Extra Nr., und einige Probleme der Theorie der Elementarteilchen: 1959, Nr. 6, 74-87 [russ.]. 161-67. Sowjetwissenschaft Zur Theorie der ParaZ. Physik Zur Wechselwirkung der schweund Orthozustände von Elementarteilchen36): ren Teilchen36): 102 ('36) 119-31. 1949, Nr. 2, 151-54. - Über die Stabilität 2 . ¿ksper. i teoret. Fiziki Bemerkungen zur astronomischer Systeme 4 ) 11 ): 1958, Nr. 1,108- Theorie der Wechselwirkung zwischen Teil10. chen: 8 ('38) 260-66. — Über den mathematiSnppl. Nuovo Cimento Non-linear generali- schen Formalismus der Schauertheorie36): 639. zations of the field theory and the constant — Über die Dipolnatur der Mesonen und die of minimal length: (10) 6 ('57) 349-55. Schwierigkeiten der Theorie von Proca 36 ): 12 ('42) 473-78. — Neue Berechnung der Technika - Molodeíi An der Schwelle einer Isotopenverschiebung6): 18 ('48) 434-37. — einheitlichen Theorie der Materie (Interview): Einfang von langsamen /?-Elektronen durch 1958, Nr. 11, 29-33. - Das Rätsel der Gravi- die äußeren Atomschalen von schweren tation: 1959, Nr. 5, 11-13. — Die neuesten Atomen 21 ): 20 ('50) 91 f. - Über die InterProbleme der Gravitation: 1961, Nr. 11, 23-. pretation der Regularisation in der Quanten— — Alle Arbeiten russ. elektrodynamik12): 21 ('51) 563-66. - ßTrudy Inst. Istorii Estestvoznanija i Techn. Zerfall von Kernen des Typs 2 Z ~ J M 2 0 ) : 24 Albert Einstein zum Gedenken19): 5 ('55) ('53) 359-61. — Die nichtlineare Quanten3-32 [russ.]. — Historische Skizze der Ent- theorie des Elektrons 4 ): 383-88. — Zur wicklung der allgemeinen Relativitätstheorie: Theorie der Energieverluste geladener Teilchen bei Durchdringen eines Ferromagneti17 ('57) 389-424 [russ.]. kums39): 28 ('55) 291-96. — Bindungsenergie U.S. Atomic Energy Commiss. Theory of von Hyperfragmenten16): 30 ('56) 800f. the periodic system of the elements20): ÑSF- Zweinukleonen-Potential vom intermolekutr-2 ('53) 4 S. laren Typ und nukleare Sättigung 13 ): 31 ('56) Usp. Chim. Die Elementarteilchen und ihre 105-12. — Über eine neue Möglichkeit in der Neutrinotheorie4): 33 ('57) 910-12. - Anomale Wechselwirkung: 17 ('48) 545-64 [russ.]. Spinoren und Bosonen4): 36 ('59) 1279-85. Usp. fiziß. Nauk Kosmische Strahlung und Zur Berechnung der Gravitationsenergie24): die neuen „halbschweren" Teilchen: 19 ('38) 37 ('59) 868 f. — Über den Zusammenhang 322-52. - Das schwere Elektron: 20 ('38) von Isospin und „strangeness" mit dem Ver257-80. — Einführung in die Theorie der halten von Spinoren gegen Inversion 4 ): 876f. Elementarteilchen: 32 ('47) 149-84, 261-315. — Mesoatome28): 61 ('57) 27-43. - Die physi- — Möglichkeiten für Laboratoriumsversuche kalische Wissenschaft in Italien: 62 ('57) 523- zur Messung der Ausbreitungsgeschwindigkeit 37. — Der internationale Kongreß über Ele- der Gravitationswechselwirkung2)31): 38 ('60) mentarteilchen in Italien: 65 ('58) 331-49. — 1005-07. — Vertauschungsfunktion eines Planck-Feiern in Berlin und Leipzig: 66 ('58) nichtlinearen Mesonenfeldes18): 40 ('61) 1072neue Deutung des Gravitations523-34. — Die Theorie der Hyperfragmente 75. —4 Eine 2 2 )'): 68 ('59) 663-85. Die Klassifizierung feldes )34): 41 ('61) 1307-09. - 18Zur Klassifider Elementarteilchen36): 72 ('60) 765-98. - zierung der Elementarteilchen ): 44 ('63) Konferenz über die Theorie der Elementar- 587-91. — — Alle Arbeiten russ., einige m. teilchen, Uzgorod 1963 23 ): 83 ('64) 190-96. - engl. Zusammenfassg. — Alle Arbeiten russ. Znanie — Sila Gibt es Gravitationswellen ? Yestn. mosk. Univ. Einige wichtige An- i«)33)io). i 9 e i , Nr. 12, 6-12 [russ.]. wendungen der Theorie der ¿-Funktion 36 ): Ferner ein Beitrag in „Colloque int. Centre 1946, Nr. 2, 73-80 [russ.]. - Quantentheorie nation. Rech, sei." 91.1959 ('62) sowie einige der Gravitation36): 1947, Nr. 8,103-13 [russ.]. weitere Beiträge in Kongreßberichten.

Ivanenko — Ivanov, Dimitür

2205

Mit: ») V. B. Bagaev; ') V. B. Braginskij; ') V. S.19351, 11-16 [russ. m. franz. ZusammenBreïnev; *) A. M. Brodskij; ') A. F. Cander;fassg.]. — La plus probable orbite de la •) Y. A. Filimonov; ') B. N. Frolov; •) E.N. Gapon; ") T. B. Gapon; 10) M. E. Geroenätejn; petite planète (122) Gerda d'après les obser") L. P. Ginzburg; ") V. Grigor'ev; ls) B. K. vations en 34 oppositions de 1872 à 1934: 15 Kerimov; ") V. M. Kleèkovskij; ") N.N.Kolesnikov; ") A. S. Kompaneec; ") N. Korst; ('37) 301-05. ") D. F. Kurdgelaidze; ") B. G. Kuzneooy; ») S. Larin; ") V. Lebedev; ") V. A. Ljul'ka; ») Izvest. Akad. Nauk SSSR, Otdel. techn. Nauk Ju. Lomsadze; ") N. V. Mickevii; *•) M. Miria- Fragen des Zeitdienstes in der UdSSR: 1938, naävili; *•) A. I. Naumov; *') G. Pomerancuk; "•) G. E. Pustovalov; ") V. V. Raiinskij; 3») V.Nr. 2, 125-29 [russ.]. Rodiêev: ") G. I. Rukman; •») M. U. Sagitov; Scientia L'astronomie au service de la a3 ) M. F. Sirokov; ") H. [G.] A. Sokolik; •«) A. A. Sokolov; ••) A. A. Staroev; ") I. M. Ternov; pratique: 64 ('33) 274^81. ") P. I. Zjukov; *») Y. N. Cytovii. VI IVANOV, Dimitür P. Chem. (org.). IV-VI IYANOY, Aleksandr Aleksan- - 1920-21, '24-25 Assist., '26-29 Doz., drovic. Astron. — 1908-12 außerord. '29-37 außerord. Prof., '37-68 ord. Prof., Prof., '12-29 ord. Prof., Univ. Petersburg Dir. d. Org.-Chem. Inst., Univ. Sofija. Leningrad; '19-30 Dir., Observât. Pul- — '32 Prix Houzeau (Acad. Sei. Paris); kovo; '30-38 stellvertr. Dir., Unions-For- '59 Georgi-Dimitrov-Preis (Volksrepublik schungsinst. f. Metrologie, Leningrad; Bulgarien). '35-39 Prof., Hydrograph. Inst. d. Haupt*1894, Okt. 13, Makotzevo (Sofija). verwaltg. „Nördl. Seeweg" im SeeflottenErfindung Ivanov-Reaktion; vgl. dazu: ministerium d. UdSSR. — '35 Verdienter A. R. S u r r e y , Name reactions in organic Wissenschaftler d. RSFSR. chemistry "(New York-London '61) 143 f.; H. K r a u c h , W. K u n z , Namenreaktionen *1867, Apr. 16 (4), Petersburg; der organischen Chemie (Heidelberg '61) 248, tl939, Nov. 23. Bildn. Porträtgallerie der Astronomischen Gesellschaft (Budapest '31) S. 31 (m. kurzer Biogr.). Nekr. P. N. D o l g o v , Astronomiceskij 2. 17 ('40) Nr. 1, 1 - 3 (m. Bildn.); Izvest. Akad. Nauk SSSR, Otdel. techn. Nauk 1940, Nr. 1, 105 f. Zur Biogr. P. M. G o r s k o v , Prof. A. A. Ivanov, der Begründer der astronomischtheoretischen Schule der Petersburg-Leningrader Universität: Uc. Zap., leningr. gos. Univ. Nr. 116 (Ser. mat. Nauk Nr. 18) ('49) 192-252 [russ.]; Vestn. leningr. Univ. 1948, Nr. 9, 111-21 (m. Bildn.). Zur Biobibliogr. P. M. G o r s k o v , M. S. L ' v o v i c , Aleksandr Aleksandrovic Ivanov (1867-1939) (Leningrad '49) 54 S. (m. Bildn.). S. Trudy jubilejnogo mendeleevskogo s-ezda [Arbeiten des Mendeleev-Jubiläumskongresses (der Akademie der Wissenschaften der UdSSR)] 1 (Moskva-Leningrad '36) 39-51: Die Arbeiten. D. I. Mendeleevs auf dem Gebiet der Metrologie [russ.]. W . D. I. Mendeleev kak metrolog [D. I. Mendeleev als Metrologe] (Moskva-Leningrad '34) 80 S. — Kurs astronomii. Vvedenie v astronomiju i sfericeskaja astronomija [Lehrgang der Astronomie. Einführung in die Astronomie und sphärische Astronomie] (Leningrad-Moskva '40) 303 S. C.R. (Dokl.) Acad. Sei. URSS Perturbations dans le mouvement de la petite planète (122) Gerda pour la période 1904-1935 et éphéméride de la planète pour l'opposition de 1935:

140 Poggendorff

auch in weiteren Auflagen. S. Atti X Congresso internazionale di chimica, Roma 1938, 3 (Roma '39) 209-12: Dédoublement alcalin des acides /S-hydroxyaliphatiques, 4: Acides [/3-lactiques], contenant en a un radical alcoyle. — Tagungsberichte der Chemischen Gesellschaft der DDR, Hauptjahrestagung 1954 (Berlin '55) 69-71: Über einige Synthesen mit der Lithiumverbindung des Natriumphenylacetats 40 ). — Recent developments in the chemistry of natural carbon compounds 2 (Budapest '67) 47-62 : Constituents of the Bulgarian zdravets oil24). W . Rükovodstvo za prakticeski upraznenija po organiena chimija [Handbuch für praktische Arbeiten der organischen Chemie] (m. Ö. Ivanov) 2 (Sofija '48) 12 + 363 S. ; 3 ('60) ; 4 ('63) 16 + 351 S. — Ucebnik po organiöna chimija [Lehrbuch der organischen Chemie] '(Sofija '48) 900 S.; 4 ('57); 5 ('60); «('64) 20 + 843 S.; 7 ('67) 20 + 864 S. Acta chim. Acad. Sci. hungar. Sur une méthode de dosage de l'huile essentielle des fleurs de la Rosa damascena Mill, en vue de sa sélection 14 ) 20 ) 24 ): 14 ('58) 163-71 [m. engl, u. russ. Zusammenfassg.]. Arhiv Hemiju i Farmaciju Einwirkung von Sauerstoff und Brom auf das Natriumsalz der Magnesiumphenylessigsäure 36 ) : 8 ('34) 8-11 [französ.]. Ber. dtsch. ehem. Ges. Über die Kondensation der «^-ungesättigten Ketone, 1: Über die Struktur des gewöhnlichen Dypnopinakons von Delacre 16 ): 76 ('43) 988-94; ~ 2: Über

2206

Ivanov, Dimitür

die Struktur des gewöhnlichen Dypnopinakons von Delacre; eine neue Art der Kondensation 18 ): 1148-56; ~ 3: Über die Struktur des gewöhnlichen Dypnopinakons, der a- und /?-Dypnopinakoline und des Kohlenwasserstoffs C 25 H 22 von Delacre 16 ): 77 ('44) 173-80. — Über die Struktur der Derivate des Dypnopinakons, 2: Über die Struktur des Merodypnopinakons und Merodypnopinakolins Delacres und des bei ihrer Darstellung sich bildenden „Dibenzyls" 18) : 180-85. Bülgaro-sfivetska DruZba Nikolaj Dmitrievic Zelinski(j): 1963, Nr. 8, S. 23. BulL Soc. chim. France Sur la vitesse de dégagement des hydrocarbures engendrés à partir du phénylacétate chloromagnésien et des dérivés organomagnésiens aliphatiques 35 ) : (4) 51 ('32) 619-22. - Synthèse avec les magnésiens des acides phénylacétique et orthochlorophénylacétique et des cétones saturées et éthyléniques, 2 22 ) 7 ): 1321-25. - Synthèses au moyen du phényl-magnésyle-acétate de sodium, 1: Méthode de préparation d'acides /?-hydroxyarylaliphatiques f/9-Iactiques substitués) 23 ): 1325-31; ~ 2: Méthode de préparation de cétones mixtes benzylées et d'acides /?-hydroxyglutariques trisubstitués symétriques 23 ): 1331-37; ~ 4: Addition d'oxygène et bromuration 36 ) : (5) 2 ('35) 76-78 ; ~ 5: Essais avec les dérivés organomagnésiens aliphatiques: 4 ('37) 682-86. — Dédoublement thermique et alcalin des acides /?-hydroxyglutariques trisubstitués symétriques [, 2]23) : (4) 61 ('32) 1337-40; Dédoublement alcalin des acides /?-hydroxyaliphatiques, 3: Acides /{-lactiques disubstitués: 53 ('33) 321-23; ~ 4: Acides /5-lactiques, contenant en a un ou deux radicaux alcoyles: (5) 7 ('40) 569-71. Influence des substitutions en ortho, méta et para dans les carboxylates organomagnésiens, contenant un atome d'hydrogène labile, sur la réaction avec les réactifs de Grignard 28 ): 1 ('34) 223-33. — Synthèses avec des acides du type R - C H = C H - C H 2 - C 0 2 H et des dérivés organomagnésiens mixtes 28 ): 233-35. — Sur la réaction entre les éthers-sels des acides organiques et les dérivés organomagnésiens mixtes et plus spécialement le chlorure d'isopropyl-magnésium [, l] 3 8 ): 1419-24; Sur la réaction entre les éthers-sels des acides organiques et le chlorure d'isopropyl-magnésium, 2: Essais avec l'acétate d'éthyle et le propionate d'éthyle 38 ): 2 ('35) 816-24. - Sur l'action aldolisatrice des dérivés organomagnésiens mixtes secondaires et tertiaires sur quelques cétones 38 ): 1435-38. — Sur le comportement des acides carboxyliques arylsubstitués /?-hydroxylés vis-à-vis de l'anhydride acétique à chaud 20 ) 43 ): 1963, 1214-17. — Sur la préparation des réactifs polyfonctionnels organométalliques à partir des combinaisons du type R-C=C-CH 2 -COOH, R - C H = C = CH-CH 2 -COOH, N = C-CH 2 -

COOH et leur emploi en synthèse 3 ) : 1422-28. — Le réactif organomagnésien de l'acide 2-chloropropanoïque 3 ) 48 ) 13 ): 1969, 1997-99. Chemické Listy Über Terpene, 88: Struktur des Germakrons, des kristallinen Bestandteils des bulgarischen ,,Zdravets"-öls 24 ) 11 ) 12 ) 30 ) 34 ): 52 ('58) 1163-73 [tschech.]. Chemistry and Industry The structure of germacrone (germacrol) 24 ) 11 ) 12 ) 30 ) 34 ): 1957, 820f. Chimija ilndustrija [Sofija] Professor Penco P. Rajkov zum Gedenken38)"1- "•): 19 ('41) 32995 [bulgar.]. C.B. Acad. bulgare Sei. Analyse de l'essence de térébenthine bulgare du Pinus silvestris 14 ) : 2 ('49) Nr. 1, 41-44. — Analyse de l'essence de térébenthine du Pinus nigricans, de l'essence de bois et des colophanes d'origine bulgare 14 ): 8.1950 ('51) Nr. 1, 17-20 [m. russ. Zusammenfassg.]. — Indones, 3: Acide 2,3-diphényl-indone-trisulfonique 16 ) 36 ) : 4. 1951 ('53) Nr. 2/3, 29-32 [ ~ ] ; ~ 4: Sur la structure des corps obtenus par sulfonation énergique de phényl-2-para-tolyl-3-indone et phényl-2éthyl-3-indone 1 «) 38 ): 5. 1952 ('53) Nr. 2/3, 2528 [ ~ ] . — Sur la préparation de l'acide diphényl-2-3-amino-3-propionique à partir de î'hydrobenzamide et de magnésyl-phénylacétate de sodium 20 ): 21-23 [ ~ ] , — Sur l'huile de zdravetz bulgare [, l ] 24 ) 23 ): 33-36 Bulgarian zdravets oil, 2: Sesquiterpenic hydrocarbons from oil24) : 8 ('55) Nr. 2, 45-48 [ ~ ] ; ~ 3: I t s terpene Compounds 24 ): 11 ('58) 379-82 [—]; ~ 4 : Sesquiterpene oxygen Compounds in the oil's eleoptene 24 ) : 469-72 [ ~ ] . — Synthèses au moyen du magnésylphénylacétate de sodium et des chlorures d'acides dicarboniques aliphatiques. Méthode de préparation de dicétones benzylées 20 ) : 4.1951 ('53) Nr. 2/3, 41-44 [ - ] . Sur l'hydrogénolyse de quelques composés organi14 ques sulfurés par le nickel de Raney ) : 6.1952 ('53) Nr. 1, 13-16 [ ~ ] . - Synthèses avec le magnésien de l'acide 2-furylacétique 8 ): Nr. 2/3, 29-31 [ ~ ] . - Sur un appareil de dosage de petites quantités d'huiles essentielles dans des matériaux végétaux et plus spécialement dans les fleurs de roses 14 ) 24 ): 6.1953 ('54) Nr. 1, 9-12 [ ~ ] . - Essai pour fixer la fin de la distillation dans la production' de l'huile de roses 14 ) 24 ): 13-16 [ - ] • - Sur l'accélération du repos de l'huile brute de menthe-herbe en vue de la stabilisation de l'huile réetifiée 14 ) 23 ) 24 ): 25-28 [ ~ ] . - Sur la composition du stéaroptène de l'huile de roses bulgare [, 1] 16 ) 36 ): 29-32 [ - ] ; ~ 2: Autres hydrocarbures saturés que l'eicosane 16 ) 3 ') : 7 ('54) Nr. 1, 17-20 [ ~ ] ; ~ 3: Hydrocarbures nonsaturés 38 ): 10 ('57) 193-96 [ ~ ] . - Sur la conservation des fleurs de roses avant leur hydrodistillation pour la préparation de l'huile des roses 14 ): 6.1953 ('54) Nr. 3, 13-16 [ ~ ] . Sur la composition de l'huile de roses bulgare

Ivanov, Dimitûr obtenue par la méthode soviétique 20 ) 24 ) : 17-20 — Application de la réaction de Rosenthaler pour fixer la fin de distillation dans la production de l'huile de roses 14 ) 20 ) 24 ): 21-24 [ ~ ] . — Sur une nouvelle méthode de dosage de l'huile essentielle des fleurs de roses 14 ) 24 ): 25-28 — Sur la structure des dérivés du groupe de la dypnopinacone, obtenus par hydrogénation en présence de nickel de Raney, 1 : Hydrogénation de la dypnopinacone et de la lutéodypnopinacoline 14 ) 4 ) 44 ) : 33-36 [ ~ ] ; ~ 2 : Hydrogénation de l'albodypnopinacoline (l'isodypnopinacoline-a) 14 ) 4 ) 44 ): 37-40 [—]• — Sur la composition de l'huile des roses bulgare a>): 7 ('54) Nr. 1, 13-15 [ - ] • - Sur la distillation des alcools et du stéaroptène de l'huile de roses lors de l'hydrodistillation des fleurs de roses 14 ) 20 ) 24 ): Nr. 3, 25-28 [ - ] • - Synthesen mit Organolithiumverbindungen, durch Substitution eines labilen Wasserstoffatoms erhalten, 1 : Synthesen mit a-Lithium-natriumphenylacetat, gewonnen mittels AryllithiumVerbindungen 4 0 ): 29-32 ~ 2 : Synthesen mit a-Lithium-natrium-a-naphthylacetat, gewonnen mittels Aryllithiumverbindungen 26 ) 6 ): 33-36 ~ 3: Synthesen mit a-Lithium-natrmm-/S-naphthylacetat, gewonnen mittels Aryllithiumverbindungen 2 6 ) 5 ) : 9 ('56) Nr. 1, 23-26 [—]; ~ 5: Synthesen mit a-Lithium-natriumphenylacetat, gewonnen mittels Alkyllithiumverbindungen 4 0 ) : 39-42 ~ 6: Synthesen mit a-Magnesyl-anaphthylacetonitril und a-Lithium-a-naphthylacetonitril 2 5 ) 6 ): Nr. 3, 21-24 [ ~ ] ; ~ 8: Über eine Methode zur Gewinnung von a,yDiphenyl-j8-alkyl- oder -aryl-)S-oxybuttersäure « ) : 29-32 [ ~ ] ; ~ 9 : Synthesen mit a-Lithiumphenylacetonitril 4 0 ): 10 ('57) Nr. 1, 53-56 [ ~ ] ; ~ 10: Wechselwirkung von a-Lithiumnatriumphenylacetat u n d a-ungesättigten Ketonen 4 0 ): Nr. 2, 121-24 - Synthèses avec le magnésien de l'acide 2-thiénylacétique - Sur la com«•): 8 ('55) Nr. 1, 29-31 position des hydrocarbures saturés de la cire 36 16 des fleurs de roses bulgares ) ) : Nr. 2, 33-36 — Sur une méthode de dosage de l'huile essentielle des fleurs de la Rosa damascena Mill. en vue de sa sélection 14 ) 20 ) 24 ): 57-60 [ ~ ] . — Dosage chromatographique des hydrocarbures dans l'huile de roses 20 ) 27 ) 16 ) : Nr. 4, 29-32 — On the addition of diethyl benzylphosphonate to Compounds with activ a t e d double bonds 5 ): 14 ('61) 47-50 [ - ] • — Obtention des composés organomagnésiens polyfonctionnels à triple liaison carbonecarbone et groupe carboxyle et les synthèses qu'ils permettent, l 3 ) : 63-66 [ ~ ] . - Synthèses au moyen de l'a-magnésyl- et de l'alithium-phénylacétate de sodium et des esters d'acides mono- et dicarboxyliques 20 ) 41 ) : 15 ('62) 487-90 - Préparation d ' u n réactif organomagnésien polyfonctionnel à doubles liaisons cumulées et groupe carboxyle, appliqué à certaines synthèses 3 ): 751-54 [ ~ ] . — 140*

2207

Sur la préparation de réactifs polyfonctionnels organomagnésiens à triple liaison carbonecarbone et groupe carboxyle et leur emploi en synthèse 3 ): 16 ('63) 185-88 [ ~ ] . - Sur la préparation du réactif organomagnésien de l'acide cyanoacétique 3 ) : 649-52 — Verhalten von Nitrobenzol gegenüber Lithiumamid in einem flüssigen Ammoniakmedium 41 47 ) ) : 19 ('66) 1043-45. - Interaction of some substituted acetic acids with 2,2-diphenylvinylmagnesium bromide — an example of indirect coupling46)3)») : 21 ('68) 1189-92. Composition of Bulgarian clary sage oil 3 ') 21 ) 49 ) : 22 ('69) 297-99. - Über eine Dehydrodimerisierungsmöglichkeit von ortho- und para-Nitroäthylbenzol 4 1 ) 2 7 ) : 755-58. C.R. hebd. Séances Acad. Sei., Paris Alcoolyse des éthers-sels par les alcoolates et les phénolates organomagnésiens mixtes 3 1 ): 19& ('32) 467-69. — Sur la vitesse de dégagement des hydrocarbures engendrés par action de l'indène sur les dérivés organomagnésiens aliphatiques. Méthode de mesure de la force de liaison des radicaux alcoyles avec le groupe magnésyle 1 ): 196 ('33) 491-93. - Sur un nouveau dérivé organomagnésien complexe: le /?-magnésylphénylacétonitrile 26 ): 197 ('33) 923-25. — Synthèses avec des acides du t y p e R - C H = C H - C H 2 - C 0 2 H 2 î ) : 1230f. - Sur la constitution de la dypnopinacone de M. M. Delacre: 199 ('34) 729-31. - Déshydratation des acides /5-hydroxypropanoïques aryle-disubstitués. Méthode de préparation d'indones le ) : 226 ('48) 1199-201. - Sur la bromuration du dihydromérodypnopinacolène et de ses hydrures 16 ) 36 ): 227 ('48) 482-84. - Sur la structure de l'hydrocarbure C2ÔH20. Transposition rétropinacolique par déshydrogénation 16 ) 36 ): 535-37. — Sur la préparation des acides indone-sulfoniques 16 ) : 1379-81. — Sur l'autoxydation des cyclohexénols aryl-aroylsubstitués. Méthode de préparation des triarylbenzènes 16 ) 14 ): 281 ('50) 578-80. - S u r la structure des déshydrolutéo- et déshydroisodypnopinacolines. Nouveaux cas de transposition rétropinacolique par déshydrogénation 16 ) 36 ) : 657-59. — Sur la structure de l'isodypnopinacoline-a (albodypnopinacoline) deM. Delacre 14 ) 16 ): 1240-42. Croatica ehem. Acta Préparation de amagnésyle-a-toluène-sulfonate de sodium et quelques synthèses avec ce réactif 20 ) : 29 ('67) 347-49. Glasn. chem. DruS. [Beograd] Détermination de la structure de quelques composés d u groupe des dypnopinacones 14 ) : No. jubilaire 1897-1947 ('51) 87-112 [serb. m. französ. Zusammenfassg.]. Godisnik sofijsk. Univ., Fiziko-mat. Fak. Alcoolyse des éthers-sels par les alcoolates et les phénolates organo-magnésiens mixtes 31 ): 29 ('33) Kniga 2, 331-40 [bulgar. m. französ. Zusammenfassg.]. — Sur la vitesse

2208

Ivanov, Dimitür

de dégagement des hydrocarbures engendrés par action de l'indène et des dérivés organomagnésiens aliphatiques. Une méthode de mesure de la force de liaison des radicaux alcoyles et le groupe magnésyle, 2 1 ): 30 ('34) Kniga 2, 53-58 [ ~ ] . — Quelques nouveaux réactifs pour la transformation de la dypnone en dypnopinacone22)29) : 81 ('34) Kniga 2, 199-204 [ ~ ] . — Influence des substitutions en ortho, méta et para dans les carboxylates organomagnésiens, contenant un atome d'hydrogène labile, sur la réaction avec les réactifs de Grignard28) : 33 ('37) Kniga 2,177-211 [ - ] • — Synthèses avec les acides du type R-CH = —CH-CH 2 -C0 2 H et des organomagnésiens mixtes 28 ): 213-20 — Synthèses avec le magnésyle-phénylacétate de sodium, 5 : Essais avec des organomagnésiens aliphatiques: 23140 — Dédoublement alcalin des acides /î-hydroxyaliphatiques, 4: Acides contenant en a un radical alcoyle: 241—48 [ ~ ] ; ~• 5: Acides contenant en a des radicaux alcoyles: 35 ('39) Kniga 2, 337-40 [ - ] . - Sur l'orthobenzoyl-benzile8) : 33 ('37) Kniga 2, 305-10 — Déshydratation des acides j8-hydroxypropioniques aryle-disubstitués. Méthode de préparation d'indones16) : 44 ('48) Kniga 2, 121-42 [ ~ ] . — Sur l'autoxydation des cyclohexénols aryle-aroyle-substitués. Méthode de préparation des triarylbenzènes16)14) : 45 ('48/ 49) Kniga 2, 157-78 [ ~ ] , — Sur la structure de l'isodypnopinacoline-a (albodypnopinacoline) de M. Delacre14)16) : 46 ('50) Kniga 2, 121-26 [ ~ ] . — Sur la structure de déshydrolutéo- et déshydroisodypnopinacoline. Nouveaux cas de transposition rétropinacolique par déshydrogénation1')36) : 145-51 [ ~ ] . — Synthèses avec magnésyle-phénylacétate de sodium et des chlorures d'acides aliphatiques mono- et dicarboxyliques. Méthode de préparation de cétones benziliques20) : 47. 1950/ 1952 ('52) Kniga Chem., 41-51 [ ~ ] , Méthodes pour le dosage de l'huile des roses dans les fleurs de roses 14 ) 24 ): 48.1953/1954 ('54) Kniga 3,1, 15-35 [ ~ ] . - Détermination de la teneur en huile de roses dans les eaux de distillation par la réaction de Rosenthaler et la tension superficielle à fin de fixer la fin de la distillation14)20)24): 37-52 [ - ] • - Sur l'huile de zdravetz bulgare, 2: Composition des hydrocarbures sesquiterpéniques24) : 49. 1954/1955 ('56) Kniga 2, 25-33 [m. bulgar. Zusammenfassg.]. — Sur une méthode de dosage de l'huile essentielle des fleurs de la Rosa damascena Mill. en vue de sa sélection 14 ) 21 ) 24 ) : 57-64 [bulgar. m. franzôs. Zusammenfassg.]. — Sur la composition des hydrocarbures des stéaroptènes de l'essence de roses bulgare et de la cire des fleurs de roses bulgares 3 ") 16 ) : 50. 1955/1956 ('57/58) Kniga 2, 141-68 — Sur la composition de l'huile de zdravetz bulgare24): 51.1956/1957 ('58/59) Kniga 3, 113-33 — Synthesen mit

Substitution eines labilen Wasserstoffatoms 40)25)5)20). 52.1957/1958 ('59) Kniga 3, 1-54 [bulgar. m. deutscher Zusammenfassg.]. — Tätigkeitsbericht in der chemischen Abteilung der physikalisch-mathematischen Fakultät von 1944-1959: Einleitung: 53. 1958/1959 ('59/60) Kniga 3, Vf. [bulgar.]; Lehrstuhl der organischen Chemie: X I I - X X I [ ~ ] . Godisnik sofijsk. Univ., Chim. Fak. Composition of the Bulgarian basil oil 37 ) 19 ): 59. 1964/1965 ('66) 229-36 [bulgar. m. russ. u. engl. Zusammenfassg.]. Industrie Parfumerie Sur une méthode de dosage de l'huile essentielle des fleurs de la Rosa damascena en vue de sa sélection14)20) 2 4 ): 10 ('55) 418-20. - Dosage chromatographique des hydrocarbures dans l'huile de roses 20 ) 2 ') 15 ): 11 ('56) 105f. - Sur la composition des hydrocarbures du stéaroptène de l'essence de rose bulgare3"): 12 ('57) 402f. Izvest. chim. Inst., Bülgarska Akad. Nauk. Sur la distillation des alcools et du stéaroptène de l'huile de roses lors de l'hydrodistillation des fleurs de roses14)20)24): 3 ('55) 431-39 [bulgar. m. russ. u. franzôs. Zusammenfassg.]. — Dosage chromatographique des hydrocarbures dans l'huile de roses20)27)15): 4 ('56) 277-86 — Sur les aldéhydes de l'essence de rose25): 6 ('58) 281-92 [ ~ ] , — Die Struktur des Kristallstoffs „Germacron" (Germacrol) im bulgarischen Zdravetsöl24)11)12)30)34) : 32743 [bulgar. m. russ. u. deutscher Zusammenfassg.]. Izvest. Inst. org. Chim., Bülgarska Akad. Nauk. Organomagnesiumverbindungen mit einer Carboxylgruppe und Dreifachbindungen oder kumulierten Doppelbindungen3): 1 ('64) 13-31 [bulgar. m. französ. Zusammenfassg.]. J. prakt. Chem. Über die Lage und die Perspektiven der organischen Chemie in der Volksrepublik Bulgarien: 10 ('60) 102-12. Liebigs Ann. Chem. Über die Reaktion einiger Vinylmagnesiumhalogenide mit Natriumphenylacetat3)48) : 687 ('65) 167-71. Naturwissenschaften Addition von Benzylphosphonsäurediäthylester an Zimtsäureäthylester 6 ): 46 ('59) 171. - Das Verhalten des o- und p-Nitrotoluols gegenüber Lithiumund Natriumamid in flüssigem Ammoniak41): 49 ('62) 420. — Infrarotspektraldaten über die Struktur einiger polyfunktioneller Organomagnesiumreagenzien18)3) : 51 ('64) 286 f. — Das Verhalten des p-Xylylendichlorids gegen Natrium- und Lithiumamid in flüssigem Ammoniak41) : 52 ('65) 13-.

Perfumery and essent. Oil Ree. On the aldehydes of rose oil25): 49 ('58) 231 f. Bulgarian zdravets oil 24 ): 617-23. — On alcohols in rose oil25): 50 ('59) 676f. - Acids Organolithiumverbindungen, erhalten durch and esters in rose oil 25 ) 37 ) 2 ): 51 ('60) 609f. —

Ivanov, Dimitür - Ivanov, Nikolaj

2209

On the composition of the Bulgarian basil oil tätigkeit an weiteren Hochschulen in Le') 1 9 ): 55 ('64) 717-19. — On the composition ningrad. (E3) of Bulgarian lavender oil 24 ) 39 ) 3 '): 57 ('66) 87*1884, Nov. 6 (Okt. 25), Gateina, Gouv. 91. Petersburg ; Priroda fSofija] Bulgarisches Rosenöl 24 ): f1940, Dez. 3, Leningrad. 1958, Nr. 6, 9-14 [bulgar.]. Nekr. M. I. K n j a g i n i c e v , Botaniceskij 2. Revue Chim., Acad. Républ. popul. roumaine Synthèses au moyen de l'a-magnésyl- et de SSSR 26 ('41) Nr. 2/3, 241-48 (m. Schr.verz. l'a-lithium-phénylacétate de sodium et des 150 Nrn.); Priroda [SSSR] 1941, Nr. 4,112-15 esters d'acides mono- et dicarboxyliques 20)41) : (m. Schr.verz. 150 Nrn.). — M. L o j c j a n s k a j a , Z. R a z u m o v s k a j a , Mikrobiologija 7 ('62) 985-92. 10 ('41) 382 f. - Biochimija 6 ('41) Nr. 1, Riechstoffe, Aromen, Körperpflegemittel S. l f . Über die Zusammensetzung des bulgarischen Zum 15. Todestag Z. G. R a z u m o v s k a j a , Lavendelöles 3 ») 24 ) 3 '): 19 ('69) 293-96. Uc. Zap. leningr. gos. Univ. Nr. 216 (Ser. biol. Spisanie bülgarsk. Akad. Nauk. Symposium Nauk Nr. 41) ('56) 3f. anläßlich des hundertjährigen Bestehens der Biobibliogr. I n : S. J u . L i p s i c , Russkie chemischen Strukturtheorie von A. M. Butlerov: 1962, Nr. 1/2, 105-08 [bulgar.]. - Inter- botaniki (Botaniki Rossii - SSSR). Biografonationales Kolloquium über organometallische bibliograficeskij slovar' [Russische Botaniker Verbindungen in Paris 1962 (Centre National (Botaniker Rußlands und der UdSSR). Biode la Recherche Scientifique) : Nr. 4, 91-93 graphisch-bibliographisches Wörterbuch] 3 (Moskva '50) 408-14 (m. Schr.verz.). [bulgar.]. H. (Redakt.) Polucenie limonnoj kisloty 2 . yses. chim. OM5. im. Mendeleeva Polyfunktionelle metallorganische Reagenzien und biochimiceskim putem. Sbornik statej [Die ihre Verwendung bei Synthesen: 7 ('62) 373- Gewinnung der Zitronensäure auf biochemischem Wege. Sammlung von Aufsätzen] 84 [russ.]. (Leningrad '35); darin eig. Beitr.: 3f.: BioMit: ') I. A b d o u l o f f ; ') V. B e l i t c h e v a ; >) B. chemische Gewinnung von Zitronensäure B l a g o e v ; •) Tz. B o n t c h e f f (C. Bondev); •) G. [russ.]. — (Chefredakt.) Biochimija kul'turB o r i s s o f f (Borisov); •) D. Chopoff (Sopov); ') T. C h r i s t o v a ; ") — ; •) P . D o c h e v s k a - I v a n o v a nych rastenij. Sbornik statej [Biochemie der ( D o i e v s k a - I v a n o v a ) ; ") - ; ") V. H e r o u t ; ") Kulturpflanzen. Sammlung von Aufsätzen] 1 M. H o r â k ; ") V. H i e v ; ") Ch. I v a n o f f ( I v a n o v ) ; (Moskva-Leningrad '36) - 8 ('48) ; darin eigene ") L . I v a n o v a ; ") Toh. I w a n o w (C. I v a n o v ) ; ") D. I w a n o w D a l e f f ( I v a n o v D a l e v ) ; ") B. Jor- Beiträge: 1 ('36) 7-86: Biochemie des Weizens 8 d a n o v ; ") Tch. (C.) J o r d a n o v ; ,0 ) N. Marécoff •) [russ.]; 127-91: Biochemie der Gerste ) (Marekov); ") V. M a r i n o v ; ") M. M i h o v a [russ.]; 7 ('40) 549-56: Biochemie von Acti(Michova); ") N. I. N i c o l o f f ( N i k o l o v ) ; ") I. O g n y a n o f f (Ognjanov); ") I. M. P a n a j o t o f f nidia [russ.]; 8 ('48) 5-100: Das Eiweiß( P a n a j o t o v ) ; ") I. P a o u n o f f (Paunov); ") S. problem in der Pflanzenzucht [russ.]. 3

P a v l o v a ; ") G. P c h é n i t o h n y ; '•) I. P. P e t r o v a ; ") J. P l i v a ; ") T. R o u s t c h e f f (RuSiev); ") - ; »») ") F. Sorm; ••) A. S p a s s o f f (Spasov); ") B . S t o j a n o v a - I v a n o v a ; ") S. T c h o r b a d j i e v (Corbadi ie v); ") J. T s o h o l a k o f f (I. Colakov); »•) R. V l a k h o v (Vlachov); «) G. W a s s i l e f f (Vasil'ev); ") E. Zidaroff (Zidarov); ") - ; «") B. A m i d j i n e ; ") G. I v a n o v ; ") - ; ") M. M o m t c h e v ( M o m i e v ) ; ") P. P e t r o v ; ") V. Stojanova.

HZ. Trudy prikl. Bot., Genetiki i Selekcii, Ser. 3 , 1 0 ('35). - Trudy prikl. Bot., Genetiki i Selekcii, Priloz. 54 ('32) (== Problema bezalkaloidnogo ljupina [Das Problem der alkaloidfreien Lupine]); 67 ('34) ( = Problema vitaminov [Das Vitaminproblem]). MHZ. Trudy prikl. Bot., Genetiki i Selekcii, Priloz. 84 ('37) ( = Problema vitaminov [Das VI IVANOV, N i k o l a j Nikolaevic. Bio- Vitaminproblem], 2). chem. — Bis 1909 Studium, '09-29 Assist, S. S. P. K o s t y c e v , Fiziologija rasteu. später Privatdoz. am Lehrstuhl f. nij [Physiologie der Pflanzen] 1 ^ M o s k v a Leningrad '33) 3 - 6 : Akademiemitglied S. P. Pflanzenphysiol., '29-40 ord. Prof., Kostycev, 1877-1931 [russ.]. — A. G e s s e , Lehrstuhl f. Mikrobiol., Univ. Petersburg Énzimaticeskaja technologija brodil'nych proLeningrad; Dr. d. biol. Wiss.; '18-22 cessov [Übers, aus d. Deutschen: A. H e s s e , Technologie der GärungsProf., Agronom. Inst., Leningrad; '22- Enzymatische industrien] (Moskva-Leningrad [ ?] '33): Über Begründer u. Leiter d. Biochem. Labor. die Untersuchung der Gerstensorten der (-> Abt. Biochem.) u. d. Vitamin-Labor., UdSSR als Grundlage der Gärungsindustrie Inst. f. angew. Botanik u. neue Kulturen [russ.]. — Sel'sko-chozjajstvennaja nauka v [Die Landwirtschaftswissenschaft in der -> Inst. f. Pflanzenzucht, Lenin-Akad. SSSR UdSSR] (Leningrad '34) 134-48: Die Biod. Landwirtschaftswiss., Leningrad; '26- chemie der Kulturpflanzen [russ.]. — Teoreti30 Prof., Technol. Inst., Leningrad; Lehr- ceskie osnovy selekcii rastenij [Theoreti-

2210

Ivanov, Nikolaj

sehe Grundlagen der Pflanzenzüchtung] 1 (Moskva-Leningrad '35) 991-1016: Biochemische Grundlagen der Pflanzenzüchtung [russ.]. — Zbirnyk prac', prysvjacenyj pam'jati akad. V. Ljubymenka [Gedenkband für das Akademiemitglied V. N. Ljubimenko] (Kiev '38) 273-83: Aufnahme von Blausäure durch Pilze7)[]. — Prezidentu Akademii nauk SSSR akademiku Vladimiru Leont'evicu Koinarovu k semidesjatiletiju so dnja rozdenija i sorokapjatiletiju nauenoj dejatel'nosti. Sbornik statej [Dem Präsidenten der Akademie der Wissenschaften der UdSSR, Akademiemitglied V. L. Komarov zum 70. Geburtstag u. zur 45jährigen wissenschaftlichen Tätigkeit. Sammlung von Aufsätzen] (Moskva-Leningrad '39) 278-87: Über die Vitaminquellen in Pflanzen [russ.]. — Trudy Vsesojuznoj konferencii po vitaminam [Arbeiten der Unionskonferenz über Vitamine], Moskva 1939 (Moskva-Leningrad '40) 88-101 : Die Pflanze als Vitaminquelle [russ.].

tative Methode der Eiweißbestimmung mittels der Biuretreaktion 5 ): Nr. 15/16, 15-22 [russ.]. — Über Methoden der Beschleunigung der Selektion auf der Basis der chemischen Zusammensetzung: 4 ('39) Nr. [?], 3-10 [russ.]. — Kolorimetrische Eiweißbestimmung in den Samen von Leguminosen und Ölpflanzen 6 ): 5 ('40) Nr. 20, 23-26 [russ.]. - Methode der quantitativen Eiweißbestimmung durch die Histidinreaktion 5 ): Nr. 23/24, 29-32 [russ.]. Enzymologia Über die durch die diastatische Methode festgestellte Verschiedenheit in der Struktur der Stärke 11 ) 8 ): 4 ('37) 163-68. Izvest. Akad. Nauk SSSB Sergej Pavlovic Kostycev t 17 ) 10 ) 13 ): 1932, 287-312 [russ.]. Izvest. Akad. Nauk SSSB, Ser. biol. Pflanzenselektion auf der Basis der chemischen Zusammensetzung: 1937, 1801-34 [russ. m. engl. Zusammenfassg.]. — Biochemische Qualitätsmerkmale von Brauereigerste: 1939, 887-98 [-]• Mikrobiologija Blausäure als Stickstoffquelle für Aspergillus niger 19 ): 3 ('34) 309-18 [russ.]. — Über die die Alkoholausbeute aus Holzhydrolysat herabsetzenden Bakterien 22 ): 8 ('39) 167-77 [russ.].

W. Metody fiziologii i biochimii rastenij [Methoden der Physiologie und Biochemie der Pflanzen] ¡¡(Leningrad '32) 240 S. ; 3 ('35) 392 S.; 4 (Moskva-Leningrad '46) 494 S. (m. Bildn.). — Problema belka v rastenievodstve [Das Eiweißproblem in der Pflanzenzucht] (MoMikrochemie Mikrochemische Analyse von skva-Leningrad '47) 112 S. (m. Bildn.). — Biochemie der Leguminosen und Fourage- Samen ohne Verlust ihrer Keimfähigkeit: pflanzen (Amsterdam '47, Den Haag '48) Festschrift Hans Molisch ('36) 243-58. Piäöevaja Promysl. Über die Vitamine der 7 + 115 S. Annual Rev. Biochem. The biochemistry of Äpfel: 1932 [russ.]. Planta [Berlin] Über die Herkunft der the fungi: 1 ('32) 675-98; 2 ('33) 521-40; Harnsäure in Pflanzen 18 ): 25 ('36) 59-63. ~ 4 ) : 5 ('36) 585-612. Priroda [SSSB] Die mikrochemische AnaArchiv biol. Nauk The nitrogen nutrition of fungi «)«): 43 ('36) 373-82 [russ. m. engl. lyse von Samen ohne Verlust der Keimfähigkeit: 25 ('36) Nr. 8, 76-83 [russ.]. - Vitamine: Zusammenfassg.]. Biochemische Z. Über die Veränderlichkeit Nr. 11, 43-70 [russ.]. Selekcija i Semenovodstvo Biochemische der chemischen Zusammensetzung der Pflanzen: 250 ('32) 430-47. - Über die Veränder- Eigenschaften5 von Frühjahrs weizen und lichkeit des Fermentgehalts in Samen und Winterweizen ): 1939, Nr. 2/3, 16-21 [russ.]. Früchten: 254 ('32) 71-87. - Die Blausäure — Anleitung zur schnellen Eiweißbestimals N-Quelle für Aspergillus niger, l l s ) : 271 mung: 1940 [russ.]. ('34) 22-31. Sovetskaja Agron. Fragen der StickstoffBiochimija Ist im Champignon Saccharase versorgung der Pflanzen in den Arbeiten von 5 enthalten? ): 2 ('37) 437-41 [russ.]. - Eine K. A. Timirjazev: 1940, Nr. 5, 17-19 [russ.]. schnelle, quantitative Methode der EiweißTabulae biol. [Den Haag] Biochemie der bestimmung mittels der Biuretreaktion 5 ) : 3 Kulturpflanzen, 1: Biochemie der Getreide('38) 723-30 [russ.]. arten»): 16 ('38) 207-59. Botanföeskij 2 . SSSB Über die Substanzen Trudy central'n. naußno-issled. biochim. bei der Biosynthese der Vitamine: 25 ('40) Inst. piüdevoj i vkusovoj Promysl. Die quali289-91 [russ.]. tative Bestimmung von Stärke und Eiweiß Dokl. Akad. Nauk SSSB Über die Bildung in Gerste verschiedener Abstammung 8 ): 3 von organischen Säuren durch Aspergillus ('33) 35-52 [russ.]. — Versuch einer Anniger unter der Einwirkung von Acenaphthen wendung getrockneter Hefe zum Brotbacken 24 " ) : 30 ('41) 356-58 [russ.]. ): 110-19 [russ.]. Dokl. vses. Akad. sel'skochozjajstvenn. Trudy prikl. Bot., Genetiki i Selekcii, Ser. A Nauk im. Lenina Eine schnelle mikroskopi- Über die Erforschung der Variabilität der sche Untersuchung auf den Eiweißgehalt von chemischen Zusammensetzung der Pflanzen: Gerstenkörnern für Zuchtsaatgut 21 ): 3 ('38) 4 ('32) 147-55. - Die Variabilität des Gehalts Nr. 12, 26-31 [russ.]. — Eine schnelle, quanti- I der Samen und Früchte an Fermenten: 5/6

Ivanov, Nikolaj - - Ives, Herbert ('33) 57-70. — Gehalt verschiedener Früchte, Beeren und Gemüsepflanzen an Vitamin C 3)2) » ) : 8 ('33) 95-111. - Erfolge der sowjetischen Biochemie der Pflanzen: 10 ('34) 105-21. — Bewässerung und die Qualität der Ölfruchternte 1 ): 11 ('34) 81-94. — Über Bohnenarten als Material f ü r die chemische Selektion: 15 ('35) 53-60. — Die Rolle der Chemie bei der Selektion der Futterpflanzen 2 3 ): 61-73. Alle Arbeiten russ. Trudy prikl. Bot., Genetiki i Selekcii, Ser. 3 On the cause of the chemical variation of chickpea seeds: 1 ('33) 3-12 [russ. m. engl. Zusammenfassg.]. — The biochemical characteristics of the barleys of the Soviet Union: 7 ('35) 1-173 [russ.], 174-88 [engl. Zusammenfassg.]. Trudy prikl. Bot., Genetiki i Selekcii, Priloää. Biochemical search for alkaloid-free lupines 23 ): 64 ('32) 5-28 [russ. m. engl. Zusammenfassg.]. — Use of colour reaction in the search for alkaloid-free lupines 23 ): 50-52 — Methods of studying vitamins in plants: 67 ('34) 7-24 [russ.], 249 [engl. Zusammenfassg.]. — The vitamin A content of carrots 23 ): 53-64 [russ.], 250 [engl. Zusammenfassg.]. — The preparation of vitamin C from sweet-briar or dog-rose 16 ) 18 ): 155-60 [russ.]. — A study of vitamins in plants: 84 ('37) 4r-20 [russ.]. Usp. biol. Chim. Biochemische Unterschiede innerhalb eines Feldes: 11 ('34) 164-202 [russ.]. — Neue Erfolge auf dem Gebiet der Biochemie der Pilze 4 ): 12 ('36) 191-209 [russ.]. Vestn. Znanija Die Biochemie im Dienste der Pflanzenzüchtung: 1935 [russ.]. obäßej Chim. Aleksej Nikolaevic Bach (1857-1887-1937): 7 ('37) 1061 f. [russ.]. 2 . prikl. Chim. Kolorimetrische Schnellmethode zur Bestimmung des Eiweißgehaltes in Pflanzensamen 5 ): 12 ('39) 1575-81 [russ.]. Mit: *) V. V. A r a s i m o v i S ; ') V. S. B o r o c h o v i i ; ") V. N. B u k i n ; ') E. S. C v e t k o v a ; ' ) E. V. D o d o n o v a ; •) V . E . I v a n o v a ; ') G. A. K a t a n s k a j wa ; ") V. A. K i r s a n o v a ;u •) M. I. K n j a g i n i ö e v ; ) M. P. K o r s a k o v a ; ) M. M. K u r g a t n i k o v ; ") N. N. L a r i o n o v a ; ")S. D. L ' v o v ; ")N. A. Makrin o v a ; ") V. Ja. Marga; ") D. M i c h l i n ; ") G. A. N a d s o n ; ")N. P. O n o c h o v a ; ") L.K. O s n i c k a j a ; *•) K. L. P o v o l o c k a j a ; ") N. L. S a r o v a ; ") I. A. g a t u n o v a ; ")M. I. S m i r n o v a ; " ) F. L. T r a j n i n a .

IYERSEN, F e l i x Christian Herbert. Math. — 1906-21 Lehrassist, am Astron. Observat., '16-20 Doz., '20-54 außerord. Prof., Univ. Helsinki; '17-24 Lehrer, Techn. Lehranst., Helsinki. — '54 Internationaler Lenin-Friedenspreis. *1887, Sept. 22, Lübeck. H Z . Rauhaa kohti 1925-1967. 3 Geometrie-Lehrbücher in finnischer Sprache, 2 pädagogisch-mathematische Arbeiten in finnischen Fachzeitschriften sowie zahl-

2211

reiche Beiträge im Kähmen der Friedensbewegung, vor allem in den Zeitschriften „Rauhaa kohti" und „Fredsposten". v yl

' IVES, Herbert Eugene. Physik (Optik, Photogr.). — 1919-25 Physicist, Western Electric Co., '25-47 Physicist, Bell Telephone Labor., New York; '11-12 Vice-Pres., Illuminating Engng. Soc.; '17 Pres., Physics Club, Philadelphia, Pa.; '24-25 Pres., Optical Soc. of America; '38 Vice-Pres., American Acad, of Arts and Sei.; '42-46 Pres., American Numismatic Soc. — '28 Hon. D. Sc. (Yale Univ., New Haven, Conn.); '28 Hon. D.Sc. (Dartmouth College, Hanover, N. H.); '29 Hon. D. Sc. (Univ. of Pennsylvania, Philadelphia, Pa.). — '06, '14, '18 Longstreth Medals (Franklin Inst., Philadelphia, Pa.); '27 John Scott Medal (City of Philadelphia, Pa.); '37 Frederic Ives Medal (Opt. Soc. of America); '51 Rumford Gold and Silver Medal (American Acad, of Arts and Sei., Boston, Mass.); Medal for Merit (U. S. Government). *1882, Juli 31, Philadelphia, Pa.; fI953, Nov. 13, New York. Biogr. G. R. H a r r i s o n , J . opt. Soc. America 27 ('37) 425-30 (m. Bildn., Schr.verz.). - Nature [London] 182 ('33) 508; 170 ('52) Hilf. Nekr. 0 . E. B u c k l e y , K. K. D a r r o w , Biographical Mem., Nation. Acad. Sei. USA 29 ('56) 145-89 (m. Bildn., Schr.verz.). A. C. M e n z i e s , Nature [London] 173 ('54) 106f. - J . opt. Soc. America 43 ('53) 1228f. (m. Bildn.). S. Electrical engineers' handbook 2: Electrical communication and electronics (H. Pender, K. Mcllwain) (Wiley engineering handbook series, 5) 3 (New York-London '36) Sect. 5, 68-82: Photoresponsive devices; auch in 4 ('50). — Measurement of radiant energy (New York '37) 389-407: Photometry. O. E. D u n l a p , Radio's 100 men of science; biographical narratives of pathfinders in electronics and television (New York '44) 210-12: Applied electro-optics to radio. — The scientists speak (W. Weaver) (New York '47) 136-39: Physics and art. W. Foreign imitations of the English noble (New York '41) 36 S. (Numismatic notes and monographs, 93). — Venetian gold ducat and its imitations (P. Grierson) (New York '55) 37 S. Bell Labor. Ree. Applicability of photoelectric cells to spectrophotometry and colori-

2212

Ives, Herbert — Ives, James

metry: 15 ('36). — Television: 20 th anniversary: 25 ('47) 190-. Bell Telephone Quarterly Picture transmission and television: 11 ('32) 118-42. Electronics The ether - fact or fiction ?: 11 ('38) 13-15. J. opt. Soc. America A method of projection in relief and color: 22 ('32) 191-98. - Standing light waves; repetition of an experiment by Wiener, using a photoelectric probe surface 3 ): 23 ('33) 73-83. - Optical factors in cesiumsilver-oxide photoelectric cells 4 ): 24 ('34) 198-205. — The optical constants of potassium 1 ): 26 ('36) 238-46. - Calculated and experimental photoelectric emission from thin films of potassium 1 ): 247-50. — Graphical exposition of the Michelson-Morley experiment: 27 ('37) 177-80. - The optical constants of sodium 1 ): 181-85. — Light signals on moving bodies as measured by transported rods and clocks: 263-73. — The aberration of clocks and the clock paradox: 305-09. — Apparent lengths and times in systems experiencing the Fitzgerald-Larmor-Lorentz contractions: 310-13. — The Doppler effect considered in relation to the Michelson-Morley experiment: 389-92. — Optical constants of rubidium and cesium 1 ): 395-400. — An experimental study of the rate of a moving atomic clock [, l] 5 ): 28 ('38) 215-26; ~ 2 6 ): 31 ('41) 369-74. — Light signals sent around a closed p a t h : 28 ('38) 296-99. - Correlation of optical properties and photoelectric emission in thin films of alkali metals 1 ): 330-38. — Behavior of an interferometer in a gravitational field [, 1]: 29 ('39) 183-87; ~ 2: Application to a planetary orbit: 38 ('48) 413-16. — Derivation and significance of the so-called "chronotopic interval": 29 ('39) 294-301. Theory of the double Fizeau toothed wheel: 472-78. — The Doppler effect from moving mirrors: 30 ('40) 255-57. — Interference phenomena with a moving medium [, l] 5 ): 31 ('41) 14-24; ~ 2 5 ): 32 ('42) 25-. - Pressure of radiation in moving system: 32-. — Impact of a wave-packet and a reflecting particle : 33 ('43) 163-66. — Impact of a wave-packet and an absorbing particle: 34 ('44) 222-28. — Historical note on the rate of a moving atomic clock: 37 ('47) 810-13. — The measurement of the velocity of light by signals sent in one direction: 38 ('48) 879-84. Lorentz-type transformations as derived from performable rod and clock operations: 39 ('49) 757-61. — Extrapolation from the MichelsonMorley experiment: 40 ('50) 185-91. — Derivation of the mass-energy relation: 42 ('62) 540-43. - Genesis of the query " I s there an e t h e r ? " : 43 ('53) 217f. - Note on "mass-energy relationship": 618f.

projection of motion pictures in relief: 21 ('33) 106-. — Transmission of motion pictures over a coaxial cable: 31 ('38) 256-. Nature [London] Rate of an atomic clock in motion: 141 ('38) 551. — The clock paradox in relativity theory: 168 ('51) 246. Philosophical Mag. Derivation of the Lorentz transformations: (7) 36 ('45) 392-403. Photographic J. Traill-Taylor lecture: Panstereoscopic photography and cinematography: 73 ('33) 482-96. Physical Rev. The depth of origin of photo electrons 1 ): (2) 40 ('32) 802-12. - The physical significance of Birkhoff's gravitational equations: 72 ('47) 229-32. Proc. amer. Acad. Aits and Sci. Rumford Medal lecture: Adventures with standing light waves: 81 ('51) 7-31. Proc. amer. philos. Soc. Revisions of the Lorentz transformations: 95 ('51) 125-31. Proc. physic. Soc. Thomas Young and the simplification of the artist's palette: 46 ('34) 16-34. Review sci. Instruments Unsymmetrical Doppler effect in hydrogen canal rays: 9 ('38) 283-. Science [USA] Measurement of velocity with atomic clocks: 91 ('40) 79-84. Scientific Proc. roy. Dublin Soc. The Fitzgerald contraction: 26 ('52/54) 9-26. Technical Studies Field fine Arts Use of polymerized vinyl acetate as an artist's medium 2 ): 4 ('35) 36-41.

Mit: ') H. B. Brigge; ') W. J. Clarke;') T. C. Fry; •) A. R. Olpin; ') G. R. Stilwell.

V VI

IVES, J a m e s Edmund. Physik. — 1921-31 Physicist, '31-36 Senior Physicist, U. S. Public Health Service, Washington, D. C. *1865, Sept. 19, London; fl943, Jan. 2. Todesanzeige Nature [London] 151 ('43) 471. J. industx. Hyg. Health aspects of radium dial painting, 3: Measurements of radioactivity in workers 5 ) 2 ): 15 ('33) 433-46. Public Health Bull. Atmospheric pollution of American cities for the years 1931 to 1933 with special reference to the solid constituents of the pollution 2 ) 1 ) 3 ) 4 ): Nr. 224 ('36) 75 S.

Public Health Rep. Loss of light due to smoke in Baltimore, Md., from October 1929 to September 1930: 48 ('33) 113-25. - Effect J. Soc. Motion Picture Engr. The problem on eye of yellow light of sodium vapor lamp: of projecting motion pictures in relief: 18 ('32) 49 ('34) 931-39. - Lighting for low cost 417-. — An experimental apparatus for the housing: 53 ('38) 895-901.

Ives, James — Iwase, Eiichi Sight-saving Rev. Social significance of better sight: 5 ('35) 116-25. Trans, illuminating Engng. Soc., New York Recent measurements of the brightness of the clear north sky in Washington, D.C. 6 ): 30 ('35) 281-92. — Sill ratio method of measuring daylight in the interior of buildings 6 ): 34 ('39) 523-43.

2213

dysprosium and terbium in alkaline earth fluorides 9 ): 86 ('63) 1179-83. - The luminescence spectra of triply-ionized rare earths in the calcination products of some magnesium compounds 9 ): 1183-87.

Bull. Inst, physic, and chem. Res. [Tokyo] Alle Arbeiten japan.; die Band- und SeitenMit: ') D.W.Armstrong; ') R.H.Britten; ') zahlen in 52) 49-53. - Fourth report of t h e K . I . K. reaction: Further studies on the propImperial Univ., Osaka; '39-46 Dir., erty of K. I. K. factor in the stomach juice Osaka Invalid Sanatorium, Kaizuka; of stomach cancer patients 8 ) 20 ): 44 ('53) 17-20 '48-61 Prof., '61 Prof. hon., Wakayama [japan.]. — Einfluß von Magensaft des 8 Ma16 Prefectural Medical College; '64- Consult- genkrebskranken auf einige Leberenzyme ) ): 73-75 [japan.]. - Effect of K. I. K. factor on ant, Torikata Seroimmunological Inst, various liver enzymes of animals, 1: Katalase; and Torikata Hospital, Osaka. ~ 2: Phosphatase 8 ) 16 ): 45 ('54) 643-48.

(2) C a 0 M g 0 - 2 S i 0 2 - M n 0 T i 0 2 , (3) C a 0 S i 0 2 2Ca0'Fe 2 0 3 1 0 ): 26 ('37/38) 592-603. - On the formation of two liquid layers in copper-iron alloys 11 ) 1 ): 618-40. — Absorption of hydrogen and nitrogen by pure iron 4 ): 27 ('38/39) 16288. : Science Kep. Bes. Inst., Töhoku Uniy., Ser. A Decarburized structures of steels 8 ): 1 ('49) 93f. — Abnormal steel and its structure 6 ): 95-100. — New type of graphitization of cast iron cooled through the eutectoid range 2 ): 139-42. — Research on the relation between cast iron and oxygen, 1: The mechanism of the formation of white cast iron under the influence of oxygen 5 ): 4 ('52) 392-402. — Thermodynamic activities in iron-cobalt solid solutions 14 ) 7 ): 8 {'56) 502-10.

. *1894, Okt. 29, Wakayama.

Zur Biogr. Festgabe: List of reports made in the I. Medical Clinic, Wakayama Prefectural Medical College, for the commemoration of t h e 10th anniversary of Prof. R. Iwatsuru's opening lecture (Tokyo [ ?] '56) 82 S. [japan.].

Igaku no Ayumi Phosphatase: 39 ('61) 5 3 57, 114-18, 171-75, 233f., 290-93 [japan.]

J. Biochemistry [Tokyo] Studies on Rivalta's reaction 11 ) 1 ): 17 ('33) 375-83. - On the digestibility or resorption coefficients of various fats in foods 14 ): 37 ('50) 397-408. - On 14 3 W . Nutrition and tuberculosis (Osaka '46) the digestibility of proteins in the diet ) ): 121 S. [japan.]. — Haemorrhage and its ae- 409-20. tiologie consideration (Tokyo '49) 248 S. [jaJapanese J. med. Sei., T i l l Über den Einpan.]. - Pain (Tokyo '50) 275 S. [japan.]. Diagnosis and therapy of diabetics (m. Y. fluß verschiedener Krankheitszustände auf Miyano) (Tokyo '50) 143 S. [japan.]. — (Mit- den Gehalt des Blutes an Fetten und Lipoiden, resp. arb.) Dietary therapy and its theoretical basis sowie auf deren Verteilung im Plasma, Serum und in den Blutkörperchen 11 ) 17 ): 4 (Tokyo '51) 582 S. [japan.]. ('36/38) 1-22. - Über den Gehalt des Blutes Biochemische Z. Über den Einfluß ver- an Phosphatase bei der myeloischen Leukschiedener Halogensalze auf den Gewebestoff- ämie 16 ): 334f. wechsel, 1: Einfluß der Natriumhalogenide Klinische Wschr. Brom-Ringer-Lösung und auf die Atmung und Glykolyse des Nierengewebes 2 ) 13 ): 254 ('32) 301-21. - Eine mano- deren klinische Anwendung: 15 ('36) 1528. metrische Methode zur Bestimmung des RestNisshin Igaku Resorption coefficient of stickstoffs sowie Gesamtstickstoffs 13 ) 6 ) 10 ): 256 proteins 3 ) 14 ): 37 ('50) 67-72 [japan.].

2216

Iwatsuru - - Izgarysev

Rinsho Igaku Über die klinische Anwendung von Brom-Ringer-Lösung: 21 ('33) Nr. 7, 1 - 5 [japan.]. Wakayama med. Rep. The mechanism of anemia induced by K. I. K . reaction 8 )'): 2 ('54/55) 1-6. — On a tuberculin destroying ferment "Tulysin" in a sensitized body 21 ): 8995. — Digestibility of fat in food and its significance 14 ) 3 ): 4 ('58/59) 133-37. - "Tulysin", a tuberculin destroying enzyme in patients with pulmonary tuberculosis and sensitized animals and its biological assay for the identification 23 ) 22 ) : 163-68. Mit: ») T. Adachi; «) N. Hosoda; 3) T. Iguchi; ') - ; ' ) T. Ito; •) Y. K a n a g a w a ; ' ) M. Katagami; •) I. Kato; •) M. Kawaguchi; ,0) K. Kobayashi; ") S. Kozawa; ") Y. Minami; ") Y. Nakai; ") T. Nakamura; ") K. Nanjo; ") H. Tamaki; ") M. Tamura; ") S. Taniguchi; ") A. Umitsu; M ) I. Yutani; ») K. Matoba; ") K. Ogura; »•) Y. Torantani. 71

IZGARYSEY, N i k o l a j Alekseevic. Chem. (physik., Elektrochem.). — 1923Prof., Techn. Hochsch. „N. E. Bauman" (ab '30: Chemische Akad.), Moskva; später wiss. Leiter am Inst. f. Nichteisenmetalle sowie wissenschaftl. u. pädagog. Tätigkeit an anderen Hoch- und Fachschulen, Moskva; zuletzt Leiter d. Lehrstuhls f. d. Technol. elektrochemischer Produktionsprozesse, Chem.-Technol. Inst. „D. I. Mendeleev", Moskva. — Staatspreis, Verdienter Wissenschaftler u. Techniker, Leninorden, Rotbannerorden (UdSSR), (gl) *1884, Nov. 16 (4), Moskva; fl956, März 21.

von Metallen [russ.] 1 '); Über Überzüge von Metallen ohne [russ.] 9 ).

galvanische Elektrolyse

S. Trudy 1-oj Konferencii po korrozii metallov pri Akademii nauk SSSR [Arbeiten der L Konferenz der Akademie der Wissenschaften der UdSSR über Metallkorrosion] (Moskva '35): Herstellung metallischer Überzüge ohne elektrischen Strom [russ.]. — Trudy Sovescanija po voprosam korrozii i bor'by s nej [Arbeiten der Konferenz über Fragen der Korrosion und ihrer Bekämpfung], 1938 (Moskva '40) 163-72: Neue Methoden des Korrosionsschutzes der Metalle [russ.]. — Trudy 2-oj Konferencii po korrozii metallov [Arbeiten der 2. Konferenz über Metallkorrosion] 1 (Moskva-Leningrad '40) 45-59: Elektrisch abgeschiedene Metallfilme und die Theorie der Elektrodenprozesse [russ.]. — Pocetnyj akademik Ivan Alekseevic Kablukov. Sbornik statej [Das Verdiente Akademiemitglied Ivan Alekseevic Kablukov. Sammlung von Aufsätzen] (Moskva '47) 23-32: Die Rolle des Verdienten Mitgliedes der Akademie der Wissenschaften der UdSSR I. A. Kablukov bei der Begründung und Entwicklung der Theorie der elektrolytischen Dissoziation [russ.]. — Trudy 2-oj Vsesojuznoj konferencii po teoreticeskoj i prikladnoj elektrochimii [Arbeiten der 2. Unionskonferenz über theoretische und angewandte Elektrochemie] (Kiev '49) 5-16: Geschichte der vaterländischen Elektrochemie [russ.]. — Trudy Sovescanija po elektrochimii [Arbeiten der Konferenz über Elektrochemie], Moskva 1950 (Moskva '53) 8 - 2 0 : Skizze der Geschichte der vaterländischen Elektrochemie [russ.]; 335-47: Moderne Theorie der Elektrooxydation und -reduktion ohne Metallabscheidung [russ.].

W . Polucenie elektroliticeskogo zeleza pri Zum 70. Geb.tag N . T . K u d r j a v c e v , S. pererabotke titanistogo zeleznjaka [DarstelV. G o r b a c e v , 2. fizic. Chim. 28 ('54) 1874-77 lung von elektrolytischem Eisen bei der Aufarbeitung von Titaneisenerz] (m. A. N. Kre(m. Bildn.). stovnikov) (Moskva '32) 31 S. (Institut priNekr. S . V . G o r b a c e v , M. G. C h a c a t u r - kladnoj mineralogii). — Elektrochimija cvetj a n , 2. fizic. Chim. 31 ('57) 928-31 (m. Schr.- nych i blagorodnych metallov [Elektrochemie verz.). der Bunt- und Edelmetalle] (Moskva-LeninMH. (Mitredakt.) P. A. A z b u k i n , N. A. grad '33) 344 S. — Korrozija metallov, priB e d r i c k i j , A . F . P r i t u l a , B o r ' b a s korroziej menjaemych v technike vodosnabzenija [Korpodzemnych sovruzenij (Proekty, instrukcii rosion der in der Wasserversorgungstechnik po zascite ot korrozii podzemnych trubopro- verwendeten Metalle] (Moskva '34). — Teovodov, elektrokabelej i dr.) [Der Kampf gegen rija i praktika vzaimnogo vytesnenija medie Korrosion unterirdischer Anlagen (Pro- tallov v svete sovremennoj elektrochimii [Die jektierungen, Instruktionen zum Schutze Theorie und Praxis der gegenseitigen Verdränvor Korrosion unterirdischer Rohrleitungen, gung der Metalle im Lichte der modernen Elektrokabel u. a.)] (Moskva-Leningrad '35) Elektrochemie] (Moskva '36) 24 S. — Agressiv72 S. (Techprop. Nauc.-issl. bjuro po zascite nye sredy chimiceskoj promyälennosti i korrometallov ot korrozii). — (Mitredakt.) Bor'ba s zija metallov chimiceskoj apparatury [Aggreskorroziej — bor'ba za metall. Sbornik statej sive Stoffe der chemischen Industrie und die [Kampf gegen die Korrosion — Kampf für das Korrosion der Metalle chemischer ApparaMetall. Sammlung von Aufsätzen] (Moskva turen] (Moskva '39) 36 S. — Kurs kolloidnoj '35); darin eigene Beiträge: Die Untersuchung chimii dlja special'nostej "porocha" i "vzryvdes Prozesses der gegenseitigen Verdrängung catye veScestva" [Lehrgang der Kolloid-

Izgarysev chemie f ü r die Fachgebiete „Pulver" und „Sprengstoffe"] (Moskva '44) 196 S. - Ocerki fiziceskoj chimii poroohov [Abriß der physikalischen Chemie von Pulvern] (Moskva-Leningrad '47) 95 S. — (Mitarb.) Chlornyj sposob termochromirovanija [Das Chlor-Inchromverfahren] (Moskva '47) 15 S. (Institut fiziceskoj chimii Akademii nauk SSSR). — Kurs teoreticeskoj elektrochimii [Lehrgang der theoretischen Elektrochemie] (m. S. V. Gorbacev) (Moskva '51) 503 S. Analele romino-soviet., Ser. Chim. Synthetisch-elektrochemische Fortschritte in der organischen Chemie'): 12 ('57) Nr. 1, 37-73 [rumän.]. Chimiieskoe MaSinostiroenie Chemische Widerstandsfähigkeit der Schweißnähte von Kesselblechen 2 »): 1 ('34) Nr. 1, 26-32 [russ.]. C. R. (Dokl.) Acad. Sei. URSS The mutual displacement of metals from the vapours of their salts and the application of this process in the fight against corrosion 28 ): 18 ('38) 43740. — Aus den Dämpfen entsprechender Metallsalze dargestellte Überzüge aus Aluminium-Chrom- und Chrom-Silber-Legierungen 28 ): 27 ('40) 457-59. - Uber eine Methode zur elektrolytischen Halogenierung von in Wasser unlöslichen Substanzen 26 ): 950-55. Dokl. Akad. Nauk SSSR Die mechanischen Eigenschaften von Chromdiffusionsschichten 10 ) 12 ): 55 ('47) 419-21. - Die Abhängigkeit des Anodenprozesses bei der Elektrosynthese der Perchlorate vom Kation des Ausgangselektrolyten 4 ): 56 ('47) 929-32. - Untersuchung des Kathodenprozesses bei der Elektroreduktion der Oxalsäure 2 ): 57 ('47) 45-48. — Über den Einfluß verschiedener Kationen auf den Anodenprozeß bei der Elektrolyse ihrer Chloride 4 ): 59 ('48) 1125-28. - Die Elektroreduktion von Aceton in Abhängigkeit von der Natur der Kathode und des Katalysators 2 ): 84 ('52) 313-15. - Über die Elektrosynthese der Aminobenzoesäuren 7 ): 90 ('53) 189f. — Adsorption organischer Stoffe an der Kathode und ihre Reduktionspotentiale 7 ): 581 f. — Die Mikrohärte von Siliciumdiffusionsüberzügen 10 ) 1 ): 91 ('53) 285 f. - Über die Elektrosynthese von p-Aminodiäthylanilinsulfat 1 6 ): 94 ('54) 913f. - Die Gewinnung glänzender Nickelniederschläge aus ammoniakhaltigen Elektrolyten 16 ) 20 ): 96 ('54) 143f. Änderung des Abscheidungspotentials von Wasserstoff an der Nickelkathode in Gegenwart einiger Zusätze') 1 1 ): 100 ('55) 311-14. Die Elektrosynthese des Anthranilsäuremethylesters') 3 ): 104 ('55) 744f. — Über den Mechanismus der elektrolytischen Oxydation von Schwefelsäure«): 106 ('56) 1039-41. Elektrochemische Oxydation von /9-Picolin5) ls ): 115 ('57) 557-59. Alle Arbeiten russ.

2217

[russ.]. — Die Gewinnung von metallischem Lithium durch Elektrolyse 24 ): 1932, 536-42 [russ.]. Izvest. Akad. Nauk SSSR, Otdel. chim. Nauk Mutual displacement of metals from the vapors of their salts and the utilization of this process for protection of metals: 1941, 673-81 [russ. m. engl. Zusammenfassg.]. — Die Bedeutung des Werkes des Akademiemitgliedes V. A. Kistjakovskij im Rahmen der Begründung der modernen Elektrochemie: 1946,12735 [russ.]. — Kationenabhängigkeit des Verlaufes von Anodenprozessen bei der Elektrolyse von Chloriden und Sulfaten: 1950, 15-26 [russ.]. J . Electrodepositors' techn. Soe. Zinc and cadmium plating in the U.S.S.R.: 13 ('37) 6 S. Korrosion u. Metallschutz Untersuchung des Prozesses der gegenseitigen Verdrängung von Metallen 19 ): 10 ('34) 109-12. Korrozija i Bor'ba s nej Korrosion metallischer Materialien beim Kochen und Aufbewahren von Pflanzensäften und Fruchtmus 2 9 ): 1 ('35) Nr. 1 [russ.]. Metal Industry [London] Zinc and cadmium plating in the U.S.S.R.: 50 ('37) 307. Metal Industry [New York] Practice of zinc and cadmium plating in the U.S.S.R.: 35 ('37) 218. Mineral'noe Syr'e Über den Einfluß von kolloidem Graphit auf die Korrosion von Kesselblech3»): 1934, Nr. 3, 43 f. [russ.]. Redkie Metally Über die elektrolytische Abscheidung von metallischem Niob und seine Trennung von Tantal 26 ) 13 ): 1933, Nr. 2, 4 1 47 [russ.]. Soobsß. Akad. Nauk Gruz. SSR Durch Chromsalzdämpfe erzeugte Chromüberzüge auf Eisen und Stahl 28 ): 1942, Nr. 3, 78- [ ]. Soobsö. nau£n. Rabot Clenov vses. chim. 0b§£. im. Mendeleeva Entwicklung der Lehre von der Korrosion und Maßnahmen zu ihrer Bekämpfung in der UdSSR seit 30 J a h r e n : 1948, Nr. 2, 1-9 [russ.]. Trudy Komissii po Bor'be s Korroziej Metallov Über Thermodiffusionsüberzüge auf Metallen: Nr. 2 ('56) 149-54 [russ.].

Usp. Chim. Professor Petr Petrovic Lebedev zum Gedenken: 17 ('48) 144f. [russ.]. - Fortschritte der Elektrosynthese in der organischen Chemie'): 25 ('56) 486-516 [russ.]. Z. Elektrochem. u. angew. physik. Chem. Der Einfluß des Wechselstromes auf die Stromausbeute bei der elektrolytischen Abscheidung von Metallen 16 ): 38 ('32) 131-35. Über die elektrolytische Abscheidung von metallischem Niob und seine Trennung von Tan26 Cvetnye Metally Standardisierung der Me- tal ): 39 ('33) 283-88; Über die elektrolyti13 thoden für die Untersuchung der Eigenschaf- sche Abscheidung von metallischem Niob,2 ): 31 40 ('34) 33-36. Die elektrolytische Abt e n metallischer Überzüge ): 1931, 713-19

2218

IzgaryseV - • Izmail'skij

21 Scheidung von Tantal aus wässerigen Lösun- sionsverzinnung von Metallen ): 757-61. — — Alle Arbeiten russ. gen2«): 295-97. Ferner Redaktion weiterer Konferenzbe2 . chim. PromySI. Die Anwendung metal- richte über Korrosionsfragen. lischer Überzüge für den Korrosionsschutz: 18 Mit: *) A. S. A k o p d i a n j a n ; •) 1.1. Arjamova; ('41) Nr. 15/16, 4-10 [russ.]. ') K. K. Babievskij; «) M. G. ChaSaturjan; V. G. Chomjakov; •) E. A. Efimov; ') M.Ja. 2 . fiziß. Chim. Die Struktur durch Chrom- Fioäln; ') N. K. Grigor'ev; ') A. N. Grigorovii; 10 salzdämpfe erzeugter Chromüberzüge auf Ei- ) N. S. Gorbunov; ") L. N. Ivanova; ") I. D. 28 Judin; ") G.E.Kaplan; ") - ; ») S. S. Krugllsen und Stahl ): 18 ('44) 143-46. - Katho- kov; '*) N. T. K u d r j a v c e v ; ") E. Ja. Majorova; denprozesse bei der Elektroreduktion von ") Y. V. Maloäuk; ") I. A. Mirkin; ") E. Y. MoroNitromethan 2 3 ): 24 ('50) 745-59. - Der Ano- zov; ")M. I. Parfenova; ") —; •') A. A. P e t r o v a r denprozeß der Elektrooxydation von Sulfaten ") S. A. Pletenev; ") V. S. Polikarpov; «•) A. F. ") Cüx. M. Ravikovli; ") S. Sarkisov; und seine Abhängigkeit von den Kationen 2 3 ): Prede; ") 1.1. SidoriSin; M) A. S. Smirnov; ") N. P. 881-87. — Untersuchung des Anodenpro- Egorova. zesses bei der Elektrolyse wässeriger Schwefelsäurelösungen in Konzentrationen, die den entsprechenden charakteristischen Punkten VI IZMAIL'SKIJ, V s e v o l o d Aleksander Diagramme von D. I. Mendeleev und N. S. droviö. Chem. (org.). — 1917-36 ForKurnakov entsprechen 6 ): 27 ('53) 130-45. — Über die Sauerstoffüberspannung in Schwefel- schungsleiter in Instituten d. Staatl. Anisäurelösungen 6 ) 18 ): 310f. — Einfluß des Oxy- linfarbenindustrie „Aniltrest"; '25-32 dationsgrades der Platinanode auf die Kinetik Vorstand d. Chem. Abteiig., Wiss. Forder elektrochemischen Sauerstoffabscheidung schungsinst. f. Mikrobiologie d. Volksin schwefelsauren Lösungen 6 ): 30 ('56) 160614. — Untersuchung der Abhängigkeit der kommissariats f. Volksbildg.; '26-41 Prof., Kinetik der Sauerstoffabscheidung an einer Staatl. Pädagog. Inst. „Karl Liebknecht", glatten Platinanode von der Schwefelsäure- Moskva; '38 Dr. d. chem. Wiss.; '41-43 konzentration 6 ) : 1807-15 [m. engl. Zusammen- Prof., Univ. Tomsk; '44-61 Prof., Städt. fassg.]. — Untersuchung der Kinetik der Elektrooxydation der Schwefelsäure®): 31 Pädagog. Inst. „V. P. Potemkin", Mosk-

('57) 1141-49 [m. engl. Zusammenfassg.]. Alle Arbeiten TUBS. 2 . obäüej Chim. Untersuchung des Prozesses der gegenseitigen Verdrängung von Metallen1») : 4 ('34) 982-87. - Über die elektrolytische Abscheidung von metallischem Niob, 2 13 ): 1415-21. - Die elektrolytische Abscheidung von metallischem Tantal aus wässerigen Lösungen 26 ): 1422-27. — Über die Elektrodenvorgänge beim Abscheiden und Auflösen von Metallen in Abhängigkeit von der Natur der Ionen und der Konzentration 1 7 ): 6 ('36) 1208-29. - Die elektrolytische Abscheidung von Blei und Zink aus ihren Sulfiden 8 ): 1676-85. Metallische Niederschläge aus Metallsalzdämpfen und ihre Anwendung als Korrosionsschutz 28 ): 8 ('38) 83033. —Elektrolytische Gewinnung von K u p f e r Zink-Nickel-Legierungen"): 9 ('39) 1443-55. — Untersuchung des Kathodenprozesses bei der Elektroreduktion der Oxalsäure 2 ): 18 ('48) 337-44. - Über die Rolle des Oberflächenzustandes der Kathode bei den Prozessen der Elektroreduktion aromatischer Nitroverbindungen 7 ): 24 ('54) 766-75. Alle Arbeiten russ. 2 . prikL Chim. Die Härte von durch Diffusion erhaltenen Chromüberzügen 10 ) 12 ): 20 ('47) 304-08. - Beziehung des Thermodiffusionsprozesses der Metallisierung von Metallen unter Bildung von intermetallischen Verbindungen und festen Lösungen zu ihrer Oberfläche 21 ): 25 ('52) 752-56. - Thermodiffu-

va; '61-68 Prof., Staatl. Pädagog. Inst. „V. I. Lenin", Moskva. — '47 Verdienter Wissenschaftler d. RSFSR; Leninorden (UdSSR). *1885, Dez. 9 (Nov. 27), Vü'no. Bildn. 2. obäcej Chim. 31 ('61) vor S. 1789. -

2. org. Chim. 1 ('65) vor S. 2081. Zum 80. Geb.tag Festschrift [Symposium zu Ehren V. A. Izmail'skijs in Char'kov, 2 5 . - 2 7 . Nov. 1965]: Azometiny. Stroenie, svojstva, primenenie [Azomethine. Struktur, Eigenschaften, Anwendungen] (Rostov na Donu '67) 293 S. (m. Bildn. vor S. 1); darin eig. Beiträge: 13-20: Zur Geschichte der Frage nach dem Zusammenhang der Spektren von Azomethin-Verbindungen mit der Mesomerie [russ.].; 96-111: Spektren der Derivate von Benzylidenanilin und das Problem der Akoplanarität 9 ) [russ.]; 180-92: Spektren der Derivate von Benzyliden-4-aminostilben 10 ) [russ.]; 193-201: Über die Spektren der Derivate von Benzyliden-a-naphthylamin 9 ) [russ.]. Ue. u . Bearb. G. R u p e , Lekcionnye opyty po organiceskoj chimii [aus d. Deutschen: H. R u p e , Anleitung zum Experimentieren in der Vorlesung über organische Chemie] (Leningrad '36) 330 S. S. Problemy anilinokrasocnoj chimii. Trudy IV Sovescanija po anilinokrasocnoj chimii i technike [Probleme der Anilinfarbenchemie. Arbeiten der 4. Konferenz über Anilinfarbenchemie und -technik], 1939 (Moskva-Lenin-

Izmail'skij grad '40) 41-62: Über die Theorie der Farbe organischer Verbindungen; Tautomerie und Mesomerie, komplexe Mesomerie [russ.]. — Voprosy anilinokrasocnoj chimii. Trudy VIII Sovescanija ~ [Fragen der Anilinfarbenohemie. Arbeiten der 8. Konferenz —], 1947 (Moskvar-Leningrad '50) 21-24: Erinnerungen an N. M. Kizner [russ.]; 88-120: Exomolekulare Wechselwirkung und Farbe organischer .Verbindungen [russ.]. — Nekotorye voprosy sinteza i primenenija krasitelej [Einige Fragen der Synthese und der Verwendung von Farbstoffen] [Sammlung von Vorträgen einer Konferenz, Leningrad 1954] (Leningrad '56) 76101: Über die Farbe und über die Absorptionsund Reflexionsspektren von Diphenylmethanund Diphenyläthanderivaten, die polare Chromophore in verschiedenen Kernen enthalten [russ.]. — Tezisy dokladov, Naucno-techniceskaja konferencija po voprosam sinteza i primenenija organiceskich krasitelej [Thesen der Vorträge der wissenschaftlich-technischen Konferenz über Fragen der Synthese und der Verwendung organischer Farbstoffe], Ivanovo 1956 (Ivanovo '56) 38 f.: Über die Absorptionsund Reflexionsspektren der Azomethine mit Nitround Elektronendonatorgruppen 35 ) [russ.]; 40-42: Über die Prüfung der Farbstoffeigenschaften von Azo-Direktfarbstoffen: Substantivitätszahl, Fixationszahl, Index der Echtheit gegen Wasser und Sodalösung [russ.]. — VIII Mendeleevskij s-ezd po obscej i prikladnoj chimii. Referaty dokladov i soobscenij, 2: Sekcija organiceskoj chimii i technologii [VIII. Mendeleev-Kongress für allgemeine und angewandte Chemie. Referate der Vorträge und Mitteilungen, 2: Sektion Organische Chemie und Technologie] (Moskva '59) 284r-86: Spektren der Molekülkomplexe mit Chinolinium- und Acridinium-Komponenten 37 ) 16 ) [russ.]; 287-89: Spektren der 2-Phenyl-chinolinium-Salze mit den Dimethylamino-Derivaten von Chinolin und Acridin 41 ) [russ.]; 290: Spektren der Molekülkomplexe von 9-[p-Dimethylaminostyrol]-acridin mit Acridinium-Salzen 6 ) [russ.]; 293-95: Absorptions- und Reflexionsspektren von /3-4-Nitround 0-2,4-Dinitrophenyläthylanilin und ihrer Derivate 21 ) [russ.]. — Stroenie vescestva i spektroskopija [Struktureigenschaften und Spektroskopie] (Moskva '60) 41-52: Absorptionsspektren der Derivate von N-[/?-(4-Nitrophenyl)-äthyl]-anilin 21 ) [russ.]; 53-61: Spektren der Derivate von N-[/3-(2,4-Dinitrophenyl)-äthyl]-anilin 21 ) [russ.]. — Fiziceskie problemy spektroskopii. Materialy X I I I sovescanija, 1960 [Physikalische Probleme der Spektroskopie. Materialien der X I I I . Konferenz, 1960] 1 (Leningrad-Moskva '62) 25962: Spektren der Acridinium-Salze und ihrer Molekülkomplexe mit Diphenylamin 41 ) [russ.]; 262-65: Einfluß der Akzeptor-Substituenten auf die Spektren der Diphenylamin-Derivate a7 24 ) ) [russ.]; 265-68: Einfluß der Elektronen-

2219

donator-Gruppen auf die Spektren der 4-N0 2 Diphenylamin-Derivate 27 ) [russ.]; 268-71: Über den Einfluß des «-Elektronen-Systems bei Molekularkomplexen von Elektronendonator-Komponenten mit onium-N-heterozyklischen Salzen16) [russ.]. W. Upraznenija po kursu organiceskoj chimii (Dlja vuzov chim. special'nostej) [Übungen für den Lehrgang in organischer Chemie (Für Chemie-Hochschulen)] (m. A. M. Simonov, E. A. Smirnov) (Moskva-Leningrad '49) 492 S.; 2 ('52) 496 S.; ungar.: (Budapest '51) 464 S.; rumän. : (Bucuresti '52, '55); poln. : (Warszawa '54) 460 S. ; auch chines. — O podgotovke ucitelej chimii v pedagogiceskich institutach [Über die Vorbildung der Chemielehrer an pädagogischen Instituten] (Moskva '53) 21 S. (Akad. pedag. nauk RSFSR, Institut teorii i istorii pedagogiki, Doklad 2). Anilinokrasoënaja Promysl. Untersuchungen auf dem Benzidingebiet, 3: Verluste bei der Fabrikation von Benzidinbasen und reduzierende Spaltung aromatischer Hydrazoverbindungen während der Umlagerung 31 ) 33 ): 2 ('32) Nr. 3, 10-16 [russ.]. - Über die quantitative Trennung von Diphenylin und Benzidin 30 ): 4 ('34) 407-12 [russ.]. Ber. dtsch. ehem. Ges. Untersuchungen auf dem Gebiete der Wismut-Weinsäure-Verbindungen, 7: Über die Einwirkung von Ammoniak auf Monowismutweinsäure; Reaktion der Monowismutweinsäure mit aromatischen Aminen 16 ) 12 ): 68 ('35) 415-21. Bull. Soc. chim. France Systèmes auxoénoïdes (1) séparés du chromophore, 1: Contribution à l'étude de la coloration des dérivés de 2-nitro-diphénylamino-arsinique contenant des auxo-groupes complémentaires 35 ): (5) 3 ('36) 1540—45; Systèmes auxoénoïdes séparés, 2 : Sur la coloration des dérivés nitro-benzoylés des amines aromatiques 36 ) : 4 ('37) 81-94 ; — 3 : Sur l'influence de la position des groupes nitroet auxo- sur la coloration des nitrobenzoylearylamides 36 ) : 94-111. — La structure et la toxicité des acides arsiniques de la série de la diphénylamine 36 ) : 8 ('36) 1739-53. - Recherches dans le domaine de l'alcoylation, 5: Sur la formation de l'oxyde d'éthyle à partir du chlorure d'éthyle et quelques remarques théoriques 29 ) : 2028-37. Chimiéeskaja Nauka i Promysl. Einige Fragen zur Theorie des Farbzustands organischer Verbindungen: 3 ('58) 232-48. - Absorptions- und Reflexionsspektren der Anilide der /3-[Acridyl-(9)]-propionsäure41): 829 f. — Spektren der Derivate von l-[Benzolazo]naphthol-(2), die kontrapolarisierte elektronenabstoßende Systeme besitzen 22 ): 4 ('59) 279f. — Spektren der Derivate von l-[Benzolazo]-3-phenyl-carbamoyl-naphthol-(2), die kontrapolarisierte elektronenabstoßende Sy-

2220

Izmail'skij

sterne besitzen 23 ): 280f. — — Alle Arbeiten russ. 2 . Tses. chim. Obsê. im. Mendeleeya Alkylderivate von 4-Nitrodiphenylamin 27 ) : 5 ('60) 237 f. — Exomolekulare Reaktionen und Farbigkeit: Absorptionsspektren der Molekülkomplexe von Naphthylaminen mit Nitrobenzol 16 ): 347-49; ~ : Untersuchung der Absorptionsspektren der Lösungen von Nitroarenen in Dimethylanilin 16 ) : 592 f. — Absorptionsspektren von Lösungen von Acridiniumsalzen mit Diphenylamin 41 ) : 705 f. — Spektren von Derivaten des 4-Nitrodiphenylmethans 11 ): 6 ('61) U l f . - Einfluß der Lösungsmittel auf die photochemische und thermische cis-trans-Isomerisierung von Perinaphththioindigo 25 ) 32 ): 7 ('62) 108f. - Einfluß der N-Methylierung auf das Spektrum von 2,4-Dinitrodiphenylamin-Derivaten 23 ) 20 ) : 8 ('63) 238 f. - Einfluß des Ersatzes des Benzolkerns durch den Naphthalinkern in Verbindungen mit getrennten chromophoren Systemen»): 9 ('64) 359f. — Einfluß der Substitution des Benzolkerns durch Anthracen in Verbindungen mit getrennten chromophoren Systemen 8 ): 595-97. — 2-Phenylaminothiophen-Derivate 28 ) : 707-09. — Färbung und Spektren von p-N0 2 -Benzolsulfaniliden 5 ) : 11 ('66) 345f. - Über den Einfluß der Einführung von Gruppen mit starker Elektronendonatorwirkung in 4'-Stellung auf das Absorptionsspektrum von 2,4-Dinitrophenylamin 23 ) 8 ) : 12 ('67) 325f. - - Alle Arbeiten russ. Chimiko-farm. PromySl. Zur Frage der Gewinnung von 3-Nitro-4-oxyphenyl-l-arsinsäure aus p-Chloranilin 36 ) : 1938,317-26 [russ.]. — Zur Frage des Bismoverolpräparates: 34749 [russ.]. C. R. (Dokl.) Acad. Sei. URSS Vom Chromophor getrennte auxo-enoide Systeme, 4: Über die Farbe der Nitrobenzoylderivate aromatischer Amine 4 ): 14 ('37) 17-22; ~ 8: Sur la coloration des arylamides de l'acide p-nitrophénylacétique 38 ): 20 ('38) 669-73; ~ 9: Sur la coloration des arylamides de l'acide pnitro-hydrocinnamique 36 ) : 675-79; ~ 11: Über die Klassifikation zusammengesetzter chromophorer Systeme, die elektrophile Chromophore und Auxochrome enthalten: 26 ('40) 909-14; ~ 12: Über die Analyse der Strukturbedingungen, die den Farbzustand von Verbindungen mit ununterbrochenen und unterbrochenen konjugierten Systemen bestimmen: 915-19; ~ 14: Über die Darstellung des 8Nitro-a-naphthmethylchlorids und die Farbe der entsprechenden Arylaminoderivate 19 ) : 28 ('40) 621-24. — Sur les formules électroniques de la double et triple liaison: 23 ('39) 658-62. — Über die Reaktionsfähigkeit des Naphthalinkerns im Zusammenhang mit der Erscheinung der Zerstreuung des elektromeren Effekts. Über die Methyl- und Chlormethyl-

gruppen: 29 ('40) 98-102. — A water-soluble camphor: Camphor Vi: 42 ('44) 216-20. Dokl. Akad. Nauk SSSR Das Prinzip der Alternierung der Spinorientierung und Ji-Elektronenformeln: Benzol, Naphthalin, Sauerstoff und andere Beispiele: 60 ('48) 395-98. — Zum Problem der Farbe der Cyaninfarbstoffe. Lichtabsorption durch Molekularverbindungen von Chinolinium- und Pyridiniumsalzen mit Aminen 37 ): 587-90. — Intermolekulare Wechselwirkungen und Farbigkeit. Absorptionsspektren der Molekülverbindungen von Chinoliniumsalzen mit aromatischen Aminen 37 ): 76 ('50) 391-94. — Absorptionsspektren der Molekülkomplexe aromatischer Amine mit Chinoliniumsalzen. Untersuchung des Absorptionsspektrums des Molekülkomplexes 4-[p-Dimethylaminostyryl]-chinolin -+l-Äthyl-2-styrylchinoliniumjodid 37 ): 91 ('53) 1119-22. — Absorptionsspektren der Molekülkomplexe von 9-[p-Dimethylaminostyryl]acridin mit 10-Äthyl-9-[jS-carbäthoxyäthyl]acridiniumjodid 41 ) : 121 ('58) 111-14. - Absorptionsspektren einiger Molekülkomplexe aus Benzacridin- und Dibenzacridin-Derivaten 16 ): 129 ('59) 572-75. - Absorptionsspektren von Derivaten des p-Nitrodiphenylamins. Über die Rolle von N H als Isolator der optischen Konjugation in Diphenylamin-Derivaten 2 7 ): 1053-56. — Absorptionsspektren der Lösungen von Dimethylaminostyryl-Derivaten des Acridins in Nitrobenzol 16 ) : 132 ('60) 598-601. — Absorptionsspektren von 4-Nitrodiphenylamin-Derivaten. Einfluß einer Alkylierung der NH-Gruppe und von Elektronendonator-Gruppen in m-Stellung 27 ) : 133 ('60) 594-97. — Absorptionsspektren von Derivaten des Diphenylmethans und Diphenyläthans mit Nitro- und Aminogruppen in verschiedenen Kernen 11 ): 139 ('61) 373-76. Messung von Spektren in gemischten Lösungsmitteln mit Alkanen als Methode zur Untersuchung der Wechselwirkung eines Stoffes mit dem Lösungsmittel 26 ): 601-04. — Mikrostruktur und Spektren von Benzylidenanilinund Azobenzol-Derivaten und ihren Salzen 23 ) : 141 ('61) 857-60. — Über die relative Empfindlichkeit der Absorptionsspektren von Merocyaninen gegenüber Lösungsmitteln 25 ) : 142 ('62) 600-03. — Die Bande der exo-Reaktion in den Spektren der Salze von Diphenylalkanen mit N0 2 - und OH-Gruppen an verschiedenen Ringen 11 ): 820-23. — Absorptionsspektren von 2,4-Dinitroanilin-Derivaten. Vorhandensein quasiautonomer chromophorer Systeme 23 ): 146 ('62) 1094r-97. Spektren von Donator-Akzeptor-Komplexen der 4-Nitrodiphenylalkane mit Donatorgruppen in 4'-Stellung. Elektronenspinresonanzeffekt 11 ) 24 ): 153 ('63) 1363-66. - Die Genetik der Spektren der Derivate von Benzylidenanilin und Benzyliden-l-naphthylamin, die N0 2 - und NMe r Gruppen enthalten 9 ) : 158 ('64) 900-03. — Zum Problem der Mikro-

ïzmail'skij struktur des Thiophens und der Genetik der Spektren 28 ): 159 ('64) 1083-86. - Mikrostruktur und Elektronenakzeptoreigenschaften der Sulfofluoridgruppe 26 ) : 163 ('65) 140407. — Genetik der Spektren der Derivate des Benzolsulfanilids 5 ) : 166 ('66) 114-17. - Genesis der Spektren von Derivaten des 4Benzoylaminostilbens vom Standpunkt der quasiautonomen Chromophorsysteme 10 ) : 177 ('67) 1091-94. — — Quasiautonome Systeme in den UV-Spektren von Benzolderivaten mit einigen Nitro- und Aminogruppen in gegenseitiger ortho- und para-Stellung 23 ) 8 ) : 179 ('68) 349-52. - Über die Spektren von Diaminen mit kontrapolarisierten Systemen. Bathochromieeffekt bei Acylierung18)10) : 183 ('68) 341-44. — Genesis der Absorptionsspektren von Benzolderivaten, die p-Didonator- und p-Diakzeptor-Kontrasysteme enthalten 2 ) 23 ): 190 ('70) 95-98. - - Alle Arbeiten russ.

2221

2 . obseej Chim. Zur Frage der Zersetzung des Salicylsäuremethoxymethylesters 4 ): 6 ('36) 1193-97. — Über die besondere Wachstumsform der Kristalle bei einigen Derivaten des l-Amino-2-methyl-4-benzoylamino-5methoxybenzols 39 ): 7 ('37) 80-83. — Untersuchungen auf dem Gebiet der Alkylierung, 5: Über die Bildung von Äthyloxid aus Äthylchlorid sowie einige theoretische Bemerkungen 29 ): 111-17; ~ 6: Über die Verseifung von Äthylchlorid unter der Einwirkung alkalischer Reagenzien 29 ): 8 ('38) 695-98 [m. franz. Zusammenfassg.]. — Die Struktur und die Giftigkeit der Arsinsäuren der Diphenylaminreihe 36 ): 7 ('37) 499-507. — Vom Chromophor getrennte auxo-enoide Systeme, 1: Über die Farbe von Derivaten der 2-Nitrodiphenylamin-4-arsinsäure, die komplementäre Auxogruppen enthalten 35 ): 508-12; ~ 2: Über die Farbe der Nitrobenzoyl-Derivate aromatischer Amine 36 ): 513-22; ~ 3: Über den Einfluß der Stellung der Nitro- und Auxogruppen auf die Farbe der Nitrobenzoylarylamine 36 ): 523-37; — 5: Über die Farbe der Nitrobenzoyl-Derivate aromatischer Amine 36 ): 8 ('38) 1730-41 [m. engl. Zusammenfassg.]; — 6: Über die Farbe der Nitrobenzyl-Derivate aromatischer Amine 39 ): 9 ('39) 647-62; ~ 7: Über den Einfluß der zweiten Auxogruppe auf die Farbtiefe von Nitrobenzylarylaminen 39 ): 1007-14; — 15: Über die Erscheinungen bei Estern der

Izvest. Akad. Nauk SSSR, Otdel. cbim. Nauk Synthese und Emissionsspektren von N[/t-(4-Nitrophenyl)-äthyl]-anilin- und N-[/J(2,4-Dinitrophenyl)-äthyl]-anilin-Derivaten 21 ): 1959,1500-04 [russ.]. — Absorptionsspektren von N-[/?-(4-Nitrophenyl)-äthyl]-anilin- und N-[^-(2,4-Dinitrophenyl)-äthyl]-anilin-Derivaten 21 ): 1684-88 [russ.]. Izvest. Akad. Nauk SSSß, Otdel. techn. Nauk Über den Prozeß der Sulfierung vom Stand- 4-Nitro- und 3,5-Dinitrobenzoesäure mit Phepunkt der Koordinationstheorie: 1938, Nr. 5, nolen, die eine ergänzende Auxogruppe enthalten 3 ): 11 ('41) 650-60; ~ 16: Über die 100-03 [ ]. Farberscheinungen der Ester von 2,4-DinitroIzvest. vyssich uëebnyeh Zavedenij, Ivanovo, hydrozimtsäure und 4-Nitrozimtsäure mit Chimija i chim. Technol. Die Wasserstoffbin' Phenolen, die eine ergänzende auxochrome dung und die Konfiguration der Moleküle des Gruppe enthalten; Schlußfolgerungen aus p- und m-N-[/?-(4-Nitrophenyl)-äthyl]-amino- früheren Untersuchungen 3 ): 691-706; Gephenols21)17)24) : 4 ('61) 867 f. [russ.].) trennte donor-enoide Systeme, 17: Farbe von J. Pharm, et Chim. Sur la préparation de Nitrobenzoyl- und Nitrobenzyl-Derivaten des l'acide nitro-3-hydroxy-4-phénylarsinique-l à 5-Aminoacenaphthens und des 2-Aminoflupartir de la p-chloraniline 35 ) : (8) 22 ('35) 337- orens: 13 ('43) 685-92 [m. engl. Zusammenfassg.]; — 18: N-2'-p-Nitrophenyläthylanilin 57. und seine Derivate 1 ): 693-96 [ ~ ] ; ~ 21: J. Soc. Dyers and Colourists Extramolecular Farberscheinungen in N-(3-Phthalimidoprointeraction and the colour of organic com pyl)- und N-(2-Phthalimidoäthyl)-Derivaten pounds: 68 ('52) 464. aromatischer Amine 3 ): 14 ('44) 216-25 [ ~ ] ; Sovetskij Vesta. Venerol. i Dermatol. Unter- Wechselwirkung zwischen nichtkonjugierten suchungen über chemotherapeutische Wismut- Systemen, 23: Resonanz und Farbe von präparate, 6: Über den Einfluß des Öls auf Diphenylamin-Derivaten, 1: Konjugierte, die Verträglichkeit der Präparate") : 1934, durch Elektronen35 abgebendes N-Atom verbundene Systeme ): 16 ('46) 1659-66 [ ~ ] ; 538-41 [ ]. ~ 24: « 2: Über die Farbe von 2,4-DinitroUkrainskij chim. 2 . Absorptionsspektren diphenylamin-Derivaten: 1667-79 [ ~ ] ; Gevon 3-Oxo-2,3-dihydrothio-naphthen und sei- trennte chromophore Systeme, 29: Vergleinen Derivaten, 2: Isomerie von 2-Benzyliden- chende spektroskopische Untersuchungen von 3-0X0-2,3-dihydrothionaphthen 25 ): 27 ('61) 4-Nitrobenzyliden- und 4-Nitrobenzyl-Deri234-37 [russ.]. vaten aromatischer Amine 36 ): 25 ('55) 1400Verbindungen mit mala2 . îizië. Chim. Über die Spektren des 12. — Synthese von Wirkung, 1: Zur Frage der Benzylidenanilins, seiner Derivate und seiner riabekämpfender Beziehung zwischen der Struktur und den Salze 9 ): 39 ('65) 768-71 [russ.]. - Struktur der pharmakologischen Eigenschaften 35 ): 10 ('40) S...O-Bindung in p-substituierten Benzol 1580-87; — 2: Benziminazol-Verbindungen 26 sulfofluoriden )') : 40 ('66) 1934-38 [russ.]. 141 Poggendorff

2222

Izmail'skij

mit einer y-Diäthylaminopropyl-Gruppe 3 5 ): gegen Lichteinwirkung von 2-Benzyliden-31588-99. — Nikolaj Nikolaevic Vorozcov: I S oxo-2,3-dihydrothionaphthen-Derivaten 2 5 ): 33 ('43) 525-39. — Polyarylmethan-Verbindun- ('63) 739-44; ~ 7: Benzyliden-Derivate des5gen, 1: F a r b e von Diphenyl- und Triphenyl- Nitro-3-oxo-2,3-dihydrothionaphthens 26 )^ 35 methan-Derivaten mit Nitrogruppen und ('65) 520-24. — Über die eigentümliche ÄußeElektronendonator-Substituenten in verschie- rung des Orthoeffektes in der Thioindogeniddenen Ringen 40 ) 42 ): 834-47 [m. engl. Zu- reihe 25 ): 31 ('61) 3839. - Über die N a t u r der sammenfassg.]; — 2: Farbe von Tetraphenyl- phototropen Veränderungen der Absorptionsmethan-Derivaten mit Nitrogruppen und spektren von Thioindigoiden 25 ) 34 ): 32 ('62) Elektronendonator-Substituenten in verschie- 660. — Salze von p-Dimethylaminoazobenzol denen Ringen 4 0 ): 848-63 - Exomoleku- mit Trifluoressigsäure in Dichloräthan 2 3 ): lare Wechselwirkungen und Farbzustand, 5: 3451 f. — Einfluß der Substitution des BenzolUntersuchung der Absorptionsspektren von rings durch den Naphthalin- u n d AnthracenMolekülkomplexen von Nitroverbindungen ring, 1: Absorptionsspektren von Monomit aromatischen Aminen 1 3 ): 24 ('54) 1402- und Dinitrophenyläthyl-a-naphthylamin 9 ): 34 15; ~ 6: Untersuchung der Absorptions- ('64) 3872-77. - Genetik der Absorptionsspektren von Molekülkomplexen aus 1,3- spektren von 2,4-Dinitroanilin und 2,4-DiDinitrobenzol und 2,4-Dinitrostilben mit Di- nitrodiphenylamin. Experimentelle Bestätimethylaminostilben 1 3 ) 3 8 ): 26 ('56) 1766-78; gung des Vorhandenseins quasiautonomer ~ 8: Absorptionsspektren der Molekül- chromophorer Systeme 2 3 ): 35 ('65) 776-85. — komplexe aus 9-[p-Dimethylaminostyryl]- Hyperchromieeffekt in den Spektren von n acridin und 10-Alkyl-9-methylacridinium- 4-Nitro-4'-benzoylaminodiphenylalkanen ) salzen 6 ): 29 ('59) 1842-50. — Zur Analyse von 2 4 ): 36 ('66) 214-18. - Besonderheiten des Struktureinflüssen auf das Spektrum, 1: Ver- Absorptionsspektrums von Benzolsulfochlorid gleichende Untersuchung von Farberscheinun- 26 ): 37 ('67) 279f. - Quasiautonome Systeme gen bei Azomethinen des Typs 0 2 N C 6 H 4 C H = in den Absorptionsspektren von Aren-DeriNC 6 H 4 A und A C J H J C H = N C 6 H 4 N 0 2 ; Emis- vaten, 5: Vergleich der Absorptionsspektren sions- und Absorptionsspektren 3 6 ): 26 ('56) der Derivate von N-l-2',4'-Dinitrophenyl-N3042-60. — Kontrapolarisierte Systeme und 2-phenyläthylendiamin und von 2,4-DinitroFarbzustand, 1: Über die Spektren einiger diphenylamin 23 ) 8 ): 1055-63. — AbsorptionsDerivate von 4-Nitrobenzanilid, die mehrere spektren von Komplexen der Oniumsalze von Elektronendonator-Chromophore in einem S,0-Heterozyklen mit aromatischen Aminen Ring enthalten 2 2 ): 29 ('59) 2623-30; ~ 2: 1 4 ): 38 ('68) 2121. - Bathochromieeffekt bei Reflexionsspektren der Derivate von N-[/9- der Acylierung von Aminen mit einem di(4-Nitrophenyl)-äthyl]-anilin mit p- und in- donatorischen kontrapolarisierten System 1 8 ): ständigen Elektronendonator-Chromophoren 39 ('69) 2366f. Alle Arbeiten russ. 21 ): 2631-38; ~ 3: Einfluß des Ersatzes der - C H a N H - G r u p p e durch die -CH 2 CH 2 NHorg. Chim. Synthese von 4-DimethylGruppe und der Methylierung von N H in Ver- aminobenzolsulfo-4'-nitroanilid 6 ) 43 ): 2 ('66) bindungen der Struktur p'-0 2 NC 6 H 4 (CH 2 ) n - 1321 [russ.]. — Über Darstellung und EigenNHC 6 H 4 A-p 2 1 ): 2927-36; - 4: Reflexions- schaften des Thioxanthydrols 1 4 ): 3 ('67) 1142f. spektren von N-[/9-(2,4-Dinitrophenyl)-äthyl]- [russ.]. — Darstellung und Eigenschaften von anilin-Derivaten 2 1 ): 31 ('61) 1788-99; ~ 5: Äthern des Thioxanthydrols 14 ): 4 ('68) 904-07 Absorptionsspektren von m- und p-Dinitro- [russ.]. benzol und ihren Molekülkomplexen mit Di2 . prikl. Chim. Untersuchungen auf dem methylanilin 3 ): 30 ('60) 393-402. - Über die Darstellung des 2- und 4-Styryl-Derivats des Gebiet der Alkylierung, 7: Die Darstellung Chinolins mit Hilfe von Benzylidenanilin 37 ): der Diäthylmetanilsäure und des Diäthyl-m29 29 ('59) 3930-34. Kontrapolarisierte aminophenols ): 12 ('39) 776-85 [russ. m. Systeme und Spektrum, 5: Über den Farbzu- franz. Zusammenfassg.]; ~ 8: Die Alkylierung stand einiger Derivate von 4'-Nitro-4-amino- mittels Äthylchlorids bei Gegenwart von benzanilid mit zusätzlichen Methyl- und Calciumoxid und Magnesiumoxid 29 ): 786-89 Methoxygruppen im Anilinring 22 ): 3935-43; [ ~ ] , — Synthese von Diazokomponenten, die ~ 7: Einfluß zusätzlicher Elektronendonator- eine Sulfofluorid-Gruppe enthalten 2 6 ): 38 ('65) gruppen im zweiten Ring auf das Spektrum 2562-66 [russ.]. von p-Dimethylaminoazobenzol 2 2 ): 34 ('64) Einige weitere Beiträge in Sammelwerken 3554-61. — Absorptionsspektren von 3-Oxo2,3-dihydrothionaphthen und seinen Deriva- und Kongreßberichten. ') Z. M. B a j r a m o v ; •) G. D. Barabaäova; ten, 3 26 ): 31 ('61) 17-28; ~ 4: Über den Ein- Mit: 3 ) A. V. B e l o c v e t o v ; ') B. M. B o g o s l o v s k i j ; ') fluß von Lösungsmitteln auf die Größe der E. V. Cecegoeva; «) S. V. D m i t r i e n k o ; ') L. N. Solvatochromieverschiebung des Absorptions- D r o z d o v ; ") V. V. E f r e m o v ; ') Ju. A. F e d o r o v ; maximums 2 5 ) 3 ): 32 ('62) 1746-55; ~ 5: Ein- ») fi. I. F e d o r o v a ; ») V. A. Gluäenkov; ") S. ") A.N. Guseva; ") G. E. I v a n o v ; fluß von Orthosubstituenten auf das Ab- Gorodncv; ") S. S. K a g a n o v a ; ") N. A. K i t r o s s k i j ; ")N. D. sorptionsspektrum und auf die Stabilität K o s t r o v a ; 1S) A. Ja. K o i e v n i k o v a ; '") A . N . Kozin; '•) M. K. Larina; ") V. E. L i m a n o v ; ") A. V. Malygina; *>) E. E. Milliarcsi; ") Ju. S.

Izmail'skij — Izumi Moâkovskij; '•) M. A. Mostoslavskij ; ") Ju. I. Naumov; ") K. A. N u r i d ï a n j a n ; ") P. F. Polevâèikov; ") B. V. Popov; *°) R. B. Roäal; ") E. P. RustanovicS; ") M. M. Sapkina; 33) P. T. Sapuntenok; ") I. N. Sevcuk; •») A. M. Simonov; ••) E. A. Smirnov; •') P. A. Solodkov; ") E. S. Solov'eva; ") V. I. S t a v r o v s k a j a; ") D. K. Surkov; ")L. D. Viänevskij ; *') M. A. Volodina; ") L. Ch. Vinograd; ") Y. N. D o b r o n r a v o v .

™ IZUMI, S h i n - i c h i . Math. - 1937 D. Sc., '37- Prof., Tôhoku Univ., Sendai; '50- Prof., Tokyo Metropolitan Univ. (gl) *1904, Juli 2, Sendai. MHZ. Tôhoku math. J . 41 ('35/36) ff. W . Introduction to the theory of Fourier series (Taipei '65) 116 S. — — Ferner Lehrbücher über Funktionentheorie und Infinitesimalrechnung in japan. Sprache. Acta math. Acad. Sei. hungar. On some theorems on conjugate functions 6 ): IB ('62) 133-43 [m. russ. Zusammenfassg. S. VI]. Annals Math. Strong law of large numbers for sequences of almost periodic functions 2 ): (2) 69 ('59) 718-32. J. Analyse math. Théorèmes élémentaires sur les séries de Fourier lacunaires 6 )') : 14 ('65) 235-46. J. Fac. Sei., Hokkaido UniT., Ser. 1 Fourier series, 8: Absolute Riesz summability 16 ): 13 ('57) 130-44; ~ 9: Strong summability of the derived Fourier series8) : 145, 165. J. indian math. Soc. Absolute convergence of some trigonometric series, l 1 ): (N.S.) 24 ('61) 191-210. J. London math. Soc. Notes on Fourier analysis, 21: On the degree of approximation of the partial sums of a Fourier series : 26 ('50) 240-42. J. Math. [Tokyo] Notes on Fourier analysis, 4 0 : 1 ('51/53) 80-86; ~ 44: On t h e law of the iterated logarithm of some sequences of functions: 1-22. — Some trigonometrical series, l 1 1 ): 110-16; ~ 2: 128-36. J. math. Analysis and Appl. Absolute convergence of some trigonometric series, 2 : 1 ('60) 184-94. J. math. Soc. Japan Notes on Fourier analysis, 12: Determination of (the jump of) a function by its Fourier series: 1 ('49) 226-31. Japanese J. Math. On some integral equations 9 ): 12 ('35/36) 81-94. — Lebesgue integral in the abstract space: 13 ('36/37) 501-13. Kodai math. Semin. Rep. Fourier series, 10: Rogosinski's lemma 16 ): 8 ('56) 164-80. Mathematica japon. Notes on Fourier analysis, 4 : On the absolute Riesz summability of Fourier series 11 ): 1 ('49) 140-50. Proc. amer. math. Soc. Two theorems concerning convergence of Fourier series: 10 ('59) 744-54; 11 ('61) 999. 141*

2223

Proc. imp. Acad., Tokyo A new concept of integrals [, 1]: 9 ('33) 570-73; ~ 2 : 1 0 ('34) 57 f. — A new proof of the Andersen's theorem: 140-42. — On the Wiener's formula: 393-96. — A general convergence theorem: 11 ('35) 10-12. — A remark on an integral equation: 210f. — Notes on Fourier series, 1: Riemann sum'): 13 ('37) 385-87; ~ 2: Convergence factor 7 ): 388-91; ~ 3 : Absolute summability'): 14 ('38) 32-35. - On the compactness of a class of functions: 15 ('39) 111-13. — A non-homogeneous ergodic theorem: 189-92. — An abstract integral, 1: 16 ('40) 21-25; ~ 2: 87-89; ~ 3 13 ): 518-23; ~ 4: 17 ('41) 1 - 4 ; ~ 5 11 ) 14 ): 18 ('42) 45-49; ~ 7:53-56; ~ 10:543-47. - Lattice theoretic foundation of circle geometry: 16 ('40) 515— 17. — Notes on Banach space, 1: Differentiation of abstract functions: 18 ('42) 127-30; ~ 5: Compactness of function spaces: 19 ('43) 99-101; ~ 6: Abstract integrals and linear operations 16 ): 169-73. — A note on infinite series1«): 18 ('42) 532-34. — A remark on ergodic theorems: 19 ('43) 102-04. — Notes on differentiation 16 ): 105-09. Proc. Japan Acad. A simple proof of Littlewood's Tauberian theorem: 80 ('54) 927-29. — Some trigonometrical series, 12: 31 ('55) 207-09; ~ 13: 257-60; ~ 14: 324-26; ~ 15: 399-401; ~ 16: 511f.; ~ 17 16 ): 659-64; ~ 18 15 ): 32 ('56) 20-23; ~ 19: 90-92; ~ 20: 93-96. — On the strong summability of t h e derived Fourier series, 2 8 ): 31 ('55) 107-10. — Fourier series, 1: Parseval relation 15 ): 32 ('56)446-50; ~ 3 : Wiener's problem: 527f.; ~ 4: Korevaar's conjecture: 655-57; ~ 5: A divergence theorem: 33 ('57) 1 - 3 ; ~ 12: Bernstein polynomials 16 ) 1 '): 67-69; ~ 14: Order of approximation of partial sums and Cesaro means 16 ) 16 ): 114-18; ~ 16: The Gibbs phenomenon of partial sums and Cesaro means of Fourier series, l 1 6 ): 284-88; ~ 17: « 2 16 ): 289-92. — On lunary Fourier series 8 ): 41 ('65) 648-51. Proc. physico-math. Soc. Japan Infinite series with multiply monotone terms: (3) 16 ('34) 127-31. — On multiply monotone sequences 4 ) : 132-36. — On Cesaro's theorem 16 ): 297-302. - On some inequalities 10 ) 1 '): 34551. — On some integral equations, 3 9 ): 18 ('36) 565-71. Science Rep. Tohoku imp. Univ., Ser. I General convergence theorems 1 '): 23 ('34/35) 477-83. — Remarks on Fourier integrals: 484-90. — On the generalized Fourier integrals, 1:880-906; ~ 2: 907-19. - On Wiener's proof of Plancherel's theorem: 24 ('35) 55-62. — On the Wiener's formula: 63-76. — On the Verblunsky's generalization of the Denjoy integrals: 344-51. — On some integral equations, 2: 25 ('36) 50-55. Tohoku math. J. The derivatives and approximate derivatives of finite functions: 37 ('33) 241-47; 39 ('34) 180. - On the linear

2224

Izumi — Jablczynski

operations [, l] 9 ): 42 ('36) 54-64; ~ 2 9 ): 44 ('38) 130-38. - On the P. Riesz' lemma: 42 ('36) 65 f. — Some general convergence theorems 2 ): 191—94. — On the bilinear funct i o n a l : 195-209. — Lebesgue integral as the inverse of the differentiation: 43 ('37) 225-32. — Quasi-analytic class and closure of {tB} in the interval ( - oo, oo)'): 267-73. — Notes on Fourier series, 4: Stieltjes integrals'): 44 ('38) 410-20; ~ 5: Absolute Riesz' summability'): 45 ('39) 134-44; ~ 6: A theorem on the absolute convergence'): 157-61; ~ 7: A remark on absolutely summable factors'): 19496; ~ 8: On the behaviour of partial sums and Fejer's means of Fourier series'): 21218; ~ 9: Uniform Cesaro summability'): 46 ('40) 117-22; ~ 10: Summability'): 15458; — 11: Inequality theorem in the strong summability'): 47 ('40) 14-17. — On certain series of functions'): 46 ('40) 91-105. — Theorems on Norlund's method of summation, l 3 ): 47 ('40) 6-13; ~ 2 3 ): 69-73. - Notes on Fourier analysis, 8: Local properties of Fourier series: (2) 1 ('49/50) 136-43; ~ 16: 144-66; ~ 16[ ?]: On the strong law of large numbers

and gap series: 8 ('51) 89-103; ~ 26: Some negative examples in the theory of Fourier series: 2 ('50) 74-95; ~ 27: A theorem on Cesaro summation: 8 ('51) 212-15; ~ 35: 1 ('49/50) 285-302; ~ 39: Theorems concerning Cesaro summability 16 ): 313-26; ~ 48: Uniform convergence of Fourier series 16 ): 3 ('51) 298-305; ~ 49: Some negative examples 11 ) 18 ): 5 ('53) 43-51. — Some trigonometrical series, 4: 18-21; - 5: 29-33; ~ 6: 290-95; ~ 7: 268-71; ~ 8: 296-301; ~ 9: 6 ('54) 30-34; - 1 0 : 69-72; ~ 11: 73-77. - On an approximation problem in the theory of probability: 5 ('53) 22-28. — Integrability of trigonometrical series, l 1 6 ): 6 ('54) 258-63. — Absolute convergence of Fourier expansions " ) : 7 ('55) 243-51. - On the absolute logarithmic summability of Fourier series of order one 12 ): 8 ('56) 201-04. Mit: ') R. P. Boas, jr.; ») S. Bochner; ') G. Hayashi; •) D. l t d ; ' ) M. Izumi; •) J. P. Kahane; ') T. Kawata; ') M. Kinukawa; •) T. Kitagawa; 10 ) K. Kobayashi; ») N. Matsuyama; ") R. Mohanty; ") M. Nakamura; ") M. Orihara; ") M. Satd; ") G. Sunouehi; ") T. Takahasbi; ") T. Tsuchikura; *•) S. Vshiyama.

J "" JABLCZYNSKI, K a z i m i e r z Stanislaw. Chem. (anorg., physik.). — 1918-24 außerord. Prof., '24-39 ord. Prof., '18-39 Leiter der Abt. Chem. d. Metalle, Univ. Warszawa. *1869, März 25, Warszawa; fl944, Okt. 12, Milanowek. Kekr. W. K e m u l a , Roczn. Chem. 23 ('49) 349-60 (m. Bildn., Schr.verz.). Zur Biogr. W. K e m u l a in: Polski slownik biograficzny 10 (Warszawa '62) 206f. S. I X Congreso internacional de química pura y aplicada, Madrid 1934, 2 (Madrid '35) 145-57: Über die Zustandsgieichung für Gase. Physikalische Z. Über die Zustandsgleichung von van der Waals, 1: 33 ('32) 536-43; Über die Zustandsgieichung für Gase, 2: 35 ('34) 731-37. Roczn. Chem. Kinetik der Wasserlöslichkeit leicht löslicher Salze 4 ): 12 ('32) 9-22. — Löslichkeitskinetik von Substanzen in nichtwässerigen Lösungen 18 ): 23-34. — Die van der Waalssche Gleichung, 1: 773-81; ~ 2: 13 ('33) 75-84; ~ 3: Die Beziehung zwischen den van der Waalsschen Koeffizienten und den Molekül- und Atomdimensionen: 14 ('34) 1013; ~ 4: Die Abhängigkeit des Koeffizienten a

der van der Waalsschen Gleichung von der Temperatur: 93-97; ~ 5: Fundamentalgleichung der Gase: 171-76; ~ 6: 285-94; ~ 7: Der Binnendruck in Gasen: 15 ('35) 45059; ~ 8: Die Dampfisothermen und die Kondensationskurve des Kohlendioxids: 16 ('36) 566-73. — Gleichgewichtsgesetz für starke Elektrolyte, Bromide und Jodide der Alkalimetalle 1 ): 12 ('32) 880-87. - Gleichgewichtsgesetz für Elektrolyte 18 ): 13 ('33) 167-75. — Kinetik der Koagulation von kolloidalem Gold»): 15 ('35) 283-89. - Das Gleichgewicht in Lösungen dreiioniger Elektrolyte 1 1 ): 350-59. — Jod in polnischen Wässern 5 ) 16 ): 16 ('36) 19-23. - Der Einfluß von Nichtelektrolyten auf die Koagulationsgeschwindigkeit von Eisenhydrat 6 ): 141-45. — Der Einfluß der Verdünnung auf das kolloidale Eisenhydrat 1 '): 301-05. - Unsichtbare Strahlung, 1: Bei Reaktionen in Gasen 13 ): 406-10; ~ 2: Bei Reaktionen im flüssigen Zustand 2 ): 17 ('37) 387-91. - Der Einfluß des Harnstoffs und des Mannits auf die Leitfähigkeit von Chlorkalium 8 ): 16 ('36) 411-15. — Die Koagulation des kolloidalen Ferrihydrates durch Quecksilberverbindungen 3 ): 17 ('37) 196-200. - Die Kinetik der Lumineszenz des weißen Phosphors'): 431-35. der — Die Koagulationsgeschwindigkeit Kolloide: 18 ('38) 45-68. - Einfluß von Nichtelektrolyten auf die Koagulationsgeschwindig-

2224

Izumi — Jablczynski

operations [, l] 9 ): 42 ('36) 54-64; ~ 2 9 ): 44 ('38) 130-38. - On the P. Riesz' lemma: 42 ('36) 65 f. — Some general convergence theorems 2 ): 191—94. — On the bilinear funct i o n a l : 195-209. — Lebesgue integral as the inverse of the differentiation: 43 ('37) 225-32. — Quasi-analytic class and closure of {tB} in the interval ( - oo, oo)'): 267-73. — Notes on Fourier series, 4: Stieltjes integrals'): 44 ('38) 410-20; ~ 5: Absolute Riesz' summability'): 45 ('39) 134-44; ~ 6: A theorem on the absolute convergence'): 157-61; ~ 7: A remark on absolutely summable factors'): 19496; ~ 8: On the behaviour of partial sums and Fejer's means of Fourier series'): 21218; ~ 9: Uniform Cesaro summability'): 46 ('40) 117-22; ~ 10: Summability'): 15458; — 11: Inequality theorem in the strong summability'): 47 ('40) 14-17. — On certain series of functions'): 46 ('40) 91-105. — Theorems on Norlund's method of summation, l 3 ): 47 ('40) 6-13; ~ 2 3 ): 69-73. - Notes on Fourier analysis, 8: Local properties of Fourier series: (2) 1 ('49/50) 136-43; ~ 16: 144-66; ~ 16[ ?]: On the strong law of large numbers

and gap series: 8 ('51) 89-103; ~ 26: Some negative examples in the theory of Fourier series: 2 ('50) 74-95; ~ 27: A theorem on Cesaro summation: 8 ('51) 212-15; ~ 35: 1 ('49/50) 285-302; ~ 39: Theorems concerning Cesaro summability 16 ): 313-26; ~ 48: Uniform convergence of Fourier series 16 ): 3 ('51) 298-305; ~ 49: Some negative examples 11 ) 18 ): 5 ('53) 43-51. — Some trigonometrical series, 4: 18-21; - 5: 29-33; ~ 6: 290-95; ~ 7: 268-71; ~ 8: 296-301; ~ 9: 6 ('54) 30-34; - 1 0 : 69-72; ~ 11: 73-77. - On an approximation problem in the theory of probability: 5 ('53) 22-28. — Integrability of trigonometrical series, l 1 6 ): 6 ('54) 258-63. — Absolute convergence of Fourier expansions " ) : 7 ('55) 243-51. - On the absolute logarithmic summability of Fourier series of order one 12 ): 8 ('56) 201-04. Mit: ') R. P. Boas, jr.; ») S. Bochner; ') G. Hayashi; •) D. l t d ; ' ) M. Izumi; •) J. P. Kahane; ') T. Kawata; ') M. Kinukawa; •) T. Kitagawa; 10 ) K. Kobayashi; ») N. Matsuyama; ") R. Mohanty; ") M. Nakamura; ") M. Orihara; ") M. Satd; ") G. Sunouehi; ") T. Takahasbi; ") T. Tsuchikura; *•) S. Vshiyama.

J "" JABLCZYNSKI, K a z i m i e r z Stanislaw. Chem. (anorg., physik.). — 1918-24 außerord. Prof., '24-39 ord. Prof., '18-39 Leiter der Abt. Chem. d. Metalle, Univ. Warszawa. *1869, März 25, Warszawa; fl944, Okt. 12, Milanowek. Kekr. W. K e m u l a , Roczn. Chem. 23 ('49) 349-60 (m. Bildn., Schr.verz.). Zur Biogr. W. K e m u l a in: Polski slownik biograficzny 10 (Warszawa '62) 206f. S. I X Congreso internacional de química pura y aplicada, Madrid 1934, 2 (Madrid '35) 145-57: Über die Zustandsgieichung für Gase. Physikalische Z. Über die Zustandsgleichung von van der Waals, 1: 33 ('32) 536-43; Über die Zustandsgieichung für Gase, 2: 35 ('34) 731-37. Roczn. Chem. Kinetik der Wasserlöslichkeit leicht löslicher Salze 4 ): 12 ('32) 9-22. — Löslichkeitskinetik von Substanzen in nichtwässerigen Lösungen 18 ): 23-34. — Die van der Waalssche Gleichung, 1: 773-81; ~ 2: 13 ('33) 75-84; ~ 3: Die Beziehung zwischen den van der Waalsschen Koeffizienten und den Molekül- und Atomdimensionen: 14 ('34) 1013; ~ 4: Die Abhängigkeit des Koeffizienten a

der van der Waalsschen Gleichung von der Temperatur: 93-97; ~ 5: Fundamentalgleichung der Gase: 171-76; ~ 6: 285-94; ~ 7: Der Binnendruck in Gasen: 15 ('35) 45059; ~ 8: Die Dampfisothermen und die Kondensationskurve des Kohlendioxids: 16 ('36) 566-73. — Gleichgewichtsgesetz für starke Elektrolyte, Bromide und Jodide der Alkalimetalle 1 ): 12 ('32) 880-87. - Gleichgewichtsgesetz für Elektrolyte 18 ): 13 ('33) 167-75. — Kinetik der Koagulation von kolloidalem Gold»): 15 ('35) 283-89. - Das Gleichgewicht in Lösungen dreiioniger Elektrolyte 1 1 ): 350-59. — Jod in polnischen Wässern 5 ) 16 ): 16 ('36) 19-23. - Der Einfluß von Nichtelektrolyten auf die Koagulationsgeschwindigkeit von Eisenhydrat 6 ): 141-45. — Der Einfluß der Verdünnung auf das kolloidale Eisenhydrat 1 '): 301-05. - Unsichtbare Strahlung, 1: Bei Reaktionen in Gasen 13 ): 406-10; ~ 2: Bei Reaktionen im flüssigen Zustand 2 ): 17 ('37) 387-91. - Der Einfluß des Harnstoffs und des Mannits auf die Leitfähigkeit von Chlorkalium 8 ): 16 ('36) 411-15. — Die Koagulation des kolloidalen Ferrihydrates durch Quecksilberverbindungen 3 ): 17 ('37) 196-200. - Die Kinetik der Lumineszenz des weißen Phosphors'): 431-35. der — Die Koagulationsgeschwindigkeit Kolloide: 18 ('38) 45-68. - Einfluß von Nichtelektrolyten auf die Koagulationsgeschwindig-

Jablczynski - • Jabloriski keit von kolloidalem Antimon- und Arsentrisulfid 12 ) 16 ): 557-62. - - Alle Arbeiten poln., zum Teil m. deutscher oder französ. Zusammenfassg. Z. anorg. u. allg. Chem. Vergiftung und Aktivierung des Zinks 10 ): 207 ('32) 157-60. Vergiftung und Aktivierung des Aluminiums und Cadmiums beim Lösen in Salzsäure 14 ): 217 ('34) 298-304.

Mit: A. B a i c z e w s k i ; •) A. C h o l e w i c k i ; ') S. Cioiek; «) J. G u t m a n ; •) A. H a r t m a n ; •) J. H e l w i c h ; ') H. J a b t c z y n s k a - J $ dMr z e j e w s k a ; •) Z. J a r o w s k i ; ») W. K o s c h a n y ; ) J. K u l e s z a ; ") R . L e g a t ; ") S. Obr?baki; ") W. O r l o w s k i ; ") T. P i e r z c h a l a k i ; ") O. P r z y g o d a ; ") M. S a l w i n ; ") B. S a w o n i a k ; >•) A. W a l c z u k ; ") J. W o j c i e chowska.

JABLONSKI, Alexander. Physik (Atom- und Molekularoptik). — 192538 Assist., '34-38 Doz., Univ. Warszawa; '38-39 Prof., Stefan-Batory-Univ., Wilno; '43-45 Doz., Polish School of Medicine, Edinburgh; '45-68 Prof., NikolausKopernikus-Univ., Torun. — '63 Preis (Ministerf. Hochschulbildung); '64 Staatspreis; '68 Smoluchowski-Medaille (Poln. Physikal. Ges.). *1898, Febr. 26, Voskresenovka, Gouv. Kursk, Rußland. Zum 70. Geb.tag Acta physica polon. 34 ('68) 579-767, 771-832 (m. Bildn.). - T. S k a l i n s k i , Post?py Fizyki 19 ('68) 445-50 (m. Bildn.). Schriftenverzeichnis Roczn. Towarz. nauk. warszawsk. 44. 1951 ('53) 88f. S. Luminescence of organic and inorganic materials. International conference, New York 1961 (NewYork-London '62) 110-14: Decay and polarization of fluorescence of solutions. W. O wplywie oddzialywan mi?dzycz%steczkowych na zjawiska absorpcji i emisji ¿wiatla (Warszawa '34) 62 S. [Habilitationsschrift]. Acta physica polon. Über die Fluoreszenzausbeute in wässerigen Fluoreszeinlösungen bei antistokesscher Erregung: 2 ('33) 97-103 [m. poln. Zusammenfassg.]. — Über die Polarisation der Photolumineszenz der doppelbrechenden Kautsky-Phosphore: 3 ('34) 42134 [ ~ ] . — Weitere Versuche über die negative Polarisation der Phosphoreszenz: 4 ('35) 31124 [ ~ ] . — Über die Absorption und die Emission des Lichtes durch orientierte, in festen Medien eingebettete Moleküle: 371-87 [ ~ ] . — Über die Bestimmbarkeit der Anisotropie der den Molekülen zugeordneten Ersatzoszillatoren aus den Messungen der Polarisation der Photolumineszenz: 389-94 [ ~ ] . — Über einige optische Eigenschaften

2225

der in festen und flüssigen Medien eingebetteten Moleküle: 5 ('36) 271-87. - Alfred Denizot, 1873-1937: 6 ('37) 95 f. [französ.], 97-99 [poln.]. — Bemerkungen zum FranckCondon-Prinzip : 350-55 [m. poln. Zusammenfassg.]. — Über die wellenmechanische Behandlung der LinienVerbreiterung: 371-91 [ - ] ; 7 ('38) 196-206 [ - ] ; 8 ('39) 71-75 [ ~ ] , — Ist die Grundpolarisation temperaturabhängig?: 15-23 [ ~ ] . — Über die Abhängigkeit der natürlichen Spektrallinienbreite von der Geschwindigkeit der emittierenden Atome: 76-78. — Influence of torsional vibrations of luminescent molecules on t h e fundamental polarization of photoluminescence of solutions: 10 ('50/51) 33-36. - Fundamental polarization of photoluminescence and torsional vibrations of molecules : 193-206. — A note on the Franck-Condon principle: 11 ('51) 195 f. — Two simple methods of measurement of the rate of polarization of light 1 ) 3 ) 4 ) : 12 ('53) 149-51 [m. russ. Zusammenfassg.]. — Magnetic rotation of the plane of polarization of broadened resonance lines: 13 ('54) 91-94 [ ~ ] . — Quenching of photoluminescence of solutions: 175-86 [ ~ ] , — Yield of anti-Stokes fluorescence of dye solutions: 239-42 — Self-depolarization and decay of photoluminescence of solutions: 14 ('55) 295-307 [—]; 17 ('58) 481 f. - Note on the theory of the polarization of photoluminescence of solutions: 14 ('55) 497-99. — A note on the diffusion controlled processes in luminescent solutions: 16 ('56) 263-66 [m. russ. Zusammenfassg.]. — Decay of photoluminescence of solutions: 16 ('57) 471-79 [ ~ ] ; 17 ('58) 482. — Pressure effects on spectral lines: 23 ('63) 493-500. — Polarization of fluorescence of solutions: 26 ('64) 427-33. - Inclusion of the Lorentz effect into theories of the pressure broadening of spectral lines based on the Franck-Condon principle: 27 ('65) 49-55. — Emission anisotropy and decay of fluorescence of solutions: 28 ('65) 717-28. Bull. Acad, polon. Sei., Cl. III Yield of photoluminescence of solutions: 6 ('57) 513-17 [m. russ. Zusammenfassg. S. XLIII]. Bull. Acad, polon. Sei., Sér. Sei. math., astron. et physiques The metastable state of dye molecules: 6 ('58) 589-93 [m. russ. Zusammenfassg. S. XLII]. — Quenching of photoluminescence of solutions by energy transfer: 663-69 [ ~ LII]. — On the notation of emission anisotropy: 8 ('60) 259-64 [ ~ X X I I ] . — Depolarization of fluorescence of liquid solutions: 655-60 LII]. — A note on the notion of emission anisotropy: 10 ('62) 555 f. [ ~ X X X I I I ] , - Does the intensity distribution within the photoluminescence band depend on the frequency of the exciting light?: 15 ('67) 885-88 XLIX]. Bull. int. Acad, polon. Sei. et Lettres, Sér. A Sur la polarisation de fluorescence des matières

2226

Jablonski — Jacek

colorantes en fonotion de la longueur d'onde de la lumière excitatrice: 1934, 14-17. — Über die negative Polarisation der Phosphoreszenz adsorbierter Farbstoffmoleküle. (Vorläufige Mitteilung): 1935, 30-33. - On the effects observed with elliptically polarized light acting on selectively photoelectric surfaces 8 ): 19&1, 291-301. Mathesis polska Über die natürliche Breite von Spektrallinien: 7 ('33) 65-75 [poln.]. Nature [London] Efficiency of anti-Stokes fluorescence in dyes: 131 ('33)'839f. - Polarized photoluminescence of adsorbed molecules of dyes: 133 ('34) 140. — Thermal rotations of fluorescent molecules and duration of luminescence 7 ): 135 ('35) 582. — Temperature influence on the pressure broadening of spectral lines 2 ): 142 ('38) 1122; 144 ('39) 594. - Long duration of the Balmer spectrum in excited hydrogen: 155 ('45) 397. Nauka polska Über die Notwendigkeit der Errichtung eines Physikalisch-Technischen Forschungsinstitutes in Polen: 21 ('36) 28793 [poln.]. — Atom- und Molekularoptik in Polen: [N.P.] 6 ('58) Nr. 2, 81-91 [poln. m. russ. Zusammenfassg.]. Nuovo Cimento Fluorescent emission of resonance lines at higher pressures : (9) 10 ('53) 573-80 [m. ital. Zusammenfassg.]. — Virtual oscillators in the metallic model of luminescent molecules: (10) 2 ('55) 995-1000 [ ~ ] . Physica Pressure broadening of spectral lines: 7 ('40) 541-51. Physical Rev. General theory of pressure broadening of spectral lines: 68 ('45) 78-93; 69 ('46) 31. — On the phase-shift approximation in the theory of pressure broadening of spectral lines: 73 ('48) 258f. Physikalische Z. Sowjetunion Zu L. Tumermann: „Über die Abhängigkeit der Fluoreszenzspektren von der Viskosität des Lösungsmittels": 8 ('35) 105-08. Pokroky Mat., Fysiky a Astron. Einige Probleme der Photolumineszenz von Lösungen: 7 ('62) 275-83 [tschech.]. Polish Science and Learning Some notes on the importance of scientific and technical research in Poland: 5 ('44) 69-. Post^py Fizyki Die Photolumineszenz der Kristalle: 1 ('50) 249- [poln.]. — Internationales Kolloquium über die Lumineszenz einiger Kristalle (Paris, 22.-27. Mai 1956): 7 ('56) 468-70 [ ~ ] . — Peter Pringsheim. Zum 80. Geburtstag am 29.3. 1961: 12 ('61) 3-6 [ ~ ] . — Lumineszenz von Lösungen: 13 ('62) 15-25 [ ~ ] , — Über die Arbeiten des Lehrstuhls für experimentelle Physik der NikolausKopernikus-Universität: 14 ('63) 641-47 [ ~ ] . — 19th Meeting of Polish physicists (Cracow, 21-26 September 1965). Impressions of a participant: 17 ('66) 107f. [poln. m. engl.

Zusammenfassg.]. — Fundamental polarization of photoluminescence of solutions: 18 ('67) 663-72 [ ~ ] . Z. Naturforsch. Über die Abklingungsvorgänge polarisierter Photolumineszenz: 16a ('61) 1-4. Z. Physik Über die durch Absorption in den Na 2 -Banden angeregte Banden- und Linienfluoreszenz des Natriumdampfes 5 ) 8 ): 77 ('32) 26-34. - Zu H. Kuhn und S. Arrhenius: Messung der Dissoziationswärme des Cadmiummoleküls auf thermisch-optischem Wege: 85 ('33) 268. — Über den Mechanismus der Photolumineszenz von Farbstoffphosphoren: 94 ('35) 38-46. — Eine Theorie der zeitlichen Abklingung des Leuchtens bei polarisierter Fluoreszenz von Farbstofflösungen [, 1]: 95 ('35) 53-65; Über die Abklingungsgesetze der polarisierten Fluoreszenz, 2: 103 ('36) 526-35. — Zur Theorie der Polarisation der Photolumineszenz von Farbstofflösungen: 96 ('35) 236-46. Mit: P. D r z e w i e c k i ; *) H. H o r o d n i c z y ; ') A. K a w s k i ; ') M. K r y s z e w s k i ; •) P. P r i n g s h e i m ; •)R. R o m p e ; ^ W . S z y m a n o w s k i ; ' ) S . Z i e m e c k i .

^ JACEK, W a w r z y n i e c Jan. Chem. — 1919-33 Chemiker, '33-38 Mitarbeiter, Staatl. Geol. Inst., Warszawa. *1885, Sept. 14, Krakow; j-1944, Deutschland. Schriftenverzeichnis (Auszug) CzterdzieSci lat Instytutu Geologicznego. 1919-1959 (S. Börska, S. Smolenski) 1 (Warszawa '60) 548. Bull. int. Acad. polon. Sei. et Lettres, Sir. A Über die Auflösungsgeschwindigkeit von Marmor in Säuren, 2: Über die Abhängigkeit der Lösungsgeschwindigkeit des Marmors von der Konzentration der Salzsäure: 1932, 65-73; ~ 3: Über die Lösungsgeschwindigkeit von Marmor in Bromwasserstoffsäure: 1933, 37480; ~ 4: Lösungsgeschwindigkeit von Marmor in Überchlorsäure und in Salpetersäure: 1934, 73-80. Roczn. Chem. Die Geschwindigkeit der Bildung eines Niederschlages von amorphem Schwefel in einem einfachen Falle: 15 ('35) 258-72. — Über die Auflösungsgeschwindigkeit zerkleinerter Körper, 2: 16 ('36) 339-47; ~ 3: 17 ('37) 64-72; ~ 4: Die Ermittlung des am häufigsten auftretenden Wertes des Koeffizienten | : 293-300; ~ 5 : Die Anwendung der vereinfachten kinetischen Gleichung zur Berechnung der Auflösungsgeschwindigkeit von in Wasser leicht löslichen Körpern: 301-08 ; ~ 6 : Über die Auflösungsgeschwindigkeit von Kaliumeisen(III)-cyanid und Kaliumbichromat: 18 ('38) 18-23; ~ 7: Indirektes Verfahren zur Feststellung der Gültigkeit der allgemeinen Gleichung für die Auflösungsgeschwindigkeit: 24-30; ~ 8: Lösung von Kaliumsulfat in

Jacek — Jackson, Frank

2227

Wasser: 19 ('39) 116-21; ~ 9: Lösung von Alaun: 122-28; ~ 10: Lösungsgeschwindigkeit von Weinsäure und Zucker in Wasser: 243-48; ~ 11: Lösungsgeschwindigkeit von Calciumsulfat (Alabaster) in Wasser: 463-70. — — Alle Arbeiten poln., zum Teil m. deutscher Zusammenfassg.

('42) 661-67. - Legendre functions of the second kind and related functions: 50 ('43) 291-302. — The harmonic boundary value problem for an ellipse or an ellipsoid: 51 ('44) 555-63. Annals Math. Series of orthogonal polynomials: (2) 34 ('33) 527-45. — Orthogonal trigonometric sums: 799-814. — Orthogo111 VI polynomials in two complex variables : 39 " JACKSON, Charles Loring. Chem. nal ('38) 262-68. — A class of orthogonal func— 1911 Prof. Emeritus, Harvard Univ., tions on plane curves: 40 ('39) 521-32.

Cambridge, Mass. Bull. amer. math. Soc. Certain problems of *1847, Apr. 4, Boston, Mass.; closest approximation: 39 ('33) 889-906. — tl935, Okt. 30, Prides Crossing, Mass. Note on relations connecting certain cases

Nekr. G. P. B a x t e r , F. G. P e a b o d y , E. H. H a l l , Science [USA] 88 ('36) 294-96. G. S. F o r b e s , Biographical Mem., Nation. Acad. Sei. USA 87 ('64) 97-128 (m. Bildn., Faks., Schr.verz.). V VI

of convergence in the mean: 40 ('34) 152-58. — The summation of series of orthogonal polynomials : 743-52. — Polynomial approximation on a curve of the fourth degree: 43 ('37) 388-93. — Note on certain orthogonal polynomials: 47 ('41) 96-102. - Generalization of a theorem of Korous on the bounds of orthonormal polynomials: 48 ('42) 602-08. — The boundedness of orthonormal polynomials on certain curves of the third degree: 52 ('46) 899-907. Duke math. J. Formal properties of orthogonal polynomials in two variables: 2 ('36) 423-34. — Orthogonal polynomials on a plane curve: 3 ('37) 228-36. - Orthogonal polynomials in three variables: 4 ('38) 441-54. — Boundedness of orthonormal polynomials on loci of the second degree: 11 ('44) 351-65.

' JACKSON, Dunham. Math. 1919-46 Prof., '46 Prof. Emeritus, Univ. of Minnesota, Minneapolis, Minn.; '21 Vice-Pres., American Math. Soc.; '24-25 Vice-Pres., '26 Pres., Math. Assoc. of America; '27 Vice-Pres., American Assoc. for the Advancem. of Sei., Sect. A. — '35 Chauvenet Prize for 1932-1934 (Math. Assoc. of America). *1888, Juli 24, Bridgewater, Mass.; Trans, amer. math. Soc. Bernstein's theofl946, Nov. 6, Minneapolis, Minn. rem and trigonometric approximation: 40 Nekr. W. L. H a r t , Biographical Mem., Nation. Acad. Sei. USA 33 ('59) 142-79 (m. Bildn., Faks., Schr.verz. 75 Nrn.); Bull. amer. math. Soc. 64 ('48) 847-60 (m. Schr.verz. 63 Nrn.). MHZ. Trans, amer. math. Soc. 28 ( ' 2 6 ) - 3 2 ('30). S. Encyclopaedia Britannica. A new survey of universal knowledge 18 (ChicagoLondon-Toronto... '65) 194-96: Polynomial 1 ). W. Fourier series and orthogonal polynomials (Oberlin, O.-La Salle, 111. '41) 8 + 2 3 4 S. (Mathematical Association of America. Carus mathematical monographs, 6). American J. Math. Problems of approximation with integral auxiliary conditions: 55 ('33) 153-66. — The convergence of some nonlinear processes of approximation: 515-24. — Problems of closest approximation on a twodimensional region: 60 ('38) 436-46. American math. Monthly The convergence of Fourier series: 41 ('34) 67-84. — A proof of Weierstrass's theorem: 309-12. — Mathematical principles in the theory of small samples: 42 ('35) 344-64. — A new class of orthogonal polynomials: 46 ('39) 493-97. — The instantaneous motion of a rigid body: 49

('36) 225-51. — Orthogonal polynomials with auxiliary conditions: 48 ('40) 72-81. - The boundedness of certain sets of orthonormal polynomials in one, two and three variables: 58 ('45) 167-83. - The boundedness of orthonormal polynomials on certain curves of the fourth degree: 63 ('48) 193-306. Mit: ') N. J a c o b s o n .

V VI

JACKSON, Frank Hilton. Math. — 1919-35 Rector of Chester-le-Street, Durham; '25-35 Rural Dean, Co. Durham; '30 Hon. Canon, '57 Canon Emer., Durham Cathedral. *1870, Aug. 16, Hollinwood, Oldham, Lancashire; 11960, Apr. 27, Cookridge, Leeds, Yorkshire. Nekr. T. W. C h a u n d y , J . London math. Soc. 37 ('62) 126-28 (m. Schr.verz. 49 Nrn.). W. (Mitarb.) The official guide to Chesterle-Street (Gloucester '37) 48 S. Quarterly J. Math., Oxford Ser. The qfl equations whose solutions are products of solutions of q9 equations of lower order: 11

2228

Jackson, Frank - • Jackson, John

('40) 1-17. — Certain q-identities: 12 ('41) 167-72. — Hypergeometric series and "set" numbers: 201-10. — q0 equations and Fibonacci numbers: 211-15. — On basic double hypergeometric functions, 1: 13 ('42) 69-82; ~ 2: 16 ('44) 49-61. — Basic functions and polynomial sequences: 17 ('46) 99-110.

^ JACKSON, John. Astron. - 191433 Chief Assist., Royal Observat., Greenwich ; '33-50 H. M. Astronomer, Royal Observat., Cape of Good Hope, Cape Town, South Africa; '32-38 Pres. of Commission 8 (Meridian Astron.), '38-52 Pres. of Commission 24 (Stellar Parallaxes and Proper Motions), Internation. Astron. Union; '49 Pres., Roy. Soc. of South Africa; '53-55 Pres., Roy. Astron. Soc., London. — '52 Gold Medal (Roy. Astron. Soc.); '58 Sir David Gill Medal (Astron. Soc. of South Africa). *1887, Febr. 11, Paisley, Schottland; j-1958, Dez. 9, Epsom, Surrey. Zur Biogr. H. D i n g l e , Monthly Notices roy. astron. Soc. 112 ('52) 345-57. - Circular brit. astron. Assoc. Nr. 330 ('52). — J . brit. astron. Assoc. 62 ('52) 292-94. — Monthly Notes astron. Soc. South Africa 11 ('52) 11. — Nature [London] 130 ('32) 990; 166 ('50) 889 f.; 171 ('53) 379 f. - Observatory 56 ('33) 31. Publ. astron. Soc. Pacific 64 ('52) 83. - Revista astron. Nr. 131 ('54) 96. Nekr. H. S. J o n e s , Biographical Mem. Fellows roy. Soc. 6 ('59) 95-106 (m. Bildn., Faks. u. Schr.verz.); Monthly Notices roy. astron. Soc. 119 ('59) 345-48; Nature [London] 183 ('59) 81 f. - W. M. W i t c h e l l , J . brit. astron. Assoc. 69 ('59) 178f. - Popular astron. Tidskr. 40 ('59) 80. - Sky and Telescope 18 ('59) 308. MHZ. Observatory 43 ('20) - 50 ('27). S. Vistas in astronomy (A. Beer) 2 (LondonNew York '56) (J. atmospher. and terrestr. Physics, Suppl. 4) 1018-22: The distances of the stars: a historical review. — Encyclopaedia Britannica. A new survey of universal knowledge 2 (Chicago-London-Toronto... '65) 885: Georg Friedrich Julius Arthur von Auwers (1838-1915), German astronomer; 4 ('65) 12: Pierre Bouguer (1698-1758), French scientist; 283f.: Ernest William Brown (18661938), British mathematician and astronomer; 11 ('65) 74: Peter Andreas Hansen (17951874), Danish astronomer; 75: Christopher Hansteen (1784^1873), Norwegian astronomer and physicist; 13 ('65) 71: Sir Harold Spencer Jones (1890-1960), British astronomer; 568: Nicolas Louis de Lacaille (17131762), French astronomer and geodesist; 936:

Pierre Charles Lemonnier (1715-1799), French astronomer; 17 ('65) 1002f.: Planetarium; 20 ('65) 727: Willem de Sitter (1872-1934), Dutch astronomer and cosmologist; 22 ('65) 224: Standard time 2 ); 249f.: François Félix Tisserand (1845-1896), French astronomer. W. The observations of the Reverend Thomas Hornsby made with the transit instrument and quadrant at the Radcliffe Observatory in the years 1774 to 1798 (m. H. Knox-Shaw, W. H. Robinson) (London '32) 145 S. — (Mitbearb.) Proper motions of stars in the zone catalogue of 20843 stars, 1900. Zones -40° to -52° derived from photographs taken at the Royal Observatory, Cape of Good Hope (London '36) 90+210 S. - (Mitbearb.) Catalogue of 20554 faint stars in the Cape astrographic zones -40° to - 5 2 ° for the equinox of 1900.0, giving positions, precessions, proper motions and photographic magnitudes, derived from photographs taken at the Royal Observatory, Cape of Good Hope (London '39) 57+414 S. - (Bearb.) Second Cape catalogue of stars for the equinox of 1925.0. Compiled from observations made with the reversible transit circle at the Royal Observatory, Cape of Good Hope, in the years 1925-1933, 1: Stars south of declination -30° (London '49) 23 + 168 S.; ~ 2: Zodiacal stars (•49) 66 S. — (Bearb.) Third Cape catalogue of stars for the equinox of 1925.0. Catalogue of 6597 stars, between the equator and declination-30°. Compiled ~ 1932-1936 (London '50) 18 + 132 S. - (Bearb.) First Cape catalogue of stars for the equinox 1950.0. Catalogue of 5070 fundamental and boss stars. Compiled ~ 1936-1944 (London '53) 26+102 S. Annals Cape Observat. Stellar parallaxes (1st series) determined in the years 1926-1930 with the Victoria telescope of the Royal Observatory, Cape of Good Hope (217 stars) 3 ): 14, 1 ('35) 119 S.; ~ (2nd series) ~ 1928-1931 ~ (201 stars): 14, 3 ('38) 109 S.; ~ (3'd, 4® and 5 th series) ~ 1931-1938 ~ (592 stars): 15 ('52) 7 + 3 1 5 S.; ~ (6th, 7 th and 8 th series) ~ 1937-1948 ~ (619 stars): 16 ('50) 331 S. Results of meridian observations of the Sun, Mercury and Venus made at the Royal Observatory, Cape of Good Hope, in the years 1925 to 1936:14,4 ('50) 45 + 1 0 3 S. - (Bearb.) Cape photographic catalogue for 1950.0: Zone -30° to - 3 5 ° 4 ) : 17 ('54) 40+273 S.; Zone -35° to -40° *): 18 ('54) 41+260 S.; Zone 4 -52° to -56° ): 19 ('55) 38 + 196 S.; Zone -56° to -64° 4 ): 20 ('58) 22 + 163+150 S. J . astron. Soc. South Africa The nearer stars: 4 ('35/39) 49-64. J . brit. astron. Assoc. R. G. Aitken, 18641951: 62 ('51/52) 117f. Monthly Notes astron. Soc. South Africa Minor planet No. 266 Aline: 6 ('47) 74. — The

Jackson, John - — Jackson, Leonard calendar: 78f. — The amateur astronomer: 7 ('48) 60-65. — An A type star of low luminosity: 8 ('49) 29 f. — The estimation of the time from the position of the Southern Cross: 36. — The discovery of Neptune - a defence of Challis: 88 f. — Parallaxes of Luyten proper motion stars: 9 ('50) 18 f. - L . J . Comrie, 18931950:10 ('51) 1, 4. Monthly Notices roy. astron. Soc. Report of the expedition from the Royal Observatory, Greenwich, to observe the total eclipse of the Sun on 1932 August 31 1 ): 93 ('32/33) 3-9. Hornby's observations of Mercury 1774-1798: 116-30. — The distribution of stars in the Cape astrographic zone - 4 0 ° to - 5 2 ° : 98 ('37/38) 491-517. - F. W. Dyson, 1868 J a n . 8 - 1 9 3 9 May 25:100 ('39/40) 238-46. - Orbital motion and measurements for parallax: 102 ('42) 257-60. — The proper motions of M type stars: 106 ('46) 245-54. - L. Becker, 18601947: 108 ('48) 41-43. - P. H. Cowell, 18701949: 110 ('50) 125-28. - Stellar parallaxes determined photographically at the Cape Observatory (18 th list) 6 ): 112 ('52) 94-100. - On the award of the Gold Medal to Dr. Walter Baade: 114 ('54) 370-83. - On the award of the Gold Medal to Prof. Dirk Brouwer: 115 ('55) 199-202. - O n t h e a w a r d o f t h e E d d i n g ton Medal to Professor H. C. van de Hulst: 202 f. — The need for observations in the older branches of astronomy, especially double stars: 204-15. - W. M. H. Greaves, 1897 Sept. 10 - 1955 Dec. 24: 116 ('56) 145-51. J . B. G. Turner, 1907-1957: 118 ('58) 312. Nature [London] P. H. Cowell t : 164 ('49) 133. — Spectrograph for the Radcliffe Observatory, Pretoria: 167 ('51) 169f. - E. Esclangon, 1876-1954: 173 ('54) 567. Nordisk astron. Tidsskr. Komet 1947 n : 1948, 66f. Observatory The masses of binary stars : 55 ('32).50-52. - A very red star: 60 ('37) l l l f . — The number of stars with magnitude and proper motion between specified limits: 62 ('39) 79-81. — Preparations for observing the total eclipse of the sun in South Africa on l 8 t October 1940: 63 ('40) 225-28. - The solar corona and the zodiacal light: 239-41. — The calculation of probable errors from residuals : a paradox: 65 ('43) 9f. — The selection of stars for parallax observations: 66 ('46) 318-21. — M-type stars and their parallaxes: 374-77. — Comet 1947 n : 68 ('48) 27 f. - Occulting shutters used in parallax determination: 109. — On the standard of time used in the calculation of ephemerides of the sun and moon : 72 ('52) 233-35. — The measurement of double stars: 74 ('54) 77. — The discoveries of Neptune and Pluto: 75 ('55) 126f. - Sir Harold Spencer Jones: 76 ('56) 15 f. Occasional Notes roy. astron. Soc. Two new satellites of Jupiter (J X and J X I ) : 1 ('38/41)

2229

23-25. — Observations of the total eclipse of the sun at Calvinia, Cape Province, South Africa, on 1940 October 1: 117. Trans, int. astron. Union Report of Commission 8 : Meridian astronomy : 5 ('36) 39-47 ; 6 ('39) 31-36. - Report of Commission 24: Stellar parallaxes and proper motions : 7 ('50) 260-65. Außerdem Jahresberichte aus dem Royal Observatory, Cape of Good Hope, veröffentlicht in Monthly Notices roy. astron. Soc. 1934-1948, und zahlreiche Veröffentlichungen von Beobachtungsergebnissen in Harvard Announcement Card, Observatory, Popular Astron. u. a. Mit: ') C. R. D a v i d s o n ; *) A. S. E d d i n g t o n ; ") H. Sp. J o n e s ; «) R . H. S t o y ; ') J. B. G. T u r n e r . VI

JACKSON, Leonard Cecil. Physik. — 1926-55 Res. Fellow, '55-57 Reader, Univ. of Bristol; '57-66 Prof., Roy. Military College of Canada, Kingston, Can. ; now retired in Christchurch, Hampshire. — '65 Hon. D. Sc. (Univ. of Waterloo, Waterloo, Ont., Can.). - '58 Duddell Medal (Physic. Soc., London). *1900, Aug. 8, Nottingham. MH.

Experimental cryophysics (London

'61).

Ue. Colloid science (H. R. Kruyt) 1 : Irreversible systems (Amsterdam-Houston-New York-London '52) 2 0 + 3 8 9 S. ; 2 : Reversible systems (New York-Amsterdam-London-Brussels '49) 19+753 S. [Übers, aus d. Niederländ.]. — J . A. A. K e t e l a a r , Chemical constitution; an introduction to the theory of the chemical bond (Amsterdam-Brussels '53) 398 S.; 2 (Princeton, N.J.-Toronto-Amsterdam-Brussels'59) 448 S. S. Actes du 7e Congrès international du froid, LaHaye-Amsterdam 1936, 1 (Utrecht '37) 517-21 : Studies on paramagnetism at low temperatures. — Low temperature physics and chemistry. 5 t h International conference, Madison, Wise., 1957 (Madison, Wise. '58) 5 9 61: Further observations of the helium film. — Experimental cryophysics (F. E. Hoare u. a.) (London-Toronto '61) 290-97: Magnetic measurements. — Encyclopaedic dictionary of physics (J. Thewlis) 2 (Oxford-LondonNew York '62) 200f.: Cryostat; 4 ('61) 358: Model experiments for low temperature phenomena. W . Low temperature physics (London '34) 7 + 122 S.; 2 (London '48, New York '50); '(London '51); 4 (London '55, NewYork '56); 6 ( London-New York '62) 8 + 158 S. (Methuen's monographs on physical subjects). — Wave filters (London '44) 7 + 107 S.; 2 ('46); 3 (London-NewYork '50) 7 + 107 S. ( ~ ) .

2230

Jackson, Leonard — Jackson, Richard

Advances Physics Properties of the saturated helium film 4 ): 7 ('58) 435-78. Canadian J. Physics The thickness of moving helium I I film 3 ): 41 ('63) 1047-55. Indian J. Physics and Proc. indian Assoc. Cnltivat. Sci. Molecular orbital theory of trigonally distorted [Co-6H 2 0 2+ ] complex 9 ): 38 ('64) 49 f. — Ligand field theory of magnetic susceptibility and anisotropy in CoSiF 6 • 6 H 2 0 !)»): 39 ('65) 7-16. J. sci. Instruments Small helium liquefier and portable cryostat 8 ): 27 ('50) 17-19. A small gas-cooled cryostat for temperatures between 4 °K and 14 ° K 8 ) : 2 8 ('51) 99-101. Nature [London] Thickness of the helium I I film 2 ): 164 ('49) 660f.

Mit: ') A. Boee; 2) E. J. Burgc; ") P. W. F. Gribbon; *) L. G. Grimes; ') A. C. H a m ; •) D. G. H e n sliaw; ') R. B. N e w m a n ; ' ) H. P r e s t o n - T h o m a s ; ') R. Rai. VI

JACKSON, Richard Fay. Chem. (org.). — 1907-08 Labor. Assistant, '0817 Assist. Chemist, '17-28 Assoc. Chemist, '28-43 Senior Chemist, Nation. Bureau of Standards, Washington, D. C.; '23- Assoc. Referee, later on General Referee on Sugars and Sugar Products, Assoc. of Official Agricultural Chemists. — '25 Hillebrand Prize (Amer. Chem. Soc., Washington Sect.). *1881, Jan. 2, Boston, Mass.; Transfer rates for fl943, Juni 1, Chevy Chase, Md. 2

Philosophical Mag. surface films of helium I I ): (7) 41 ('50) 20507. — Velocity of flow of helium I I in the creeping film 6 ): 1081-84. — Superconductivity of niobium 8 ): 1284-87. — Further observations on the helium I I film by an optical method") : 44 ('53) 14-18. — Visual observations of the formation of bulk liquid from the helium I I film 5 ): 214-16. - A method for the determination of the rate of extension of the helium I I film 5 ): 1403-06. — The thickness of the saturated helium film above and below the A-point6): 45 ('54) 1084-87. — The magnetic susceptibility of ferrous fluosilicate at low temperatures: (8) 4 ('59) 269-72. - The helium film formed from the vapor phase 4 ): 756-62. — The thickness of the saturated helium film above and below the A-point 4 ): 1346-55. Physica The thickness of the moving helium I I film 4 ): 24 ('58) Suppl., 144. Proc. physic. Soc. The magnetic moment of the manganic ion: 47 (*35) 1029-31. Paramagnetism of the rare-earth sulphates a t low temperatures: 48 ('36) 741-46. — Principal paramagnetic susceptibilities of potassium ferricyanide a t low temperatures: 60 ('38) 707-10. Proc. roy. Soc., London, Ser. A The principal magnetic susceptibilities of some paramagnetic crystals at low temperatures: 140 ('33) 695-713. — The principal magnetic susceptibilities of neodymium sulphate octahydrate a t low temperatures: 170 ('39) 26671. — The thickness of the helium film 2 ): 206 ('51) 270-85. — The thickness of the saturated helium film above and below the A-point 6 ): 240 ('57) 243-64. Rep. Progr. Physics Superconductivity: 6 ('40) 335-44. Trans. Faraday Soc. The P, T, x relationships of H 2 + H D and H 2 + D 2 mixtures between 18 and 28 °K ' ) : 64 ('58) 1481-91. Yearb. physic. Soc., London Measurements of the thickness of the helium film: 1958, 4346.

Nekr. C. A. B r o w n e , J . Assoc. offic. agric. Chemists 26 ('43) Nr. 4, I I - V (m. Bildn.). C. F. S n y d e r , J . Washington Acad. Sci. 33 ('43) 287 f. Bur. Standards J. Res. Some physical properties of levulose and its estimation by copper reduction methods 4 ): 8 ('32) 403-44. - Analytical methods for the determination of levulose [fructose] in crude products 4 ) 2 ): 9 ('32) 597-613. — The stability of levulose in aqueous solutions of varying p H 4 ) : 11 ('33) 619-33. J. Res. nation. Bur. Standards Yield and purity of levulose derived from the calcium levulate process 4 ): 15 ('35) 341-56. — Dimensions of Jerusalem-artichoke cossettes 6 ) 1 ): 17 ('36) 615-24. — Extraction of Jerusalem-artichoke juices in an experimental diffusion battery 1 ) 5 ): 19 ('37) 263-85. - Structure of difructose anhydride I I I (difructofuranose l,2',2,3'-anhydride) 3 ): 24 ('40) 181-204. Errors of Munson and Walker's reducingsugar tables and the precision of their method 3 ): 27 ('41) 237-55. - Copper reduction of dextrose, levulose, invert sugar, and sucrose - invert sugar mixtures, in citrate-carbonate solution 3 ): 34 ('45) 213-26. - Reaction of periodic acid on the difructose anhydrides 3 ): 35 ('45) 497-500. International Sugar J. Ofner's method for determination of invert sugar in refined sugars 3 ): 46 ('44) 41-43. J. Assoc. offic. agric. Chemists Report on chemical methods for (the determination of) reducing sugars. Biourge and Nyn's selective determination of levulose 4 ): 15 ('32) 198-212. — A critical study of the Munson-Walker method for reducing sugars: 17 ('34) 293301. — Report on chemical methods for (determining) reducing sugars: 18 ('35) [19 ('36) ?] 172-78; 21 ('38) 423-25. - Report on (the analysis of) sugars and sugar products: 22 ('39) 578-80; 23 ('40) 558-60; 25 ('42) 674f. - The basic values of the Clerget divisor and the correction coefficients 3 ): 22

Jackson, Richard - - Jacobs ('39) 580-86. — Errors of Munson and Walker's reducing-sugar tables and the precision of their method 3 ): 24 ('41) 767-88. — Normal weight of invert sugar and a test of Vosburgh's rule 3 ): 26 ('42) 675-80. - Contamination of cuprous oxide in reducing-sugar analysis 3 ): 988. — Ofner's method for determination of invert sugar in refined sugars 3 ): 26 ('43) 46272. — Copper reduction of dextrose, levulose, invert sugar, and sucrose - invert sugar mixtures, in citrate-carbonate solution 3 ): 28 ('45) 371-85. Mit: >) J. A. B o g a n ; 2) W. D. 5C h a s e ; *) E. J. M c D o n a l d ; •) J. A. M a t h e w s ; ) M. J. P r o l f i t t . VI

JACOBS, W a l t e r Abraham. Chem. (org.). — 1907-08 Fellow, '08-10 Assist., '10-12 Assoc., '12-23 Assoc. Member, '2349 Member, '49 Member Emer. (active until '57), Rockefeller Inst, for Medical Res., New York. — '53 Order of King Leopold of Belgium. *1883, Dez. 24, New York; 1-1967, Juli 12, Los Angeles, Calif. Bildnis Scientific Monthly 35 ('32) 91. S. Bicentennial conference, Pennsylvania University 1941. Chemical kinetics and natural products (Philadelphia, P a . '41) 27-41: Chemistry of the ergot alkaloids. Annual Rev. Biochem. The terpenes, saponins and closely related compounds 3 ): 7 ('38) 448-72. Chemistry and Industry The aconite alkaloids, 28: The nature of a-oxodelphinine and /?-oxodelphinine 13 ): 1955, 948 f.; 29:] The quaternary chlorides and acetates of atisine 13 ): 13 1385-87. - The nature of oxonitine ): I960, 591 f. J . amer. chem. Soc. The dehydrogenation of gitogenin 18 ): 56 ('34) 1424f. - The structure of the ergot alkaloids 2 ): 57 ('35) 383f. — The hydrolysis of ergotinine and ergoclavine 2 ): 960f. - [The aconite alkaloids, 1:] The Nalkyl group of aconine (aconitine) 3 ): 58 ('36) 1059; ~ 25: The oxygen-containing groups of delphinine 13 ): 76 ('54) 161-69; ~ 26: Oxonitine and oxoaconitine 13 ): 4048 f.; ~ 27: The structure of atisine 13 ): 4496 f.; ~ 30: Products from the mild permanganate oxidation of atisine 1 3 ): 78 ('56) 4139-43; ~ 31: A partial synthesis of atisine, isoatisine and dihydroatisine 13 ): 4144f.; ~ 32: The structure of delphinine 13 ): 3542f. - [The ergot alkaloids, 15:] Position of the carboxyl group in lysergic acid 2 ): 60 ('38) 1701 f. - The veratrine alkaloids, 6: The oxidation of cevine 2 ): 61 ('39) 2252f.; ~ 34: The transformation of isorubijervine to solanidine 13 ): 74 ('52) 4218f.; ~ 35: Veracevine, the alkanolamine of cevadine and veratridine 1 3 ): 75 ('53) 3248-52; ~ 37:

2231

Structure of isorubijervine; conversion to solanidine 13 ): 4442-46; ~ 38: The ring system of the tertiary polyhydroxy veratrine bases; oxidative studies with cevanthridine and veranthridine 1 3 ): 76 ('54) 2028f.; ~ 39: A study of certain selenium dehydrogenation products of cevine 13 ): 78 ('56) 1914-18. - The synthesis of certain substituted quinolines and 5,6-benzoquinolines 5 ): 61 ('39) 2890-95. J . biol. Chemistry The partial dehydrogenation of oleanolic acid 4 ): 96 ('32) 341-54. The sugar of sarmentocymarin 1 ): 355. — Strophanthin, 25: The allocation of the lactone group of strophanthidin and related aglucones 3 ): 357-66; ~ 26: A further study of the dehydrogenation of strophanthidin 4 ): 97 ('32) 57-61; ~ 27: Ring I I I of strophanthidin and related aglucones 3 ): 727-37; ~ 28: Further degradation of strophanthidin and periplogenin derivatives 3 ): 102 ('33) 237-48; ~ 31: Further studies on the dehydrogenation of strophanthidin 3 ): 107 ('34) 143-54; ~ 32: The anhydrostrophanthidin 3 ): 108 ('35) 693702; ~ 33: The oxidation of anhydroaglucone derivatives 3 ): 118 ('36) 611-24; ~ 34: Cyanhydrin syntheses with dihydrostrophanthidin and derivatives 3 ): 625-30; ~ 35: The nature of "the acid C 23 H 30 O 8 " from strophanthidin 3 ): 631-35. —Ouabain or g-strophanthin [, l] 1 ): 96 ('32) 647-58; ~ 2: The degradation of isoouabain 1 ): 101 ('33) 15-20. - The ergot alkaloids, 1: The oxidation of ergotinine: 97 ('32) 739-43; ~ 2: The degradation of ergotinine with alkali; lysergic acid 2 ): 104 ('34) 547-51; ~ 3: On lysergic acid 2 ): 106 ('34) 393-99; ~ 4: (a) The cleavage of ergotinine with sodium and butyl alcohol; (b) Structure of the ergot alkaloids 2 ): 108 ('35) 595-606; ~ 5: The hydrolysis of ergotinine 2 ): 110 ('35) 521-30; ~ 6: Lysergic acid 2 ): 111 ('35) 455-65; ~ 8: The synthesis of 4-carboline carbonic acids 2 ): 113 ('36) 759-65; ~ 9: The structure of lysergic acid 2 ): 767-78; ~ 11: Isomeric dihydrolysergic acids and the structure of lysergic acid 2 ): 115 ('36) 227-38; ~ 12: The synthesis of substances related to lysergic acid 6 ): 120 ('37) 141-50; ~ 13: The precursors of pyruvic and isobutyrylformic acids 2 ): 122 ('38) 419-23; ~ 14: The positions of the double bond and the carboxyl group in lysergic acid and its isomer; the structure of the alkaloids 2 ) 1 ') 5 ): 125 ('38) 289-98; ~ 16: Further studies of the synthesis of substances related to lysergic acid 5 ): 126 ('38) 67-76; ~ 17: The dimethylindole from dihydrolysergic acid 2 ): 128 ('39) 715-19; ~ 18: The production of a base from lysergic acid and its comparison with synthetic 6,8-dimethyl-ergoIine 5 ): 130 ('39) 399-405; ~ 19: Transformation of DLlysergic acid and D-lysergic acid to 6,8-dimethylergolines 5 ) 2 ): 145 ('42) 487-94. - The strophanthins of Strophanthus eminii 1 ): 99 ('33) 521-29. - The digitalis glucosides, 6: The

2232

Jacobs

oxidation of anhydrodihydrodigitoxigenin; t h e problem of gitoxigenin 3 ) : 693-99 ; ~ 7 : The isomeric dihydrogitoxigenins 3 ) : 100 ('33) 671-83. — Trianhydroperiplogenin 1 ) : 101 ('33) 697-700. — On sarsasapogenin and gitogenin [, l] 1 8 ): 105 ('34) 501-10; Sarsasapogenin, 2 18 ): 109 ('35) 573-84; ~ 3: Desoxysarsasapogenin ; further degradations of sarsasapogenin 18 ) : 110 ('35) 565-73. - The structure of the cardiac aglucones 3 ) : 108 ('35) 497513. - The digitalis sapogenins 18 ) : 110 ('35) 429-38. — The lactone group of cardiac aglycones and Grignard reagent 3 ): 114 ('36) 597-99. - The veratrine alkaloids, 1: The degradation of cevine 2 ) : 119 ('37) 141-53 ; ~ 2: Further study of the basic degradation products of cevine 2 ): 120 ('37) 447-56; ~ 3: Further studies on the degradation of cevine; t h e question of coniine 2 ): 124 ('38) 659-66; ~ 4: The degradation of cevine methiodide 2 ) : 125 ('38) 625-34; ~ 5: The selenium dehydrogenation of cevine 2 ): 129 ('39) 79-87; ~ 7: Decevinic acid 2 ): 134 ('40) 123-35; ~ 8: F u r t h e r studies on the selenium dehydrogenation of cevine 2 ): 139 ('41) 263-75; ~ 9: The nature of the hydrocarbons from t h e dehydrogenation of cevine 2 ) 11 ): 277-91; ~ 10: The structure of cevanthridine 2 ) : 293-99; ~ 11: The dehydrogenation of jervine 2 ) 11 ) : 141 ('41) 51-66; ~ 12: Further studies on the oxidation of cevine 2 ): 253-67; ~ 13: Dehydrogenation of protoveratrine 2 ): 143 ('42) 427-32; ~ 15: Rubijervine and isorubijervine 2 ): 148 ('43) 41-50; ~ 16: Formulation of jervine 2 ): 51-55; ~ 17: Germine; its formulation and degradation 2 ): 57-66; ~ 19: Protoveratrine and its alkanine, protoverine 2 ) : 149 ('43) 27179; ~ 20: Further correlations in t h e veratrine group; the relationship between the veratrine bases and solanidine 2 ) : 451-64; ~ 21 : Conversion of rubijervine t o allorubijervine; t h e sterol ring systems of rubijervine 2 ): 152 ('44) 641-43; ~ 22: On pseudojervine and veratrosine, a companion glycoside in Veratrum viride 2 ): 155 ('44) 565-72; ~ 23: King system of rubijervine and isorubijervine 2 ): 159 ('45) 617-24; ~ 24: Octahydroindolizine [octahydropyrrocoline] ring system of the tert. bases ; conversion of sarsasapogenin into a solanidine derivative 2 0 ): 160 ('45) 24348; ~ 25: Alkaloids of Veratrum viride 2 ): 55565; ~ 26: On the hexanetetracarboxylic acid from cevine and germine 8 ): 170 ('47) 181-87; ~ 27: Further studies with jervine 8 ): 635-52; ~ 28: Structure of jervine 16 ) : 175 ('48) 57-65; ~ 29: Structure of rubijervine 1 6 ): 179 ('49) 623-32; ~ 30: A further study of the struct u r e of veratramine and jervine 18 ) : 181 ('49) 55-65 ; ~ 31 : The structure of isorubijervine 16 ) : 191 ('51) 63-69; ~ 32: The structure of veratramine 1 6 ): 71-86; ~ 33: The isomeric forms of cevine, germine and protoverine 10 ) : 193 ('51) 325-37. — The sapogenins of Polygala senega 9 ): 119 ('37) 155-70. - Delphinine [,!]*):

127 ('39) 361-66; ~ 2: On oxodelphinine 2 ): 128 ('39) 431-37; ~ 3: The action of hydrochloric, nitric, and nitrous acids on delphinine and its derivatives 2 ): 136 ('40) 303-21. - The aconite alkaloids, 2: The formula of oxonitine 3 ) 2 ): 128 ('39) 439-46; ~ 3: The oxidation of aconitine and derivatives with nitric acid and chromic acid 2 ): 136 ('40) 323-34; ~ 7: On staphisine, a new alkaloid f r o m Delphinium staphisagria 2 ): 141 ('41) 67-84; ~ 8: Atisine 2 ): 148 ('42) 589-603; ~ 9: Isolation of two new alkaloids from Aconitum heterophyllum, heteratisine and hetisine 2 ): 605-09; ~ 10: Napelline 2 ): 611-16; ~ 11: Action of methyl-alcoholic sodium hydroxide on atisine, isoatisine and dihydroatisine 2 ): 147 ('43) 567-69; ~ 12: Benzoylheteratisine, a new alkaloid from Aconitum heterophyllum 2 ): 571 f.; ~ 13: Isolation of pimanthrene from dehydrogenation products of staphisine 2 ): 152 ('44) 645-50; ~ 14: Oxidation of the hydrocarbon from dehydrogenation of atisine 2 ): 651-57; ~ 15: Nature of the ring system and character of t h e nitrogen atom 2 ) 12 ) 6 ): 154 ('44) 293-304; ~ 16: On staphisine and the hydrocarbon obtained from its dehydrogenation 8 ): 169 ('47) 211-20; ~ 17: Further studies with hetisine 8 ): 170 ('47) 189-201; ~ 18: The synthesis of t h e hydrocarbon obtained on dehydrogenation of atisine 8 ): 203-07; ~ 19: Further studies with delphinine derivatives 8 ): 209-20; ~ 20: Further studies with atisine and isoatisine 8 ): 515-25; ~ 21: Further oxidation studies with atisine and isoatisine 8 ): 174 ('48) 1001-12; ~ 22: The demethylation of delphinine derivatives 1 6 ): 180 ('49) 133-44; ~ 23: Oxidation of isopyro-oxodelphonine, dihydroisopyro-oxodelphonine, and their demethylanhydro derivatives 1 6 ): 479-94. — T h e preparation of certain trimethyleneindole derivatives 5 ): 130 ('39) 407-14. - Phoebus Aaron Theodor Levene 19 ): 141 ('41) I f . J. org. Chemistry Ergot alkaloids, 10: On ergotamine and ergoclavine 2 ): 1 ('36) 245-53; ~ 20: Synthesis of dihydro-DL-lysergic acid; new synthesis of 3-substituted quinolines 20 ): 10 ('45) 76-86. - The aconite alkaloids, 24: The degradation of atisine and isoatisine: 16 ('51) 1593-602; ~ 33: Identity of y-oxodelphinine 13 ) 14 ): 21 ('56) 1514f.; ~ 35: Structural studies with delphinine derivatives 1 3 ): 22 ('57) 1428-32. — Veratrine alkaloids, 36: A possible skeletal structure for veracevine, cevine, germine and protoverine 1 3 ): 18 ('53) 765-73. Physiological Rev. The chemistry of t h e cardiac glucosides: 13 ('33) 222-45. Science [USA] Strophanthin, 29: The dehydrogenation of strophanthidin 3 ): 79 ('34) 279f. — The digitalis glucosides, 8: The degradation of t h e lactone side chain of digitoxigenin 3 ): 80 ('34) 434. - The structure of t h e cardiac aglucones 3 ): 533f. — The ergot alkaloids 2 ): 81 ('35) 256f. - On an alkaloid from

Jacobs — Jacobsen, Jacob Peter ergot 2 ): 82 ('35) 16f. - The ergot alkaloids: Synthesis of 4-carboline carbonic acids 2 ) : 421 f. — The ergot alkaloids : The structure of lysergic acid 2 ): 88 ('36) 38f. - The ergot alkaloids [, 7] : The ultraviolet absorption spectra of lysergic acid and related substances 2 ) 16 ): 166f. — The synthesis of substances related to lysergic acid 5 ): 85 ('37) 248f. - Veratrine alkaloids, 14: Correlation of the veratrine alkaloids with the Solanum alkaloids 2 ): 97 ('43) 122. Mit: ») N. M.4 B i g e l o w ; ') L . C . C r a i g ; >) R. C. E l d e r f i e l d ; ) E . E . F l e c k ; «) E . G . G o u l d , jr.; •) S. Granick; ') - ; ") C. F. H u e b n e r ; •) O. I s l e r ; 10 ) H. J a f f e ; ") G. I. L a v i n ; 1! ) L. M i c h a e l i s ; ») Sw . W . P e l l e t i e r ; ") P. R a t h g e b ; ") A . R o t h e n ; ) Y. S a t o ; ") T. S h e d l o v s k y ; ") J. C. E. S i m p eon; ») D. van S l y k e ; ") F. C. Uhle. yi

JACOBSEN, J a c o b Christian Georg. Physik. — 1925-65 Wiss. Mitarbeiter, Inst. f. theoret. Physik, '41-56 Prof., '41-65 Leiter d. physikal. Labor., Univ. Kobenhavn; '56-58 Forschungs-Dir., '5865 Konsulent, Versuchsanlage der Atomenergiekommission, Ris0; '58- wiss. Konsulent, Kebenhavn. *1895, Jan. 13, Simested; tl965, Mai 6, Kobenhavn. Nekr. N. O. L a s s e n , Festskr. Kobenhavns Univ. 1965, Nov.-H., 148-56 (m. Bildn., Faks.); Fysisk Tidsskr. 63 ('65) 145-64 (m. Bildn., Schr.verz. 45 Nrn.); Nuclear Physics 85 ('66) 1-14 (m. Bildn., Schr.verz. 46 Nrn.); Oversigt Selsk. Virksomhed, Kgl. danske Vid. Selsk. 1965/66 ('66) 81-94 (m. Bildn., Faks.). 8. Lectures on the theory and design of an alternating-gradient proton synchrotron presented a t t h e Conference on the alternatinggradient proton synchrotron, Geneva 1953 (Genf '53) 159-: Magnet studies. Acta radiol. [Stockholm] Measurement of the radiation t o which roentgen- and radiumworkers are exposed 1 ): 17 ('36) 252-55 [m. deutscher u. französ. Zusammenfassg.]. Fysisk Tidsskr. Om opdagelsen af de positive elektroner: 32 ('34) 17-30. — Absorption af röntgen- og y-strâler: 33 ('35) 156-66. Om cyklotronen : 39 ('41) 33-50. - P. M. S. Blackett, Nobelpristager i fysik fra 1948: 47 ('50) 166-76. Ingenieren Cyklotronen og hojspsendingsanlaeggene pâ Universitetets Institut for teoretisk Fysik 3 ) 2 ): 50 ('41) Nr. 37, E49-E54. Nogle indtryk fra Kongressen i Genève 8 ): 64 ('55) 807-09. Matematisk-fys. Medd., Kgl. danske Vid. Selsk. Construction of a cyclotron: 19 ('41) Nr. 2, 30 S. — Deuteron induced fission of uranium and thorium 5 ): Nr. 6, 22 S. — The decay constant of RaC' 7 ): 20 ('43)

2233

Nr. 11, 10 S. — A high voltage x-ray installation: 22 ('45) Nr. 11, 13 S. - On the recoil of the nucleus in beta-decay 4 ): 23 ('45) Nr. 12, 32 S.; 2 ('52). Militsert Tidsskr. Anvendelse af radioaktive stoffer i krigsväben: 79 ('50) 185-91. Nature [London] Efficiency of Geiger counter and absorption of cosmic rays: 130 ('32) 581. — Decay constant of radium C : 133 ('34) 565 f. — Correlation between scattering and recoil in the Compton effect: 138 ('36) 25. — Positrons from radio-scandium: 139 ('37) 879 f. — Fission cross-section in uranium and thorium for deuteron impact 5 ): 148 ('41) 230. Naturwissenschaften Die a-Ionisation in Druckkammern 6 ): 21 ('33) 350. Oversigt Selsk. Virksomhed, S g l . danske Yid. Selsk. Martin Knudsen 1949/1950 ('50) 55-61. Physical Rev. Deuteron induced fission in uranium and thorium 6 ): (2) 58 ('40) 867f. — Fission cross-section in uranium and thorium for deuteron impact 6 ): 59 ('41) 1043. — On the recoil of the nucleus in beta-decay of M K r 4 ): 73 ('48) 675-79. Z. Physik Eine Vorrichtung zur Messung schwacher Ionisierungsströme: 91 ('34) 167f. — Absorption von harten y-Strahlen in leichten Elementen: 103 ('36) 747-55. Außerdem: Beretning fra Radiumstationens fysiske laboratorium 1930-1956 in: Arsberetning fra Landsforeningen til K r seitens Beksempelse. Mit: 1) J. A m b r o s e n ; •) K. J. B r o s t r e m ; ') J. K o c h ; ') O. K o f o e d - H a n s e n ; *) N. O. L a s s e n ; •) C. B. Madsen; ') Th. S i g u r g e i r s s o n ; ") H. Topsoe. VI

JACOBSEN, Jacob Peter. Physik (Hydrogr.). — 1919-42 Doz. Physik, Farmac. Lsereanstalt, Kobenhavn; '28- Hydrograph, Internationales Bureau für Meeresuntersuchungen. *1877, Febr. 23, Skjenkelso; •¡1946, Juni 19, Charlottenlund. Nekr. M. K n u d s e n , Fysisk Tidsskr. 44 ('46) 65f. - H. T h o m s e n , ibid. 66-72 (m. Schr.verz.). S. James Johnstone memorial volume (R. J . Daniel) (Liverpool '34) 275-93: Periodical variations in temperature and salinity in the Straits of Gibraltar 4 ). — Ringkobing Fjords naturhistorie i brakvandsperioden 1915-1931 (Kobenhavn '34) 17 S.: Vandets saltholdighed og temperatur i Ringkobing Fjord i aarene 1919-1929. — Verhandlungen der 7. Tagung der Baltischen Geodätischen Kommission, Leningrad-Moskva 1934, 2: Vorträge (Helsinki '35) 151-69: Unterliegt die

2234

Jacobsen, Jacob Peter - • Jacobsohn

Höhendifferenz zweier fester Punkte bei Hornbsek und Gjedser einer jährlichen Variation ? — Berichte und Mitteilungen. 5. Hydrologische Konferenz der baltischen Staaten, Finnland 1936 (Helsinki '36) Mitt. 9 b, 1 - 5 : Die Wasserbewegung in den Verbindungsstraßen zwischen der Ostsee und dem Kattegat. — Geofysiken i Danmark. Meteorologe Hydrografi, Jordmagnetisme, Seismologi (Kebenhavn '45) 31-41: Hydrografi. W. Temperature and salinity at the surface of the North Sea and the English Channel. Descriptions of the methods used in preparing the Atlas published in 1933 by the Service Hydrographique of the Bureau of the International Council for the Exploration of the Sea (Kobenhavn '34) 20 S. (Conseil permanent international pour l'exploration de la mer). — Urnormal 1937, or primary standard seawater 1937. Report (m. M. H. C. Knudsen) (Liverpool '40) 38 S. (Association d'océanographie physique. Publication scientifique 7). Dansk Tidsskr. Farm. Middelafvigelsen for funktioner af korrelerede og for funktioner af ukorrelerede iagttagelser: 9 ('35) 53-67. Farmaceuten De internationale havundersegelser og de nordiske landes deltagelse i disse: 4 ('41) Nr. 6, 112-15. Mcddelelser Kommissionen Danmarks Fiskeri- og Havundersegelser, Ser. Hydrogr. Temperaturmessung mit elektrischem Widerstandsthermometer auf der Kattegatexpedition im August 1931: 3, Nr. 1 ('35) 22 S. Procès-verbaux, Assoc. Océanogr. physique On the nomenclature and units for indication of the amount of constituents of sea-water: 2 ('37) 63-67. Rapports et Procès-verbaux Réun., Cons. perm. int.Explorat.Mer Nomenclature and units for the indication of the content of constituents of sea-water 1 ) 2 ) 3 ): 107 ('38) Nr. 3, 3-9. The Atlantic current through the FaroeShetland Channel and its influence on the hydrographical conditions in the northern part of the North Sea, the Norwegian Sea and the Barents Sea: 112 ('43) 5-47.

(Madrid '36) 91-103: Kinetische Studien über das System der Fumarase [ ] 6 ). W. Système fermentaire actif sur l'aneurine et acétylcholine (Lisboa '62) (Separata Estudós científicos da Iunta de Investigaçoes do Ultramare, 447).

Actas, Relatorios, Commun., Reuniäo Mol. portug. Blut-Cholinesterase in schwangeren Frauen 6 ): 1 ('46) 25f. - [Serum-]Cholinesterase und Insulin 1 ): 67f. — Stabile und radioaktive Isotope in der Biochemie: 2 ('47) 13-40. — Enzymatischer Abbau des Aneurins i): 105-08. []. Actualidades Mol. O sangue como carácter individual: 5 ('32). — Fermentaçâo alcoólica: 36 ('63) 5-32. Anais azevedos Biochemical aspects of the life force: 9 ('57) 223-42 [ ]. Archives Biochem. On the enzymatic destruction of thiamine 1 ) : 14 ('47) 83-86. Archives Biochem. and Biophysics Enzymic adaptation by asymmetric induction 1 ): 69 ('57) 286-89. Archives portug. Sei. Mol. Sur l'action de la Phosphatase: B ('32/34). — Anomalien in der Wirkungsweise der Fumarase: 4 ('35/38) 1642 [französ.]. — Einfluß von Deuteriumoxid auf die Wirkungsweise einiger Enzyme 13 ) 12 ): 111-25 — Hydrasen und ihre physiologische Wirkung 13 ) 12 ) : 6 ('41/43) 13-46 Untersuchung pflanzlicher Cholinesterase: 7 ('44/45) Suppl. 1, 4-6 [ ~ ] . - Sexualhormone und Serum-Cholinesterase 8 ): 22-24 [ ~ ] . — Einfluß des Substrats auf die Aktivität von Fumarase 6 ): 33-36 — Blut-Aconitasen: Suppl. 2, 49-51 — Einfluß des Substrats auf die lipolytische Aktivität des Blutes 4 ): 55-58 — Einfluß von Ascorbinsäure auf Pflanzen-Urease 4 ) : 59-61 [ ~ ] . - Einfluß des Substrats in vivo auf Blut-Glycerophosphatase 6 ) : 62-64 - Einfluß einiger RedoxVitamine auf Urease 4 ): 73-75 — Bildung von Äpfelsäure durch Crassulaceae : 76-78 [ ~ ] . — Sur un système fermentaire attaquant l'acide folique 1 ): 10 ('49) 8f. - Action de la 4 Mit: *) K. B u c h ; ') B. S c h u l z ; •) H. W a t t e n b e r g ; streptomycine sur plusieurs enzymes ): 29-31. L'influence de l'acide folique et des vita— •) H. T h o m s e n . mines B x et B 2 sur l'activité de plusieurs 4 enzymes ): 32f. — Sur une thiaminase végé71 JACOBSOHN, K u r t Paul. Chem. tale: 52-54. — — Einige weitere Arbeiten in (org.), Biochem. — 1929-69 Vorstand d. dieser Zeitschrift.

Biochem. Abteilung, Inst, de Invest, cient. Bento da Rocha Cabrai, Lisboa; '55-69 ord. Prof., '60-69 Dir. d. Chem. Labor., Univ. de Lisboa; '60-68 Präs., '69 Generalsekretär, Chem. Ges. v. Portugal. *1904, Okt. 31, Berlin.

Arzneimittel-Forsch. Über enzymatische Umsetzungen von ungesättigten Fettsäuren 1 ) : 10 ('60) 461-63. Ber. dtsch. chem. Ges. Die Spezifität der Fumarase und enzymatische Gleichgewichte 5 ): 67 ('34) 1481-85. Biochemische Z. Zur Kinetik der Fumarase 13 8 ) ): 249 ('32) 72-74; 254 ('32) 112-37. S. Trabajos I X Congreso internacional de Über die enzymatische Aktivität von Fumaquímica pura y aplicada, Madrid 1934, 5 rasepräparaten 5 ): 261 ('33) 267-74. - Über

Jacobsohn das Gleichgewicht im System der Fumarase ): 269 ('34) 225-30. - Zur Thermodynamik des Systems der Fumarase: 274 ('34) 167-80, 464. — Zur Thermodynamik enzymatischer Gleichgewichte. Untersuchungen im System der Aspartase 1 3 ): 282 ('35) 374-82. - Stereochemische Spezifität und Gleichgewicht im System der Fumarase. Über die biochemische Darstellung der D-Äpfelsäure 12 ): 383-86. 1S

Bull. Soc. Chim. Mol. L'action de la température dans le système de la fumarase. Sur la thermostabilité de la fumarase 8 ): 16 ('34) 550-61. — Sur l'équilibre enzymatique 1 3 ): 1637-44. — L'action de l'eau lourde sur les systèmes de la fumarase et de la phosphatase ' ) : 18 ('36) 926-31. — Problèmes stéréochimiques de l'équilibre enzymatique. Recherches dans le système de la fumarase 1 3 ) : 1674-80. — L'équilibre enzymatique en présence de l'eau lourde. Recherches avec des fumarases 7 ) 13 ) : 19 ('37) 1194-99. - Sur l'activité fermentaire d'organes à la suite de leur altération pathologique 5 ): 20 ('38) 1206-10. — Recherches sur les aconitases 12 ) 13 ): 22 ('40) 48-59. - Sur le mécanisme de l'inactivation fermentaire sous l'action des neutrons 1 1 ): 33 ('51) 673-80. Etudes sur la succino-déhydrase de E . coli induite par biosynthèse 1 ): 37 ('55) 139-45. Action de l'aneurine et de composés analogues sur l'hydrolyse de l'acétylcholine 1 ) : 48 ('66) 323-32. — Influence de la thiamine in vivo sur l'activité thiaminasique d'organes de cobaye 1 ) 14 ): 50 ('68) 1791-96. Bull. Soc. portug. Sei. natur. Einfluß von Deuteriumoxid auf die enzymatische Wirkung der Aconitasen 7 ) 13 ): 13 ('38/41) 37-41. - Die Beeinflussung enzymatischer Prozesse durch Deuterium 7 ) 1 3 ): 71-73. - Die Struktur des enzymatischen Systems der Aconitasen: 7 5 77. — Enzyme, die an Doppelbindungen angreifen: 79-83. — Vergiftung von Aconitasen la ) : 91-93. — Gleichgewicht in enzymatischen Systemen von Aconitasen: 96-98. — Insulin und Zitronensäuregärung 5 ) : 111-14. — Gleichgewichte von Aconitase-Systemen: 115-17. — Hydratasen und Vitamine 5 ): 131-33. — -

[ ] •

Chimie et Industrie, Congr. Chim. industr. Untersuchungen über den Gärungsmechanismus in Anwesenheit von schwerem Wasser 7 ) : 17 ('37) I, 487-93 [französ.]; 18 ('38) I I , 73640 [französ.]. Ciëncia [Lisboa] Acêrca de compostos bioquímicos, acumuladores da energía vital: 1956, Nr. 14, 20-27. C.B. (hebd.) Séances (et Mém.) Soc. Biol. Quelques observations sur les propriétés spécifiques de la fumarase 8 ) 13 ) : 109 ('32) 50406. — Sur la diffusion de la fumarase dans la nature 5 ): 506-08. — Sur la diffusion de la fumarase dans les tissus végétaux 5 ) : 110 ('32) 1063f. — Sur la spécificité stéréochimique de

2235

la fumarase: 113 ('33) 501-04. — Action des alcaloïdes sur la fumarase. Influence de la morphine 8 ): 505-07. — Action des alcaloïdes du groupe de la quinoléine sur la fumarase 1 3 ) : 507 f. — Action de l'anilarsinate de soude sur la fumarase 8 ) : 747-49. — L'influence de l'ion "argent" sur l'hydratation enzymatique d u fumarate 13 ) 8 ) : 749-51. — L'action de plusieurs métaux lourds sur la fumarase 8 ): 752-54. — L'influence des sels sur le système de la fumarase 8 ): 114 ('33) 858-60. - Y a-t-il u n système co-enzymatique de la fumarase? 8 ): 116 ('34) 169-71. — Sur le coefficient de la température du système de la fumarase 5 ) : 117 ('34) 726-28. — Sur l'action biologique de l'acide mono-iodo-acétique et du fluorure. Recherches enzymatiques sur le système de la fumarase 1 3 ): 118 ('35) 1110-13. - Sur la synthèse de l'acide aspartique dans le foie à partir de l'acide fumarique 13 ) 8 ) : 120 ('35) 33-36. — Sur l'intoxication de la fumarase 1 3 ) : 36-38. — L'action du magnésium sur le système de l'aspartase 8 ) : 551-54. — Sur la diffusion de l'aspartase 1 2 ): 121 ('36) 251-55. — Recherches sur les enzymes placentaires: la fumarase 8 ): 128 ('36) 609-11. - Sur la spécificité stéréochimique de l'aspartase 8 ) : 611-13. — Sur l'existence hypothétique d'enzymes analogues à l'aspartase 12 ) : 124 ('37) 1026-28. — Sur la nomenclature des enzymes fermentant l'acide fumarique: 1028-30. — Sur l'existence problématique du groupe fermentaire des ammoniacases 12 ): 125 ('37) 554-56. — L'action de l'eau lourde sur la malico-déhydrase 12 ): 126 ('37) 592-95. Contribution au problème des ferments de défense 5 ): 129 ('38) 695-97. - Sur le p H d u milieu d'action de la fumarico-aminase 12 ) : 697-99. — Sur la spécificité des enzymes désaminant les D-aminoacides 12 ) : 699-701. — Sur la diffusion de l'aconitase 13 ) : 131 ('39) 647-49. — Recherches sur les enzymes placentaires. Sur l'existence d'une aconitase dans la placenta 6 ) : 649-51. — Sur la spécificité structurale de l'aconitase 1 2 ): 652-54. — Les aconitases dans les tissus animaux 1 3 ): 133 ('40) 109-12. — Sur la diffusion des aconitases dans les tissus végétaux 1 2 ): 112-15. — Sur quelques propriétés spécifiques des aconitases : 116-19. — Activité de la thiaminase dans l'organisme vivant et mort 1 ): 142 ('48) 1150f. — Sur un système fermentaire attaquant l'acide folique 1 ): 1151f. — L'influence de l'acide folique et des vitamines B x et B 2 sur l'activité de plusieurs enzymes 4 ) : 143 ('49) 1627f. — Action de la streptomycine sur plusieurs enzymes 4 ): 1629f. — Sur l'intoxication de la thiaminase 1 ): 144 ('50) 1575f. — Action de l'oxyde de deutérium sur la thiaminase 1 ): 145 ('51) 597-99. - Y a-t-il plusieurs thiaminases ï 1 ) : 1736-38. — Action des sulfamides sur la thiaminase végétale 1 ): 146 ('52) 953-56. — Etudes sur la thiaminase des champignons 10 ): 1454-56. — Action des

2236

Jacobsohn - - Jacobson

sulfamides et de la riboflavine sur la thiaminase des champignons 1 ): 1456-58. — Sur l'activation de la thiaminase 1 ) : 147 ('53) 182224. — Mode d'action de plusieurs antibiotiques sur la saccharase d'une levure 1 ): 1828-31. — Action d'antibiotiques sur une peptidase et sur l'uréase 1 ) : 148 ('54) 199-202. - Action de plusieurs antibiotiques sur les déhydrases et sur la fumarase bactériennes 1 ): 1712-14. — Sur la biosynthèse induite de la succinodéhydrase et de la fumarico-hydratase 10 ) : 1714—17. — Biosynthèse induite de l'uréase chez E. coli1) : 149 ('55) 428-30. - Etude sur la fermentation tartrique 1 ): 1823-25. — Sur la biosynthèse induite de la thiaminase 1 ): 1835 f. — Sur les hydratases de la salive humaine 3 ): 150 ('56) 1661-63. - Sur la fermentation de l'acide itaconique par des homogénatshépatiques 9 ) 1 ): 154 ('60) 226-28. - Sur la fermentation de l'acide méthyl-fumarique par des homogénats hépatiques: 1928-31. — A propos de la cholinestérase végétale 1 ): 156 ('62) 202-04. Enzymologia Zur Spezifität der Aspartase ): 1 ('36) 183-90 [m. französ. Zusammenfassg.]. — Zur Kenntnis der Fumarasen. Uber die Existenz der Malicodehydrase 12 ) : 3 ('37) 164-69 — Zur Fermentkinetik in schwerem Wasser1»): 5 ('38/39) 321-25 - Zur enzymatischen Hydratisierung der Aconit13 säure ): 388. — Sur l'équilibre du système des aconitases. (Contribution à l'étude des hydratases et fumarases): 8 ('40) 327-43. — Sur le système fermentaire hydrolysant l'aneurine 1 ): 13 ('48/49) 62-65 [m. deutscher Zusammenfassg.]. — Sur l'inhibition compétitive de la fumarase: 16 ('53/54) 113-16 [m. deutscher u. engl. Zusammenfassg.]. — A propos du synergisme entre Paneurine et acétylcholine 1 ) : 24 ('62) 123-28 12

aktivierung von Thiamin 1 ) : 149-64 [ ]. — Einwirkung von Deuteriumoxid auf Urease 1 ): 2 ('52/53) 65-71 [französ.]. — Einwirkung von Isonicotinoylhydrazid auf verschiedene tierische Enzyme: 81-84 [ ~ ] . — Durch Bernsteinsäuredehydrogenase eingeleitete Biosynthesen 10 ) : 3 ('54) 141-52 [ ]. - Induction et inhibition de la succino-déhydrase de E. coli1): 5 ('56) 113-18. — Radiographie de la gomme 2 ): 6 ('57/58) 45-52. - Etudes sur l'équilibre du système de la fumarase, l 1 ): 7 ('59/60) 5-14; ~ 2 1 ): 15-18; ~ 3 1 ): 19-24. - Action du coenzyme A sur la transacétylation entre l'acétylcholine et l'aneurine 1 ): 9 ('61/62) 15363. — Sur l'activité optique des complexes formés entre plusieurs métaux lourds et des acides organiques asymétriques 1 ): 10 ('63/64) 71-82. Revista portug. Quirn. Polarimétrie des complexes aspartiques : 1 ('58/59) 37-44. — Sur des complexes formés entre plusieurs métaux lourds et des hydroxyacides asymétriques 1 ) : 5 ('63) 99f. — Sur des complexes formés entre plusieurs métaux lourds et des acides organiques 1 ): 7 ('65) 8-12. - Chemische Struktur und Krebslokalisierung: 8 ('66) 192 [portugies.]. Z. analyt. Chem. Polarimetrie von Wolframkomplexen mit optisch aktiven Hydroxysäuren 1 ): 202 ('64) 417-20 [m. engl. Zusammenfassg.]. Mit: ') M. Deodata (de) A z e v e d o ; *) F. B a r r e i r a ; ') J. F. C r u z ; ') J. M. C r u z ; •) A. da C r u z ; •) D. P . da C u n h a ; ') A. de P e r e i r a F o r j a z ; •) F . B . P e r e i r a ; •) R . E . P i n t o ; ») J. M. R o e a d o ; ") M. da S i l v e i r a ; " ) M. S o a r e s ; ") J. T a p a d i n h a s ; ") R. C a r d o s o .

™ JACOBSON, Carl Alfred. Chem. 1920-46 Prof., '46 Prof. Emeritus, West Mode Virginia Univ., Morgantown, W. Va.

Experimental Med. and Surgery d'action des antibiotiques sur plusieurs enzymes animaux 1 ): 11 ('53) 149-56. Fermentforschung Fortgesetzte Studien über die Spezifität der Fumarase: 14 ('34) 175-81. Lisboa méd. Vitamines, hormones et ferments: 12 ('35) 169-82. — Sobre o mecanismo bioquímico da respiracâo celular: 13 ('36) 393-99. — Recherches fermentaires sur le placenta 6 ) : 15 ('38) 359-64. — Etudes enzymologiques sur le métabolisme du cancer. Sur l'activité des hydratases dans des tissus cancéreux humains 13 ): 18 ('41) 118-31.

*1876, Jan. 25, Grantsburg, Wis.; f l 9 5 2 , Dez. 2, Morgantown, W. Va. Nekr. Morgantown Post 1952, Dez. 3, l f . Schriftenverzeichnis Publications by the Faculty of West Virginia University, 19251944: A bibliography (G. Jenny) (Morgantown, W.Va. '47) 41 f.

H. Encyclopedia of chemical reactions 1 (New Y o r k ' 4 6 ) - 4 ('51). MH. Encyclopedia of chemical reactions 5 (New York '53) - 7 ('58). Chemicky Obzor On E. Svagr: "Studies of Revista Chim. pura e appl. Über eine reversible Reaktion enzymatischer Natur: (3) 9 the toxin of water hemlock (Cicuta virosa)" : ('34) 17-23 [ ] . — Neue biochemische Syn- 7 ('32) 15f. these von Aminosäuren 12 ): 11 ('36) 220-30 [ ]. Industrial and Engng. Chem. Silica black: - Vitamin B x 1 ): (4) 1 ('50) 175-83 [ ]. 26 ('34) 798-800. - Silica black as a nickel 1 Revista Fac. Ci., Univ. Lisboa, B Enzym- carrier in oil hydrogénation ): 800-02. aktivität und ionisierende Strahlungen 11 ) : (2) J. chem. Educat. A proposed encyclopedia 1 ('50/51) 113-18 [ ] . - Biochemische In- of chemical reactions: 10 ('33) 614-18.

Jacobson - J. physic. Chem. Silica f l u f f : 40 ('36) 4 1 3 18. Proc. West Virginia Acad. Sci. A new method for determining solubilities: 10 ('36) 94 f. Science [USA] An encyclopedia of chemical reactions: 79 ('34) 541 f. Mit: ') L. R. Williams.

JACOBY, Harold. Astron., Navigation. — 1904-30 Prof., '06-30 Dir. of the Observât., Columbia Univ., New York. — 1888 Cofounder of the New York Math. Soc. (the later American Math. Soc.). *1865, März 4, New York; "¡•1932, Juli 20, New York. Nekr. J . S c h i l t , Science [USA] 76 ('32) 359f. - New York Times 1932, 21. Juli, S. 17. VI

JACQUES, Raymond. Math. 1925-27 Maître de Conférences, '27-29 Prof, sans Chaire, Univ. de Montpellier; '29-37 Maître de Conférences, '37-62 Prof, tit., Univ. de Toulouse. *1892, Aug. 18, Le Creusot. W . Cours de mécanique (Paris '52) 112 S. (Cours de l'Univ. de Toulouse). — Cours de géométrie analytique (Paris '53) 275 S. ( ~ ) . — Cours d'analyse (Paris '53) 306 + 2 S. ( ~ ) . C.B. hebd. Séances Acad. Sci., Paris Sur certaines congruences de sphères: 198 ('34) 880-82. — Sur certains systèmes d'équations a u x dérivées partielles: 201 ('35) 20f. VI

JACYNA, W i t o l d Pavlovic. Chem. (physik.). — 1930-Prof., Chem.-Technol. Inst. Leningrad. — Weitere Daten unbekannt. (Ê3) *1890, März 9 (Febr. 25), Witebsk. Acta physica polon. Le système de Clapeyron et l'échelle de Kelvin. (Note sur les méthodes d'extrapolation pour le calcul de l'échelle thermodynamique absolue yi) : 2 ('34) 419-24. — The volume energy of real gases, 1 : He, Ne, H 2 : 3 ('34) 15-21 [auch poln.: 21-32], — Evaluation de l'échelle thermodynamique: 4 ('35) 249-68 [m. poln. Zusammenfassg. 243-48], Bull. int. Acad, polon. Sci. et Lettres, Sér. A The theorem on the preliminary selection of the a r b i t r a r y functions in t h e t h e r m o d y n a m ical equation of s t a t e : 1934, 375-78. — The equation of s t a t e for helium in t h e intermediate region of temperature 1 ) 3 ) 4 ): 379-86. — " N e a r " a n d " f a r " action in t h e thermo142

Poggendorff

Jacyna

2237

dynamical equation of s t a t e : 1935, 4-13. — The principle of the "dominant-action" in t h e thermodynamical equation of s t a t e : 14-18. — Sur la loi de Taction et de la réaction thermodynamique 2 ): 507-14. — Über die gasthermometrischen Angabedifferenzen: 1937, 97-108. — Zur Begründung der Temperaturskala unterhalb 1 °K: 260-68. — Remarques critiques sur l'échelle thermodynamique audessous de 1 ° K 2 ) 3 ) : 1938, 33-36. J . amer. chem. Soc. Thermodynamic properties of helium a t high pressure: 60 ('38) 555-58. Physical Bey. Note on t h e m a t h e m a t i c a l foundation of the thermodynamical equation of s t a t e : (2) 5 1 ('37) 677. Z . Physik Bemerkung über die BeattieBridgemansche und dieTzu-Chang-Huangsche F o r m der Zustandsgleichung 1 ) 3 ) 4 ): 89 ('34) 370-72. — Zur thermodynamischen Theorie der Zustandsgleichung 1 ) 3 ) 4 ): 90 ('34) 331-41, 93 ('34/35) 278. - Die Eigenschaften der reellen Gase auf Grund der thermodynamischen Zustandsgleichung, 1: Der JouleThomson-Effekt des Heliums in Abhängigkeit vom Druck u n d von der T e m p e r a t u r : 91 ('34) 349-52; ~ 2: Der Joule-Effekt bei H e l i u m : 92 ('34) 204-11; ~ 3 : Die spezifischen Wärmen c v bzw. c p u n d die Spannungs- bzw. Ausdehnungskoeffizienten ß bzw. a des Heliums: 661-74; — 4 : Die thermodynamischen Funktionen des Heliums: 93 ('35) 3 3 8 47; ~ 5: Kompressibilität des Heliums unterhalb des kritischen Zustandes im Intervall von 4,34 °K bis 2,59 ° K : 95 ('35) 246-51; ~ 6 : Das kritische Gebiet bei Helium: 253-61; ~ 7: Das Boyle-Gebiet bei Helium: 409-14; ~ 8: Inversionslinie des Joule-ThomsonEffektes bei Helium: 692-97. — Bemerkung über die Gültigkeitsgrenzen des Theorems der präliminaren Auswahl der willkürlichen Funktionen in der thermodynamischen Zustandsgleichung: 91 ('34) 353. — Bestätigung des Jacynaschen Auswahltheorems a m Helium 1 3 4 ) ) ): 92 ('34) 675-79. - Bemerkung zur thermodynamischen Theorie der Zustandsgleichung 1 ) 3 ) 4 ): 93 ('34/35) 348f. - Das BoyleGebiet in der neuen Theorie der Zustandsgleichung 1 ) 3 ) 4 ): 94 ('35) 224-28. - Der y>0Wert auf Grund der neuen Zustandsgleichung: 95 ('35) 252. — Zur experimentellen Bestätigung der neuen Zustandsgleichungstheorie: 96 ('35) 119f. — Zur Bestimmung der absoluten Temperatur des normalen Wassergefrierpunktes. (Über Vo-Grenzwerte): 97 ('35) 107-12. Bemerkung über die neue Auffassung der kritischen Erscheinungen: 669f. — Über den negativen Kohäsionsdruck 1 ) 3 ) 4 ): 774r-76. — Über die Extremwerte des Joule-ThomsonEffektes (JTE-Inversionspunkte zweiter Ordnung): 98 ('36) 775-89. - Über Grenzverdünnungszustände: 99 ('36) 159f. — Über die Temperaturabhängigkeit der zur Temperatur-

2238

Jacyna — Jaeger

messung dienenden Eigenschaften: 100 ('36) 205-11; 101 ('36) 785f. - Die allgemeinen physikalischen Grundlagen der reellen Thermodynamik 1 ) 3 ) 4 ) : 77-85. — Über die kausale N a t u r der „statistischen Gesetzlichkeit" : 13538. — Bemerkung über den Beweis des Auswahltheorems: 139f. — Kompensationszustände („Basislinie") bei Helium u n d Kohlensäure: 103 ('36) 61-66. - Über die U-Effekte von H . Amagat und P. Weiss. Die Zustandsgieichung auf Grund des Auswahltheorems u n d des Joule-Thomson-Effektes: 67-75. — Bemerkung zu meiner Arbeit „Über die U-Effekte von H . Amagat und P . Weiss" in der Verbindung mit der Frage über die Zustandsgieichung auf Grund des JouleThomson-Effektes: 105 ('37) 267 f. Mit: *) S. D e r e v j a n k i n ; ') L. Malis; •) A. Obnors k i j ; ') T. P a r l e n t ' e v .

V'"" JAEGER, Frans Maurits. Chem. (physibal. u. anorg.). - 1908^3 Prof., Univ. Groningen. — '31 Dr. h. c. (Univ. Groningen) ; Dr. h. c. (Univ. de Bruxelles). *1877, Mai 11, Den Haag; fl945, März 2, Haren, Groningen. Zur Biogr. W. P . J o r r i s s e n , Chemisch Weekbl. 81 ('34) 182-86. - I. L i f s c h i t z , ibid. 187-91. - A. S i m e k , ibid. 192-201. — P . T e r p s t r a , ibid. 201-03. - D. W. D i j k s t r a , ibid. 203-05. — J . B e i n t e m a , Schr.verz.: ibid. 205-12. Nekr. J . M. B i j v o e t , J a a r b . koninkl. nederl. Akad. Wet. 1944/45, 145. - W. P . J o r r i s s e n , A. J . Z u i t h o f f , Chemisch Weekbl. 48 ('47) 67-71 (m. Schr.verz.). J. T i m m e r m a n s , R a p p o r t Année acad., Univ. libre Bruxelles 1947/48 ('49) 139. W. De ontdekkingsgeschiedenis der chemische elementen (Antwerpen-Amsterdam '35) 191 S. — Lectures on t h e principles of symm e t r y and its applications in all natural sciences "(London '48) 348 S. Bull. Soc. chim. Belgique La mesure exacte des constantes physico-chimiques à des températures très élevées: 4 1 ('32) 30-52. Bull. Soc. chim. France Sur les configurations stériques relatives et absolues des ions complexes tri-diaminés optiquement actifs du chrome, d u cobalt et du rhodium: (5) 4 ('37) 1201-20. Chemické Listy Yëdu a Prûmysl Das Problem einer dissymmetrischen Synthese : 31 ('37) 162-67,179-86 [tschech.]. - Die analytische Ultrazentrifuge und die Untersuchung der filtrierbaren Virusarten: 33 ('39) 34-37, 56-59, 79-84 [tschech.]. Chemisch Weekbl. Über das Gesetz der Additivität der spezifischen Wärmen in heteropolaren Verbindungen: 31 ('34) 60f. —

Hendrik Sjoerd van Klooster: 32 ('35) 562 f. — Das Problem der dissymmetrischen Synthese: 33 ('36) 522-33. - Die Messung der Oberflächenspannung von geschmolzenen Salzen u n d Metallen bei hohen T e m p e r a t u r e n : 34 ('37) 641-46. - Die analytische Ultrazentrifuge und die Untersuchung der filtrierbaren Virusarten: 36 ('38) 419-31. — Prof. Dr. Antonin Simek: 39 ('42) 454. - - Alle Arbeiten niederländ. Nachr. Ges. Wiss. Göttingen, Fachgr. III Die relative und absolute Konfiguration der komplexen Tridiammino-Ionen beim trivalenten Chrom, K o b a l t und R h o d i u m : (N.F.) 1 ('37) 199-213. Physica The exact formulae for t h e t r u e and mean specific heats of platinum between 0 and 1600 °C 9 ): 6 ('39) 1123-25. Price Moravskß prirod. SpoleCnosti Die relative u n d absolute Konfiguration der komplexen Tridiammino-Ionen beim trivalenten Chrom, Kobalt u n d R h o d i u m : 10 ('37) 10[tschech.]. Proc., Koninkl. (nederl.) Akad. Wet. (Amsterdam) The exact measurement of t h e specific heats of solid substances [metals] a t high temperatures, 5: On the cooling correction of t h e metal calorimeter in exact high temperature calorimetry 9 ) 4 ): 35 ('32) 347-52; The exact measurement of the specific heats of solid substances between 0 and 1625 °C, 6[a]: On the law of Neumann-Joule-KoppRegnault concerning the molecular heat of chemical compounds in function of atomic heats 4 ): 352-62; The exact measurement of the specific heats of solid substances [metals] a t high temperatures, 6[b]: Metals in stabilized and non stabilized condition: platinum a n d silver 9 ) 4 ): 763-71; ~ 7: Metals in stabilized and non stabilized condition: copper and gold 9 4 ) ): 772-79; On t h e law of additive atomic heats in intermetallic compounds, 9 : The compounds of tin and gold, and of gold a n d antimony 4 ): 916-28; On t h e law of additive atomic heats in the case of intermetallic mixed crystals, 10: Silver and gold 4 ): 929-31; The exact measurement of the specific heats of solid substances [metals] a t high temperatures, l l [ a ] : On t h e remarkable behaviour of beryllium after preliminary heating above 420 °C ' ) : 1055-61; ~ l l [ b ] : On t h e variability of the specific heats of fused and solidified silver under different circumstances 9 ) 1 1 ): 36 ('33) 291-98; ~ 12: The specific heat of metallic rhenium 9 ): 786-88; ~ 13: T h e specific heats of vanadium, niobium, t a n t a l u m and molybdenum f r o m 0 to 1500 °C n ) : 37 ('34) 61-66; — 14: The specific heats a n d thermal retardation-phenomena of beryllium 9 ): 67-76; ~ 15: A redetermination of t h e specific heats of palladium 1 1 ): 280-83; ~ 16: The specific heats of metallic thorium and of thorium dioxide between 20 and 1400 °C u ) :

Jaeger 327-32; ~ 17: Calorimetrical retardationphenomena in the case of cerium and chromium8): 489-97; ~ 18: On the use of Dewar vacuum vessels in the metal block calorimeter for the control of the cooling-rate«)9): 38 ('35) 502-09; ~ 19: The specific heats of zinc, magnesium and their binary alloy: MgZn2 8 ): 510-20; ~ 20: On the molecular heats of the alloys of palladium and antimony in comparison with the sum of the atomic heats of the free elements8): 822-33; ~ 21: On the molecular heats of the compound PtSb 2 in comparison with the sum of the atomic heats of the free composing elements8): 833-36; ~ 22: The molecular heats of the supposed binary compounds of copper and palladium8): 836-41; ~ 23 [a]: The calorimetrical, electrical and thermoelectrical behaviour of ductile titanium, 1®)«): 89 ('36) 442-52; ~ 23 [b]: « ¿ 2 »)«): 453-61; ~ 24: ¡=s 3 9 ) 6 ): 462-69; ~ 26: The specific heats and the electrical resistance of cerium4)9): 912-20; ~ 27: The specific heats and the electrical resistance of lanthanum4)9): 921-27; ~ 28: The heat-capacity and the electrical resistance of didymium between 300 and 600 °C 4 ) 9 ): 40 ('37) 481-89; ~ 29: Specific heats, electrical resistance, thermo-electrical behaviour and thermal expansion of neodymium in connection with its allotropic changes4)9): 41 ('38) 120-38; ~ 31: The mean specific heat of cobaltum in connection with the granular size of its crystalline structure13): 43 ('40) 815-19. The structure of potassium-osmiamate12): 36 ('32) 610-24. — The structure of tetraand tri-phosphonitrile-chloride1): 756-62. — The structure of cesium-osmiamate12): 77986. — The structure of the ammonium-, rubidium- and thallium-osmiamates12): 78798. — The crystal structure of cesium-, thallium- and rubidium-perrhenates1): 36 ('33) 523-28. — The allotropism of beryllium12): 636-44. — On complex salts with a,a'-dipyridyl: Complex salts of bivalent nickel5): 37 ('34) 10-15. — On complex salts of trivalent rhodium with a,a'-dipyridyl6): 284-90. — On the complex salts of a,a'-dipyridyl with bivalent iron6): 333-36. — Complex salts of a,a'-dipyridyl with bivalent copper [, l] 6 ): 395-400; ~ 2 6 ): 618-23. - Complex salts of a,a'-dipyridyl with zinc and cadmium [, l] 6 ): 753-60; ~ 2 6 ): 38 ('35) 235-42. - On the symmetry and the structure of the crystals of the hydrochlorides of triaminotriethylamine1): 243-48. — On some complex dipyridyl-salts of nickel and copper6): 972-77. — On complex salts of dipyridyl with bivalent and trivalent cobaltum6): 39 ('36) 164-75. - On the localization of the transition-points of allotropic metals under varied circumstances by means of the method of Saladin-LeChatelier9): 36674. — Measurement of the electrical resistance of metals as function of the temperature by means of a twin galvanometer with photo142*

2239

graphic recording9): 374-83. — On the preparation and properties of some ortho-diamino-cyclohexanes6) : 384-93. — The determination of the thermo-electrical force of metals in a vacuum by means of the photographically recording double galvanometer9): 469-77. — On the relative and absolute spatial configuration of isomorphous, optically-active complex salts, 1 : Comparison of the triethylenediamine- and tricyclohexanediaminesalts of trivalent cobaltum and rhodium: 40 ('37) 2-11; ~ 2: Comparison of the tridiamino-salts of cobaltum, rhodium and chromium: 108-16. — Investigations on complex salts of racemic and optically-active cyclohexanediamines with trivalent cobaltum and rhodium, 1: On trans-cyclohexane-1-2diamine and its fission into optically-active antipodes 3 ): 12-23; ~ 2: The complex tricyclohexanediamine rhodium salts 3 ): 116-23; ~ 3 : Tricyclohexanediamine salts of trivalent cobaltum3): 246-58; ~ 4: On the crystallographic properties of the opticallyactive tricyclohexane-diamine-cobaltic salts and on ethylenediamine-cyclohexanediaminecobaltic salts of this series3): 316-25. — On the possibility of distinguishing right- and left-handed structures in crystals by means of their Laue-patterns2) : 406-10. — On pterotactic derivatives of bivalent platinum with optically-active, cyclic trans-1-2-diamines2): 490-98. — Optical rotation and rotatory dispersion in solution and in the crystalline state2)10) : 574-79. — On reversible phase-transitions in solid refractory metals: 43 ('40) 762-69. — On the preparation of /?phenyl-isopropylamine (benzedrine), of the isomeric a-phenylpropylamine and of /?phenyl-a-propylenediamine and on the resolution of these bases into their opticallyactive antipodes, l 6 ): 44 ('41) 26-40; ~ 2: On the resolution of a-phenylpropylamine into its optically-active antipodes 7 ): 140-43; ~ 3: On the resolution of ^-phenyl-a-propylenediamine into its optically-active components') : 354-60. — The temperature-coefficient of the electrical resistance of ruthenium and its thermo-electrical behaviour with respect to platinum9) : 144-52. Recueil Trav. chim. Pays-Bas La détermination exacte des chaleurs spécifiques vraies [, 2] du tungstène, du rhodium, du palladium, du ruthénium, de l'osmium et de l'iridium à des températures entre 0 et 1625 °C 9 ): 61 ('32) 1-46; La détermination exacte des chaleurs spécifiques à des températures élevées, 3 : Etude systématique des causes d'erreurs expérimentales se présentant dans l'emploi du calorimètre métallique et dans la mesure des chaleurs spécifiques des métaux préalablement travaillés9)4) : 52 ('33) 61-84; ~ 4: Loi de Neumann-Joule-Kopp-Regnault concernant l'additivité des chaleurs atomiques

2240

Jaeger - ' Jaköb

des éléments dans leurs combinaisons chimiques 4 ): 89-111; The exact measurement of the specific heats of metals [solid substances] at high temperatures, 5: Specific heats and thermal hysteresis of beryllium'): 53 ('34) 451-63; ~ 6: The specific heats of vanadium, niobium, tantalum and molybdenum 11 ) : 67787; ~ 7: The calorimetrical behaviour of zirconium 11 ) : 917-32 ; La détermination exacte des chaleurs spécifiques à des températures élevées, 8: Sur la règle additive des chaleurs atomiques des métaux dans leurs combinaisons binaires 8 ): 55 ('36)492-517; The exact measurement of the specific heats of solid substances at high temperatures, 9: Specific heats, electrical resistance and thermoelectrical behaviour of titanium in their dependence on the temperature 9 ) 6 ): 615-54; ~ 10: Specific heat, electrical resistance, thermoelectrical behaviour and thermal expansion of some rare-earth metals 4 ) 8 ): 57 ('38) 113782; The exact measurement of the specific h e a t and other physical properties of solid substances at high temperatures, 11: The specific heat, electrical resistance, thermoelectrical behaviour and thermal expansion of electrolytic iron 9 ) 13 ): 1313-40; La détermination exacte des chaleurs spécifiques àdes températures élevées, 13: Les chaleurs spécifiques, la résistance électrique et les forces thermoélectriques du cobalt 9 ) 13 ): 59 ('40) 831-56. — The structure of the alkali osmiamates 12 ): 51 ('32) 1013-53.

Biochemische Z. Über die Wechselwirkung zwischen Casein und Nicotin: 259 ('33) SSISS. — Die Wechselwirkung zwischen Aminosäuren und Nicotin: 265 ('33) 426-28. Usp. Chim. Fortschritte der Proteinchemie. Überblick über die Literatur während der letzten 10-12 Jahre (bis 1933): 2 ('33) 361-92 [russ.]. — Übersicht über die Arbeiten über die Chemie der Proteine in den letzten 6 Jahren: 8 ('39) 1255-88, 1416-36 [russ.].

Yerhandelingen koninkl. nederl. Âkad. Wet., Afd. Natuurkunde, 1. Sect. Second report on viscosity and plasticity, 2: Viscosity of liquids in connection with their chemical and physical constitution: 16 ('38) Nr. 4, 29-112. Z. anorg. u. allg. Chem. Die verschiedenen Typen von Komplexsalzen des ) A. D. A v e t i s j a n ; ') N. K. F l o r e n s k a j a ; J Mit: ) J. B e i n t e m a ; >) J. ter Berg; ') L. B i j k e r k ; s ) A. N. F u n i k o v a ; «) M. I. K l i m e n t o v a ; 5) A. I. 4 ) J. A. B o t t e m a ; s ) J. A. v a n D i j k ; •) K. F o n - S o l n c e v ; •) A. S. S p i r i d o n o v a ; ') T. V. S v e d o v a ; t e y n e ; ') W. F r,0o e n t j e s ; ") T. J. P o p p e m a ; •) •) N. A. T a r a s i k o v . E. R o s e n b o h m ; ) P. T e r p s t r a ; ") W. A. V e e n s t r a ; ") J. E. Z a n s t r a ; ") A. J. Z u i t h o f f . VI

w

JAICNIKOV, I v a n Stepanovic. Chem. (org.), Bioehem. - 1936- Prof., Landwirtsch. Akad. „K. A. Timirjazev", Moskva. — Weitere Daten unbekannt. *1883, April 15 (3), Sobolevskaja Svijazsk, Gouv. Kazan'.

JAKÖB, Wiktor F. Chem. (anorg.). — 1912- Assist., Inst, anorg. Chem., '24 Dr. phil., Univ. Lwöw; '26-36 außerord. Prof., '36-45 ord. Prof., Techn. Hochsch. Lwow; '45-51 ord. Prof., Schlesische Techn. Hochsch. Gliwice; '51-60 ord. Prof., '60 Prof. emer., Jagiellonen-Univ.

Jaköb -

Jakovkin, Aleksandr

2241

Krakow. — Sniadecki-Medaille (Poln. w i t h N H 3 > N 2 H 4 a n d H 2 0 7 ) : 6 0 1 - 0 9 ; ~ 3 : Supercomplexes of octacyanotungstates(IV) Chem. Ges.). with NH3, N2H4, H209)17): 611-18; ~ 4: *1886, Mai 30, Lwöw. Electronic spectra and regions of photosensiZ u r Biogr. Z. W o j t a s z e k , 1962, 263-65 (m. Bildn.).

Wszechéwiat t i v i t y of [MO(CN) 8 ] 4 _ a n d [ W ( C N ) 8 ] 4 " 1 7 ) 9 ) : 4 0

S. Theory a n d structure of complex compounds. Papers presented a t the symposium held in Wroclaw 1962 (B. Jezowska-Trzebiatowska) (Oxford-London-New York-Paris '64) 79-86: Uber die Koordinationseigenschaften der Molybdän- u n d W o l f r a m a t o m e ; 211-15: The properties of solid photoproducts of octacyanides of molybdenum(IV) and of tungsten(IV) 9 ) 1 7 ); 333-37: A series of derivatives in t h e group of oxime-oyanides of molybdenum 8 ) 3 ); 381-86: On some properties of [Mn(CN) 5 NO] , _ ions 6 ) 16 ). Ber. dtsch. ehem. Ges. Über die Elektroreduktion der Perrhenatsäure : 66 ('33) 461 f. Chemické Listy Yëdu a P r ù m y s l Einfluß der Bildung von Komplexen auf die Einstellung des Gleichgewichtes in einigen Oxydoreduktionssystemen 1 2 ) : 26 ('33) 461-66 [poln.]. Coll. Trav. chim. Tchécoslovaquie Influence of complex formation on t h e a t t a i n m e n t of equilibrium in some oxidation-reduction systems 1 2 ): 5 ('33) 93-102. Przeglqd chem. Modern atomic weights: 4 ('46) 36-41 [ ]. Roczn. Chem. Quadrivalent molybdenum, 2 : Hydrolysis of complex cyanides of t h e t y p e X 4 [Mo(CN) 4 (OH) 4 ]; a hydroxide of quadrivalent molybdenum 1 0 ): 12 ('32) 576-88 [poln. m. engl. Zusammenfassg.] ; — 3 : MolybdänIV-oxychlorsäure; Beständigkeit der sauren Lösungen des vierwertigen Molybdäns 2 ): 19 ('39) 146-50 [poln. m. deutscher Zusammenfassg.]; ~ 4 : Über den Zerfall der Molybdänoctocyansäure ; die Molybdändicyansäuren 1 3 ) : 151-55 [ ~ ] . — Moderne anorganische Chemie u n d ihre Beziehungen zu verwandten Wissens c h a f t e n : 68-83 [ ~ ] . — Über die Koordinationszahl zehn in freien komplexen Ionen 7 ) : 26 ('52) 492f. [ ~ ] . - N a t u r e of t h e peroxide linkage in dicobalt ammines 1 1 ) : 80 ('56) 105566 [poln. m. engl. Zusammenfassg.]. — Über das sogenannte Nitrosylcyanid des Molybdäns Mo(0)3)6) : 33 ('59) 861-63 [poln. m. deutscher Zusammenfassg.]. — Observations on t h e course of reduction of chloride complexes of Mo(V) 11 ) 16 ) : 35 ('61) 3 - 1 2 [poln. m. engl. Zusammenfassg.]. — Polarographic investigations on molybdic isopolyacids, 1 : Behaviour of molybdate in nitric acid solutions 1 ) : 13-21 — On investigations of t h e photochemical reactions of octacyanomolybdates(IV) a n d octacyanotungstates(IV) 9 ) 1 7 ) : 86 ('62) 165-67. Investigations of the photochemical reactions of octacyanomolybdates(IV) a n d octacyanotungstates(IV), 1 : Preliminary results 7 ) : 593600;

JAMES, Thomas Campbell. Chem.

- 1904-19 Lecturer, '19-21 Assist. Prof., '21-44 Prof., '36-45 Vice-Principal, '44

Prof. Emer., Univ. College of Wales, Aberystwyth, Wales. *1879, Juni 21, Llanelli, South Wales; t l 9 6 7 , N o v . 19.

Nekr. C. W. D a vi es, Chemistry in Britain 4 ('68) 168. W. Practical organic chemistry (m. J . J . Sudborough) 2 (London-Glasgow '49) 1 8 + 450 S. J. chem. Soc., London The relationship between the three forms of cis-cinnamic acid 2 ): 1933, 1453f. - The addition of halogens to unsaturated acids and esters, 5: The bromination of m-methoxycinnamic acid and

its ethyl ester 1 ): 1935, 1600-04. - David Gwynne Davies, 1907-1944: 1944, 562. Mit: ») J. I. Jones; ») H. V. W. Robinson. V VI

>

JAMIESON, George Samuel. Agri-

kulturchem. — 1918-19 Analytical Re-

search Chemist, '19-27 Chemist in Charge

of the Oil, Fat and Wax Sect., '27-43

Senior Chemist, Bureau of Chemistry (and Soils), '43-47 Chemical Consultant, U. S.

Departm. of Agriculture, Washington, D. C. *1879, Juni 7, Bridgeport, Conn.; fl959, Jan. 26, Bethesda, Md. Nekr. Capital Chemist 1959, Marz-H., S. 69 (m. Bildn.). W. Vegetable fats and oils; the chemistry, production and utilization of vegetable fats and oils for edible, medicinal and technical purposes (New York '32) 444 S.; 2('43) 6 + 508 S. (American Chemical Society monograph series, 58). — Report of the United States vegetable oil mission to Brazil 1942 (Washington, D. C. '42) 117 S.; auch portugies. Ausgabe. Annual Rev. Biochem. The chemistry of the acyclic constituents of natural fats and oils: 7 ('38) 77-98. Investigational Rep., U. S. Bur. Fisheries Chemical and physical properties of burbotliver oil and its vitamin content 9 ) 13 ): Nr. 12 ('32) 6 S. J. agric. Res. Oil content of nine varieties of soybean and the characteristics of the extracted oils1)7): 46 ('33) 57f. J. amer. chem. Soc. The chemical composition of the fat produced by Penicillium javanicum van Beijma 14 ): 56 ('34) 973-75. J. Assoc. offic. agric. Chemists Report on the determination of moisture in fats and oils: 15 ('32) 560f. — Report on the analysis of fats and oils: 16 ('33) 568f. — Report on fats and oils: 17 ('34) 381 f. — Report on the analysis of oils, fats and waxes: 20 ('37) 418-21; 23 ('40) 603f. J. biol. Chemistry The lipids of milk, 1: The fatty acids of the lecithin-cephalin fraction 6 ) 4 ): 106 ('34) 717-24. Oil and Soap Fats and their examination: 9 ('32) 54-59. - Wheat-germ oil 1 ): 136-38. Comparative study of methods for determining free fatty acids in cotton seed 7 ): 228— 31; 10 ('33) 9-11. - The Bolton and Williams grouping of fatty oils according to the iodine number of their unsaponifiable matter 7 ): 69f. — California apricot[-kernel] oil 7 ): 14749. — Free fat acid determination. Some additional factors affecting the accuracy of the free fatty acid determination as applied

Jamieson - - J a n e t , Maurice t o cotton seed analysis 7 ): 11 ('34) 191 f. — Passion f r u i t seed oil'): 193. — P a t a u a palm 011 (CEnocarpus p a t a u a Mart.) 7 ): 207,217f. — The oil content of soybeans 2 ): 253, 261. — Phosphatides in American soybeans and oil7) : 12 ('35) 70-72. - Caprified fig-seed oil 7 ): 88. — A s t u d y of t h e composition of American t u n g o i l 7 ) : 92 f. — Review of scientific literat u r e on f a t s and oils for 1934 10 ) 8 ) 3 ): 106-21; ~ 1936 10 ) 8 ) 3 ): 14 ('37) 59-71, 88-103. - Bagilumbang or soft lumbang (Aleurites trisperma) oil 7 ): 12 ('35) 146-48. - California raisin (grape) seed oil 7 ): 241. — Composition of oiticica oil 7 ): 13 ('36) lOf. — Analysis of t u n g fruits grown under different conditions in Mississippi 7 ): 71. — The determination of t h e lint on cotton seed and the cellulose in hull fiber 7 ): 139f. — Composition of t h e oil of t h e American black walnut 7 ): 202. — Expressed kapok seed oil 7 ): 233 f. — A n o n - f a t t y oil f r o m jojoba seed 7 ): 289-92. — J a p a n e s e t u n g oil 7 ): 14 ('37) 2f. — Soybean phosphatides 7 ) 6 ): 12629. — The composition of expressed lumbang oil 7 ): 203-05. — A f u r t h e r s t u d y on t h e composition of American t u n g oil with special reference to t h e linoleic acid content 7 ): 15 ('38) 30-32. — Ouricury palm-kernel oil 7 ): 172-74. — Stillingia oil 7 ): 295f. — Ben (Moringa) seed oil: 16 ('39) 173f. — Cocos pulposa palm-kernel oil 11 ): 17 ('40) 144. — Composition of seven American linseed oils 11 ): 18 ('41) 173f. — Factors affecting the stability of cotton seed oil 12 ) 11 ): 19 ('42) 176-80. - Mexican prickly poppy seed oil 11 ): 20 ('43) 33-35. - Seed oil of Garcia nutans 1 1 ): 202f. — Licania arborea seed oil 11 ): 227-31. — Preparation of purified methyl linoleate b y chromatography 1 2 ) 1 1 ): 249f.

2245

1935 I, 89-92 [russ. u. deutsch]. - Sur l'équation complexe de Fredholm: 1936 I I I , 25559. C. R . hebd. Séances Acad. Sei., Paris Sur les équations de Fredholm complexes à n o y a u x uniformes: 200 ('35) 33-35. VI

JANEK(S), Aleksandr(s) Michajlovic. Chem. (anorg., Kolloidchem., Gesch. d. Chem.). — 1920 Doz., '21-30 außerord. Prof., '30- ord. Prof., Vorstand d. dispersoidol. Labor., Lett. Univ. Riga; '32-34 Präs., Lett. Biol. Ges.; '35-40 Präs., Französ.-Lett. Ges. — Weitere Daten nicht bekannt. *1891, Nov. 28, Daugavpils (Dwinsk), Lettland. Kolloid-Z. Ein neues Verfahren zur Herstellung von Schwefelsolen: 64 ('33) 31f. — Kolloide Schwefellösungen durch Einwirkung von J o d auf Natriumsulfid: 65 ('33) 87. — Kolloide Lösungen bei der Hydrolyse von Cerisulfat 1 ) : 295-97. — Überführung der dispersen Phase aus einem Dispersionsmittel in ein anderes durch Entmischung, 2 1 ): 66 ('34) 296-302. Latvijas f a r m . 2 . Zum 400jährigen Bestehen des Collège de France in Paris: 1933 [lett.]. — Neues Verfahren zur Herstellung von Schwefelsolen: ibid. [lett.]. — Die Realit ä t v o m S t a n d p u n k t des Epallelismus: 1935, 17 S. - A. M. Ampère: 1937, Nr. 1, 6 S. [ ]. Z. anorg. u . allg. Chem. Zur Statistik der Wertigkeiten: 252 ('44) 354-56.

Mit: ') W. F. B a u g h m a n ; ') J. L. Carter; ») G. R. Mit: ») A. S c h m i d t . Grcenbank; *) G. E. Holm; ') W. B. H o l t o n ; •) F. E. K u r t z ; ' ) R. S. McKinney;«) H. A. M a t t i l l ; •) E. M. Nelson; 1 0 ) R. C. N e w t o n ; ") W. G. R o s e ; JANET, Maurice ") C. E. S w i f t ; ") C. D. Tolle; ") G. E. Ward.

Léopold René. Math. - 1924-45 Prof., Univ. de Caen; '45-59 Prof., '59 Prof. hon., Univ. de VI JANCEVSKIJJ Sergej Arkad'evic. Paris. - '43 Prix Saintour, '59 Prix Math. — 1930- Dozent, '36 Kandidat d. Petit d'Ormoy (Acad. Sei. Paris). physik.-math. Wiss., Univ. Leningrad; *1888, Okt. 24, Grenoble. Zur Biogr. Annales Univ. Paris 17 ('47) '31- Mitarbeiter, '33- Prof., Eisenbahn232 (m. Bildn. v o r S . 227, Schr.verz.-Auszug). inst., Leningrad. (£3) Informations sei. franç. 1960, 41-. *1900, Sept. 22 (9), Petersburg; fl941, Dez. 28, Leningrad. Z u r Bibliogr. Notice sur les t r a v a u x scienS. T r u d y 2-go Vsesojuznogo matematiceskogo s-ezda [Arbeiten der 2. Mathematischen Unionskonferenz], Leningrad 1934, 2 (Leningrad-Moskva '36) 262-69: Komplexe Fredholmsche Gleichungen [russ.]. W . Funkcii kompleksnogo peremennogo [Funktionen einer komplexen Veränderlichen] (Moskva-Leningrad '37) 196 S. C. R . (Dokl.) Acad. Sei. URSS Irreguläre Oszillationseigenschaften der Eigenfunktionen bei Eigenwertproblemen vierter Ordnung:

tifiques de M. Maurice J a n e t (Paris '37) 28 S.; Suppl. ('51) 8 S. — Annales Univ. Paris 17 ('47) 232; 24 ('54) 246.

H . Faculté des Sciences de Paris: Séminaire de mécanique céleste 1.1957/58 (Paris '58) ff. S. Verhandlungen des Internationalen Mathematiker-Kongresses, Zürich 1932, 2 (Zürich-Leipzig '33) 111-13: Détermination explicite de certains minima. — Recherches philosophiques (A. Koyré, H.-Ch. Puech, .A.

2246

Janet, Maurice

Spaíer) 2.1932/33 (Paris '33): A propos du posés aux examens écrits de 1954 à 1959 (Pacalcul des variations et de son rôle dans la ris '66) 38 S. science contemporaine. — C. R. Congrès inter- Annales sci. Ecole norm. sup. Sur les fornational des mathématiciens, Oslo 1936, 2 mules fondamentales de la théorie des groupes (Oslo '37) : Sur les systèmes de deux équations continus finis et de la méthode du repère aux dérivées partielles à deux fonctions in- mobile: (3) 59 ('42) 165-86. connues. — Mélanges offerts à M. Pierre Janet par sa famille, ses amis et ses disciples à l'occaAnnales Soc. polon. Math. Les systèmes sion de ses quatre-vingt ans (Paris '39): Les linéaires d'équations aux dérivées partielles. deux tendances des mathématiques: La théo- Etude spéciale du cas de deux équations à une rie des systèmes d'équations aux dérivées par- inconnue: 18 ('34) 59-86. — Sur un système tielles. — Les grands courants de la pensée simple d'équations du second ordre: 20 ('47) mathématique (P. Le Lionnais) (Paris '48), 335-46. 2 ('62) 413-21 : Harmoniques et spectres (Idées Annales Univ. Paris La chaire de mécanique de Volterra, Equation de Fredholm, Espace analytique et de mécanique céleste de la Fade Hilbert, Physique classique et physique culté des Sciences de Paris: 26 ('56) 379f. moderne). — Congrès international de philoBuletinul Inst. politehn. Ia$i Sur les syssophie des sciences, Paris 1949, 2 (Paris '51) (Actualités scientifiques et industrielles, 1137. tèmes dynamiques à deux degrés de liberté: Philosophie, 17) : Sur le calcul des variations. (N. S.) 4 ('58) 103-06 [m. russ. u. rumàn. Zu— Atti I I I Congresso dell'Unione matematica sammenfassg.]. italiana, Pisa 1948 (Roma '51) 65-68: Sur les Bull. math. Fac. Sci. et grandes Ecoles Exsystèmes à autant d'équations aux dérivées trémales fortes et extrémales faibles; extrépartielles que de fonctions inconnues. — Proc. 6 tb International congress of mathematicians, males anguleuses: 1 ('34) 3-12. Cambridge, Mass., 1950 (Providence, R. I. Bull. Sci. math. Sur la relation entre "équa'52): Equations semi-canoniques. — For- tions canoniques" et "problème de calcul des mulaire de mathématiques à l'usage des phy- variations" et sur certains systèmes différensiciens et des ingénieurs (M. Fréchet) 7 (Paris tiels du second ordre en involution: (2) 71 ('47) '56) 7-10: Equations linéaires du premier 62-72. ordre; 11-19: Equations du premier ordre; C. R. hebd. Séances Acad. Sci., Paris Détersystèmes du premier ordre à une inconnue; généralités sur les équations d'ordre égal mination explicite de certains minima dans ou supérieur à deux; 45-53: Systèmes des problèmes sans conditions aux limites : 194 d'équations aux dérivées partielles. — Ency- ('32) 2109-11, 2248. — Systèmes de deux clopédie française, Cahiers d'actualité et de équations aux dérivées partielles à une foncsynthèse 1: La mathématique, compléments tion inconnue de n variables indépendantes: (Paris '57) 16-18: Méthodes d'intégration des 198 ('34) 1565-67. - Deux théorèmes sur les équations aux dérivées partielles. — Celebra- relations entre expressions différentielles lizioni archimedee del sec. XX, Siracusa 1961, néaires: 200 ('35) 517 f. — Sur les formules 2: Simposio di analisi (Gubbio '62) 25 f.: Grou- fondamentales de la théorie des groupes finis pes continus finis et variétés à connexion continus: 212 ('41) 424f., 627. - Sur les systèaffine. — L'histoire générale des sciences (R.e mes comprenant autant d'équations aux déTaton) 3 : La science contemporaine, 2 : Le 20 rivées partielles que de fonctions inconnues : 227 siècle (Paris '64) 56-69: Equations différen- ('48) 707-09. tielles et équations aux dérivées partielles. Enseignement math. L'œuvre mathématique de René Gosse: (2) 12 ('66) 1-8. J. Math, pures et appl. Dualité dans cerW. Cours d'analyse supérieure. Equations intégrales et applications à certains problèmes taines questions de calcul des variations: (9) de la physique mathématique (Paris '35) 128 15 ('36) 177-91. - Sur le degré de généralité S. (Les Cours de l'Université de Caen. Certi- de la solution de certains systèmes d'équaficat d'études supérieures d'analyse supérieu- tions aux dérivées partielles: 17 ('38) 187-95. re). — Précis de calcul matriciel et de calcul - Sur le problème de Pfaff : 19 ('40) 307-18. opérationnel (Paris '54) 8+223 S. — Métho- — Sur la classification des systèmes formés des mathématiques de la physique. Cours d'autant d'expressions différentielles linéaires 1950/51 (Paris '-); ~ Cours complémentaire, indépendantes que de fonctions indéterminées : mars-avril-mai 1952. Compléments divers sur 37 ('58) 279-93. — Remarques sur quelques problèmes classiques du calcul des variations: la transformation de Laplace et les équations aux dérivées partielles (Paris '55) 48 S.; 2('57) 41 ('62) 127-36. - Sur quelques formules de 47 S. — Invariants intégraux, applications à la théorie des groupes continus finis: 44 ('65) la mécanique céleste (Cours de mécanique 331—41. analytique et de mécanique céleste professé en Mémorial Sci. math. Equations intégrales 1953/54) (Paris '55) 2+106 S. - Mécanique et applications à certains problèmes de la analytique et mécanique céleste. Sujets pro- physique mathématique: 101/102 ('41) 151 S.

Janet, Maurice — Janko

2247

Revue franç. Astronaut. Mouvements des petits satellites proches de la Terre : 2 ('59) Nr. 3, 5-11. Revue gén. Sei. pures et appl. L'aspect moderne des démonstrations d'existence. Le problème de la représentation conforme: 44 ('33) 365-69. — Mécanique analytique et mécanique céleste: Problème des trois corps; périhélie de Mercure: 60 ('53) 328-35. - Le calcul des variations : 73 ('66) 205-13. Vesn. DruS. Matematiëara i Fiziëar a Narodne Republ. Srbije Sur quelques progrès récents de la théorie des équations différentielles de la physique mathématique: 14 ('62) 69-79. Außerdem Vorlesungs- und Übungsskripten aus den Jahren 1925-1962 und einige weitere Publikationen. IV

('34) 555-70; 6 ('36) 587-603. - Les travaux et le rôle scientifique international du Laboratoire Central d'Electricité: 4 ('34) 633-68. - Jean R e y f : 6 ('36) 5-7. C. R. hebd. Séances Acad. Sci., Paris Sur le Congrès international d'électricité de 1932: 195 ('32) 348f. — Observation au sujet de la note de MM. A. Pérard et M. Romanowski: "Premières comparaisons des étalons nationaux de résistance électrique, exécutées au Bureau International des Poids et Mesures" : 196 ('33) 1290f. — Observation à propos de J . Cayrel: "Remarques sur la note de M. Anastasiadès intitulée: Sur le mécanisme de la rectification dans les redresseurs sulfure cuivrique - magnésium": 198 ('34) 65. — Observations à propos de la note de MM. A. Pérard et M. Romanowski: "Nouvelles comparaisons des étalons nationaux de résistance JANET, Paul André Marie. Elek- électrique": 199 ('34) 525-27.

~VI trotechn. — 1894-98 Chargé de Cours, 1895- Dir. du Labor. Central, 1898-Prof. tit., Univ. de Paris; 1895- Dir. de l'Ecole Supér. d'Electricité, Paris; Prés. Hon., Commission Internation. d'Electrotechn. ; Prés., Soc. des Ingénieurs Civils; Prés., Soc. franç. de Physique ; Membre Fondateur, Soc. des Amis d'André-Marie Ampère. — 1911 Prix Gaston Planté (Acad. Sei. Paris); '13 Médaille d'Or Ampère (Soc. d'Encouragement pour l'Industrie nation.) ; '30 Médaille Mascart (Soc. franç. des Electriciens). *1863, Jan. 10, Paris; tl937, Febr. 21, Malakoff, Seine. Nekr. M. de B r o g l i e , Notices et Discours, Acad. Sei., Paris 2.1937/48 ('49) 21-23. - Ch. M a u r a i n , ibid. 24-26. — D. C. J a c k s o n , Proc. amer. Acad. Arts and Sei. 72 ('38) 3636§. — E. L e c l a i n c h e , C. R. hebd. Séances Acad. Sei., Paris 204 ('37) 533-35. - Elektrotechnik u. Maschinenbau 55 ('37) 284. W . Notes et souvenirs (Paris '33) 342 S. Problèmes et exercices d'électricité générale 2 (Paris '35) 8 + 2 9 2 S. — Leçons d'électrotechnique générale professées à l'Ecole Supérieure d'Electricité 3 : Moteurs à courants alternatifs; couplage et compoundage des alternateurs ; transformateurs polymorphiques '(Paris '38) 376 S. — Le calcul symbolique d'Heaviside et ses applications à l'électrotechnique. Conférences faites à la Section de radioélectricité de l'Ecole Supérieure d'Electricité (Paris '38) 8 + 3 6 S. — Problèmes et exercices d'électricité générale et de machines électriques. Neubearb. von G. Nasse (Paris '53) 6 + 4 1 2 S. . Bull. Soc. franç. Electriciens Rapport annuel sur le Laboratoire Central et l'Ecole Supérieure d'Electricité: (5) 8 ('33) 608-22; 4

Mémoires Soc. Ing. civils France Hommage rendu à la mémoire d'Ampère au nom de la Société des Ingénieurs Civils de France et de la Société Française des Electriciens: 89 ('36) 238-. Notices et Discours, Acad. Sci., Paris Congrès international des physiciens tenu en commémoration du centenaire de la mort de Alessandro Volta. Discours: 1.1924/36 .('37) 163-69. Revue gén. Electr. L'inductance propre et l'inductance mutuelle des longs solénoïdes concentriques à plusieurs couches: 17 ('33) 619-23. Revue sci. André-Marie Ampère (17751836): 74 ('36) 112-19. VI

JÂNE0, Jaroslav. Versicherungsmath., math. Statistik. — 1931-36 außerord. Prof., '36-52 ord. Prof., '37-38, '4647 Dekan, '45-52 Leiter d. Inst. f. Versicherungsmath. u. math. Statistik, Vysokâ Skola Speciâlnich Nauk, Ceské Vysoké Uceni Technické, Praha; '52-64 ord. Prof., Karlova Universita, Praha. *1893, Dez. 3, Opatov, Morava; tl965, Jan. 23, Praha. Zur Biogr. F . F a b i a n , Pokroky Mat., Fysiky a Astron. 4 ('59) 658-64. Zum 60. Geb.tag J . N o v â k , Öas. Pëst. Mat. 79 ('54) 89. - L. T r u k s a , ibid. 181-85. Zum 70. Geb.tag F. F a b i a n , Cas. Pest. Mat. 89 ('64) 117-22 (m. Bildn. u. Schr.verz.). Nekr. F. F a b i a n , Aplikace Mat. 10 ('65) 390; Statistika 1965, Nr. 4, 190. S. Atti X Congresso internazionale degli attuari, Roma 1934, 6 (Roma '34) 321-23: [Arbeitslosenversicherung in der ÖSR] [engl.].

2248

Janko — Janssen

— Festschrift zum 70. Geburtstag Professor Dr. Gustav Rosmaniths (Praha '35) 40-44: Über den Begriff der Akzeptanzintervalle. — C. R. 11e Congrès international d'actuaires, Paris 1937,1 (Paris '37) 433-46: Les méthodes de réassurance en Tchécoslovaquie. — Rapports et communications. C. R. Institut International de Statistique, 24 e Session, Praha 1938 (Praha '38) : Le t a u x annuel d'accroissement de la population. — Trans. Prague conference on information theory, statistical decision functions, random processes, Liblice near Prague 1956 (Praha '57): Characterization of several decision functions.

Sborn. Masarykovy Akad. Prâce Prâce strojû rozsirenim funkce organismu: 26 ('51) 201-15. Statistické Obzor Sur les taux de reproduction de la population en Tchécoslovaquie: 19 ('38) 287-318. — Miry reprodukce obyvatelstva, sestrojené podle dat nasi populacni statistiky: 20 ('39) 221-43. — Homogenita statistického souboru: 21 ('40) 239-63 [tschech. m. deutscher u. französ. Zusammenfassg.]. — Statistika v plânovaném hospodârstvi: 26 ('46) 9-19. Außerdem zahlreiche weitere Publikationen, auch sozialwissenschaftlichen Inhalts, in W . Méthodes statistiques permettant une tschech. Sprache, weitere Beiträge in Sitzungsestimation préalable de la mortalité pour les berichten sowie Mitarbeit an mathematischen vies tarées (Praha '37) 8 S. — Zâklady Schullehrbüchern. statistické indukce (Praha '37) 224 S. — Pojistnâ matematika - tabulky ke cviceni VI de JANS, Carlo. Math. - 1923-50 (Praha '38) 48 S. — J a k vytvâri statistika obrazy svëta a zivota 1 (Praha '42) 137 + 5 S., Prof. Differentialrechnung u. höhere Ana2 ('47) 144 S.; 2 ('44) 155 + 1 S., 2 ('48) 163 + lysis, '50 Prof. emer., Univ. Gent; '321 S. (Cesta k vëdëni, 22). — Politickâ aritmetika (Praha '46) 154 S. (lithogr.). - Mate- 50 Studieninspektor der vorbereitenden matické a statistické zâklady pojistné tech- technischen Schulen. niky 1 (Praha '46) 202 S. (lithogr.); 2 ('47) *1880, Juli 4, Roma; 138 S. (lithogr.). — Matematickâ statistika •(•1958, März 7, Gent. 1 (Praha '49) 217 S. (lithogr.); 2: Teorie Nekr. A. L e m b r e c h t s , F. B a c k e s in: nâhodnych vybërû, odhady a nëkteré testy vyznamnosti (Praha '51) 150 S. (lithogr.). — Liber Memorialis der Rijksuniversiteit te Zâklady statistiky (m. J . Novâk, A. Robek) Gent 1913-1960 (T. Liiykx) 4 (Gent '60) 139(Praha '50) 64 S. — Tabulky k matematické 41 (m. Bildn., Schr.verz.). statistice (Praha '50) 50 S. ; erweiterte NeuMHZ. (Begründer) Wis- en natuurkund. aufl. ('53) 99 S. - Statistické tabulky (Praha Tijdschr. 1923-1943. '58) 251 + 1 S.; russ.: (Moskva '61) 243 S. Wis- en natuurkund. Tijdschr. Een eenActa Fac. Berum natur. Univ. Comenianae voudig bewijs der formule van Frullani en K otâzce statistické indukce: 1 ('56) Nr. 4/6, uitbreidingen van die formule: 9 ('38) 85-112. 149-54. Aktu&rské Yëdy Difference equation of the VI JANSSEN, Carl Emil Luplau (LUPpolicy reserve: 8 ('49) 68-75. LAU JANSSEN, Carl). Astron. - 1911Assicurazioni sociali La disoccupazione e la 59 Bibliothekar, Univ.-Bibliothek, K0morbidità: 8 ('32) Nr. 2, 20-27. benhavns Univ. ; Besitzer u. '19-59 Leiter Bull. Inst. int. Statistique Le taux annuel d. Urania-Sternwarte, '27-Leiter d. städt. d'accroissement de la population: 30 ('40) 7580. — Applied statistics training in European Sternwarte „Runder Turm", Kobenhavn; countries, special report for Czechoslovakia: '16 Mitbegründer der Astronomisk Sel38, 3 ('62) 351-66. skab, Kobenhavn. — '22 Gold-Medaille Cas. Pést. Mat. a Fysifey Advances in the theory of non-parametric tests in statistical inference: 74 ('50) 62-74 [tschech. m. engl. Zusammenfassg.]. Cas. Pést. Mat. Besuche ausländischer Mathematiker in der ÖSR: 83 ('58) 387 f. [tschech.]. Hutnické Listy Pouziti analyzy rozptylu k rozboru vysledkû pokusü: 12 ('57) 423-30. Pokroky Mat., Fysiky a Astron. Theorie der Prüfung statistischer Hypothesen: 3 ('58) 9 21,125-39 [tschech.]. - Über einige Probleme der mathematischen Statistik: 5 ('60) 378-85 [tschech.].

(Kgl. Danske Vid. Selskab). *1889, Okt. 3, Frederiksberg.

Ue. F. H o y l e , Verdensrummet. Astronomi for alle [Frontiers of astronomy] (Kobenhavn '56) 232 S. — R. T h i e l , Universets erobring. Himmelgäder og stjerneforskning gennem ârtusinder [Und es ward Licht] (Kobenhavn '57), ('58) 383 + 12 S. - H. W e n d t , P â sporet af Adam. Forskereventyret og urmennesket. Roman om en videnskab [Ich suchte Adam. Roman einer Wissenschaft] (Kobenhavn '58) 446 S. — K. H e u e r , Jordens sidste dage. De naeste 50 milliarder ar set med astronomens ojne [The next 50 billion

Janssen years. An astronomer's glimpse into the future] (Kobenhavn '58) 142 S. — H. G a r t m a n n , Teknikken kan ikke standses. Den store kamp om fremskridtet [Sonst stünde die Welt still] (Kobenhavn '59) 351 S. F. H o y l e , J . E l l i o t , Budskabet fra Andromeda [A for Andromeda] (Kobenhavn '62) 208 S. — P. M o o r e , Stjerneverdenen. Astronomiens historié i billeder [Astronomy] (Kobenhavn '63) 253 S. - C.-J. C l e m e d s o n , Mennesket i rummet [Människan i rymden] (Kobenhavn '63) 288 S. - H. Z i m , R. H. B a k e r , Stjernehimlen i farver. En forer over stjernebillederne, solen, mànen, planeterne og andre himmelfaenomener [Stars] (Kobenhavn '65) 163 S. — C. A. R o n a n , Mennesket og universet [Man probes universe] (Kobenhavn '66) 158 S. - R . W y l e r , G . A m e s , Ud i himmelrummet. Fra stjernetydning til rumfart [The golden book of astronomy] (Kobenhavn '66) 107 S. — B. C e n d r a r s , Tag mig med til Verdens ende [Emmène-moi au bout du monde] (Kobenhavn '66) 273 S. — P. van de K a m p , Verdensrummet, Opbygningen af universet [Space] (Kobenhavn '67) 120 S. Mlle. G. G a m o w , Solenssaga. Stjernernes udvikling og den subatomare energi [Solens födelse och död] (Kobenhavn '45) 214 S. S. Tvsersnit af Jordens og menneskehedens historié (Kobenhavn '63) (Sondagsuniversitetet, 40): [Mitarbeit]. — Sesam. Systematisk leksikon 7 (Kobenhavn '63) 309-88: Rumfart; 8 ('63) 217-310: Astronomi; 313-95: Meteorologi og klimatologi. W. Astronomi og astrofysik. Lœrebog for gymnasiet og realklassen (Kobenhavn '32) 100 S. — Astrofysik. Lœrebog for realklassen (Kobenhavn '32) 46 S. - Hvad er det for en stjerne ? (Kobenhavn '34) 190 S. (Viden og virke). — Stjernehimlen og dens vidundere (Kobenhavn '38) 486 S. — Verdens undergang (Kobenhavn '38) 4 S. (Ledetraad ved folkelig universitetsundervisning, 63). — Maanen (Kobenhavn '48) 4 S. ( ~ 222). - Verdensbilledet gennem tiderne (Kobenhavn '49) 4 S. ( ~ 233). - Solen (Kobenhavn '50) 4 S. ( ~ 287). — Feriebogen om Ry og Danmarks Sohojland (m. Aase Janssen) (Kobenhavn '42) 132 S. — Stjernehimlens billedgalleri (Kobenhavn '46) 76 S.; fotogr. Abdruck ('67) 75 S. — Fifty years activity of the Urania Observatory (Kobenhavn '47) 32 S. — Astronomi (Kobenhavn '48) 16 S. (Grundrids ved folkelig universitetsundervisning, 468). — Pâ vej til manen (Kobenhavn '58) 94 S. — Mennesket ude i rummet (Kobenhavn '58) 14 S. — Le décor chez Guy de Maupassant (Kobenhavn '60) 130 S. - Stjernekalenderen 1961. Med 12 stjernekort, til orientering pà stjernehimlen (Kobenhavn '60) 7 Bl.; ~ 1962. ~ ('61) 7 Bl.; ~ 1963. ~ ('62) 7 Bl.; ~ 1965. ~ ('64) 9 Bl.; ~ 1966. ~ ('65) 9 Bl.; ~ 1967. ~ ('66) 9 Bl.

2249

L'Astronomie (BSAF) E. Hertzsprung [Zum 90. Geburtstag]: 77 ('63) 372 [französ.]. Astronomische Nachr. Helligkeitsschätzungen von Nova Aquilae 3 (1918): 252 ('34) 219. — Mikrometermessungen von Doppelsternen: 295-300; 262 ('37) 317-20. - Mitteilungen über die Nova 452.1934 Herculis: 254 ('34/35) 163, 318. - Die Bahn von 0 2 1 8 : 255 ('35) 274-76. Historiske Medd. Staden Kobenhavn og Borgere Observatoriet paa Rundetaarn: (3) 2 ('36/38) 303-32. J. Observateurs Observations photographiques d'étoiles doubles: 36 ('53) 107-09. Mesures micrométriques d'étoiles doubles: 38 ('55) 106-08. J. roy. astron. Soc. Canada The meteor craters in Hérault, France: 46 ('51) 190-98. Urania [Kobenhavn] Elektrische Photometrie: 7 ('50) 3-11. — H. E. Lau, ein hervorragender dänischer Astronom: 18-25. — Die Entwicklung der Sterne und die interstellare Materie: 36-42. — Einiges über den ArizonaMeteorit: 54-57. — A. Odelberg zum 50. Geburtstag: 81 f. — Weitere Mitteilung über die Radialgeschwindigkeit der Spiralnebel: 17072. — Ein Besuch im Observatorium auf dem Pic-du-Midi: 180-87. — Zur Sonnenfinsternis in der Sowjetunion: 8 ('51) 37-46. - Über Sonnenuhren: 90-94, 108-10, 129f. - Zum 350. Todestag von Tycho Brahe: 154-57. Das Brillenfernrohr: 9 ('52) 19-23, 34-38, 47-52, 120-23; 10 ('53) 19-25, 70-72. Sterndeuter-Humbug: 9 ('52) 38-40. - Der Naturzustand auf dem Mars: 62-64, 81-84. — Tätigkeitsbericht über das Urania-Observatorium im Finanzjahr 1951/52: 69-72; ~ 1952/53: 10 ('53) 50-53. - Der Astronomenkongreß in Rom: 9 ('52) 109-17. — Einiges Neue über Tycho Brahes Sternsystem im Jahre 1572: 10 ('53) 3 f. - Die Dimensionen des Weltalls: 33-40. - Der Planet Vulkan: 61-70. — E. Hertzsprung zum 80. Geburtstag: 77f., 83-89; ~ zum 85. Geburtstag: 15 ('58) 57f.; — zum 90. Geburtstag 1)2)3)5)8)8)9). 20 ('63) 67-74, 75f. - Über Doppelsterne: 10 ('53) 95-103; ~ 2: 11 ('54) 18-20,29-33. — Die Beobachtung der Sonnenfinsternis durch den- Amateur: 33-39. — Mars'): 47-54. — Die Rotation der Venus: 12 ('55) 13-16. — Die Arbeit des Amateurastronomen: 22-26. — Die Magellanschen Wolken: 37-40. — Die Totalitätsdauer von Sonnenfinsternissen: 41 f. — Zur Entwicklung der Astrophotographie: 50-57. — Jens Olsens Weltuhr: 13 ('56) 1-3. — Ein merkwürdiger Sterntyp: 17-19. — Gasmassen im Weltall: 21-25. — Verschiedenes Neue vom Sonnensystem: 26f. — Kometen: 53-57. — Mars: 61-67, 85; 22 ('65) 33-37. - Einiges über Gasnebel: 13 ('56) 69f. — Der Polarstern: 77-80. — Die Marsopposition: 93-95. — Neue

2250

Janssen — Jardetzky

Meteorkrater: 14 ('57) 1-3. - Ein alter K o m e t ? : 9f. — Die astronomische Uhr im Münster von Strasbourg: 21-23. — Die Entstehung des Weltalls: 25-29. — Der Komet Arend-Roland: 33-37, 63f. - Algol: 39f. Der Komet Mrkos 1957d: 65f. - Über künstliche Erdtrabanten: 73-75, 81-83; 15 ('58) l f . — Supernova in NGC 2841: 14 ('57) 78. K. E. Lundmark, 1889-1958: 15 ('58) 25-30. — Foppende Sterne: 34-37. — Etwas Astronomie aus der Zeit Karls des Großen: 49-53. — Weiße Flecken auf der Karte der Wissenschaften: Die Astronomie: 16 ('59) 17-20. Der Vulkanausbruch auf dem Mond: 20-24. — Das Hertzsprung-Russel-Diagramm: 5 3 58. — Die Rückseite des Mondes: 81-84. — Die interstellare Materie: 17 ('60) 17-19. — Veränderliche mit unregelmäßigem Lichtwechsel : 55-59. — Die höhere Schicht der Atmosphäre: 65f. — Die Entstehung des Weltalls: 85-92. — H a t die Erde einen Schweif?: 19 ('62) 2-4. - Einiges über die Mondoberfläche: 10-14. — Über den Termin des Osterfestes: 18-22. — Eine nur wenig bearbeitete Amateuraufgabe: 49-53. — Einiges über R R Lyrae: 60-62. — Einiges über die Fixsternparallaxe: 66-69. — Die Erfindung des Fernrohrs: 69. — G. C. Flammarion f : 20 ('63) 12f. - Castor: 13f. — Eine Supernova: 33 f. — Die Sonnenfinsternis am 20. Juli 1963: 39 f. — Eratostenes Brand: 41-44. — Einiges über das Internationale Observatorium auf der Südhalbkugel: 49-52. — Begegnung mit Tycho Brahe: 52-58. — Der Durchmesser des Planeten Merkur: 74f. — Die höchstgelegenen Observatorien: 77-80. — Komet Holmes: 21 ('64) 62f. — Das Europäische Observatorium auf der Südhalbkugel: 71 f. — Interstellare Materie: 72-75. - Im Weltraum: 22 ('65) l f . — Materie und Antimaterie: 5-8. — Das Auflösungsvermögen eines Fernrohrs: 8f. — R. F. Rasmussen: 9 f. — Das Observatorium Kvistaberg: 14-16. — Die Rotationszeit der Venus: 17-20. — Das Mars-Experiment: 2022. - Über die Mondphotographie: 29-33. Betrachtungen eines alten Marsbeobachters: 37-40. — Das Einbu-Museum: 45-47. — Über quasistellare Strahlungsquellen: 47-52. — Der Mond: 61 f. — Einiges über den Mond und seine Oberfläche: 62-64. — Die Konferenz der ESRO [European Space Research Organization] in Wien, 11.-17. Mai 1966: 79-81. Alle Arbeiten dänisch. Weitere Beobachtungsmitteilungen in Beobachtungszirkularen usw. Mit: 3 ) B. ley; ») N.

') U. G ü n t z e l - L i n g n e r ; s ) R. J o n c k h e e r e ; L i n d b l a d ; )H. W. E l l i s ; ! ) D . S. M i l l e r ; S )C. N. R o w s e ; ') M. S. M a c p h a i l .

v.vi JEFFREYS, Sir Harold. Geophysik, Astron. — 1931-46 Univ. Reader in Geophysics, '46-58 Prof. Astron. and Exper. Philosophy, '58 Emer. Prof., St. John's College, Cambridge; '55-57 Pres., Roy. Astron. Soc. ; '57-60 Pres., Internat. Seismol. Assoc. — '53 Hon. Fellow of the Royal Society, New Zealand; '53 Hon. LL.D. (Univ. of Liverpool); '56 Hon. Sc. D. (Univ. of Dublin); '60 Hon. D. C. L. (Univ. of Durham). — '15 Smith's Prize, '27 Adams Prize (Univ. of Cambridge); '29 Buchan Prize (Roy. Meteorol. Soc.) ; '37 Gold Medal (Roy. Astron. Soc.); '39 Murchison Medal (Geol. Soc. London); '42 Victoria Medal (Roy. Geogr. Soc.); '48 Royal Medal (Roy. Soc. London); '48 Prix Charles Lagrange (Acad. Roy. Belgique); '52 William Bowie Medal (Amer. Geophysical Union); '60 Copley Medal (Roy. Soc. London); '62 Vetlesen Prize (Columbia Univ., New York); '63 Guy Medal in Gold (Roy. Statist. Soc.); '64 Wollaston Medal (Geol. Soc. London). *1891, Apr. 22, Fatfield, Co. Durham. Zur Biogr. R. R o b i n s o n , Proc. roy. Soc., London, Ser. A 196 ('49) VII. - C. H i n s h e l w o o d , ibid. 259 ('60/61) 285. - Gerlands Beitr. Geophysik 61 ('37) 144. - Monthly Notices roy. astron. Soc. 97 ('37) 156, 37584. - Nature [London] 139 ('37) 1004f.; 158 ('46) 866; 162 ('48) 873; 188 ('60) 536, 974. Nordisk astron. Tidsskr. 1947, 90. — Observatory 68 ('48) 240; 80 ('60) 248. - Publ. astron. Soc. Pacific 59 ('47) 48. Zum 70. Geb.tag Festschrift: The earth today (A. H. Cook, T. F. Gaskell) (London '61) 404 S. (m. Bildn.) (Geophysical J . roy. astron. Soc. 4). — Quarterly J . roy. astron. Soc. 2 ('61) 112.

H. (Bearb.) National report of Great Britain. Seismology and physics of the earth's interior (London '63). S. Proc. 5 t h Pacific science congress, Canada 1933 5 (Toronto '34) 2523-26: The seismology of the Pacific. — Physics of the earth 7: Internal constitution of the earth (B. Gutenberg) (New York-London '39), 2 ('51) 8-22: The origin of the solar system. — The earth as a planet (G. P. Kuiper) (Chicago-LondonToronto '54) (Solar system series, 2) 42-56: Dynamics of the earth-moon system. — Vistas in astronomy (A. Beer) 1 (London-New York '55) (J. atmospher. and terrestr. Physics, Spec. Suppl. 3) 189-94: The moon's principal librations in rectangular co-ordinates. — Encyclopaedic dictionary of physics (J. Thewlis) 2 (Oxford-London-New York '62)569-73: Dynamics of earth; 595f.: Stresses in earth; 3 ('62) 567-69 : Hamilton-Jacobi theory ; 655-58 : Heaviside calculus ; 4 ('61) 720f. : Physical data for moon; 5 ('62) 525f.: Internal constitution of outer planets, and their satellites; 658-61: Probability; 6 ('62) 344^-48: Rotating bodies; 7 ('62) 408-10: Contact transformations. — Mantles of the earth and terrestrial planets. Conference organised by the School of Physics at the University of Newcastle-upon-Tyne, England, 1966 (S. K. Runcorn) (London-New York '67) 93-95: Figure and density of the moon. W . Tables of the times of transmission of the P and S waves of earthquakes (London '32) 16 S. - (Bearb.) V. C o r n i s h , Ocean waves and kindred geophysical phenomena (Cambridge-New York'34) 159 S. - Earthquakes and mountains (London '35) 10 + 184 S.; 2 ('50) 10+191 S. - On travel times in seismology (m. I. Lehmann) (Nogent-le-Rotrou '36) 116 S. (Publications du Bureau central séismologique international, Série A. Travaux scientifiques, 14). — Table for the near earthquake pulses (Newport, I. o f W . '37) 7 S. — Scientific inference. Neudruck (Cambridge '37) 6 + 2 7 2 S.; 2 (Cambridge '57) 8 + 236 S. - Theory of probability (Oxford-New York-London '39) 7 + 3 8 0 S.; 2 (Oxford-London-Toronto '48); 3 (Oxford-New York '61) 9 + 4 4 7 S. (The international series of monographs on physics). — Seismological tables (m. K. E. Bullen) (London '40) 48 S.; 2 ('58) 50 S. — Methods of mathematical physics (m. B. S. Jeffreys) (Cambridge '46) 8 + 6 8 0 S.; 2 ('50) ; 3 ('56, '62) 9 + 7 1 6 S. - The earth; its origin, history and physical constitution 3 (Cambridge-London-Toronto '52) 392 S.; 4 ('59) 16+420 S. — Asymptotic approximations (Oxford '62) 144 S. — Cartesian tensors. Neuauflage (Cambridge '62) 92 S. — Operational methods in mathematical phvsics. Neuauflage (New York-London '64)' 6 + 1 1 7 S. (Cambridge tracts in mathematics and mathematical physics, 23).

Jeffreys

2263

Advancement Sci. Mechanical aspects of and distribution of velocity : 550-52. — Travel continental drift and alternative theories: 8 times for Pacific explosions: 7 ('62/63) 212-19. ('51) 79f. — Half a century in geophysics: 10 — Head waves and the nature of the Mohoro('53) 113-19. vicié discontinuity: 412-14.14 — SH from — American J . Sci. Insolation and denudation: a source in the lower layer ): 1593-604. 12 Note on Dr. Blackwelder's paper: 226 ('33) S in three European earthquakes ) ): 8 ('63/ 607. - Thermal state of the earth: 239 ('41) 64) 12-16. — On the hydrostatic theory of the - The times of 825-35. — Types of isostatic adjustment: figure of the earth: 196-202. pP, sS, sP and pS 1 2 ): 324-37. - On the 243A (Daly-Vol.) ('45) 352-59. expression of gravity formulae: 541. — On American Scientist The relations between very long Love waves9): 10 ('65/66) 175-79. astronomy and geophysics: 39 ('51) 407-11. — The use of amplitudes in improving velocity Annals Eugenics Maximum likelihood, in- distributions for Europe 12 ): 515-24. — Reverse probability and the method of mo- vision of travel times: 11 ('66) 5-12. — ments: 8 ('38) 146-51. - Note on the Beh- Estimation of small changes in a function: 12 rens-Fisher formula: 10 ('40) 48-51. — Some ('66/67) 111. — Small changes in seismic applications of the method of minimum x'2: 11 distributions in velocity: 113. — A complete('41) 108-14. ness theorem for expansions of a vector Astronomical J . Nutation and the variation function in spherical harmonics: 465-68. — Inelastic processes in the [earth's] shell: 14 of latitude: 64 ('59) 84-86. Astronomiieskij 2. Nutation and latitude ('67) 1-4. - The damping of S waves: 189f. — Comparison of seismological stations: 15 variation: 86 ('59) 918-20 [russ.]. ('68) 249-51. — Waves and tides near the Australian J. Physics The clock paradox in shore: 16 ('68) 253-57. special relativity: 11 ('58) 583-86. Gerlands Beitr. Geophysik On the figure Biometrika Random and systematic arof the earth: 36 ('32) 206-11. - The figure of rangements: 31 ('39) 1-8. the earth. Remarks on Prof. Hopfner's paper: British J . Philos. Sci. The present position 39 ('33) 374-77. — Vorschlag einer neuen in probability theory: 5 ('55) Nr. 20, 275-89. Nomenklatur für Nahbebendiagramme: 40 Bull, astron. [Paris] Dimensions of the ('33) 96-109. — On the radioactivities of earth and the value of gravity: 15 ('50) 191- rocks: 47 ('36) 149-71. - The Italian earth94. — Constants related to the earth and quake of 1930, July 23: 49 ('37) 393-401 [m. moon: 25 ('65) 67-79. französ. u. deutscher Zusammenfassg.]. — Modem geophysics and Gerlands Beiträge zur Bull. CI. Sci., Acad. roy. Belgique The energy of elastic strain in the earth 13 ): (5) 53 Geophysik: 51 ('37) 1-8. — Aftershocks and periodicity in earthquakes: 53 ('38) 111-39 ('67) 926-33. Bull. g€od£s. The use of Stokes' formula in [m. französ. u. deutscher Zusammenfassg.]. J. London math. Soc. A symmetrical interthe adjustment of surveys: (N. S.) Nr. 30 ('53) 331-38 [m. deutscher, span., franzos. u. ital. polation formula, using second divided differZusammenfassg.]. — Convection and the ences: 11 ('36) 270-72. — The case of equal origin of the continents: Nr. 33 ('54) 220-22. periods in gyroscopic systems: 27 ('52) 362-64. Notes on the variation of latitude: Nr. 59 J . and Proc. roy. Soc. New South Wales The ('61) 43. structure of the earth: 93 ('59/60) 137-39. Mathematical Gaz. Orthogonal matrices in Bull, seismol. Soc. America On P up to 20° in North America: 30 ('40) 225-34. - Note on three dimensions: 49 ('65) 192-94. Fourier analysis: 54 ('64) Teil A, 1441-44. Mémoires, Acad. roy. Belgique, CI. Sci., Colorado School Mines Quarterly The Collect. in-8° Comparison of forms of the structure of the earth: 54 ('59) 313-18. elastic equations for the earth 13 ): 37 ('66) Ergebn. kosm. Physik Deep-focus earth- Nr. 3, 31 S. quakes: 4 ('39) 75-105. Mind The problem of inference: 45 ('36) Geological Mag. Note on Mr. Hill's paper: 324-33. — Bertrand Russell on probability: The granitic and basaltic areas of the earth's 59 ('50) 313-19. surface: 71 ('34) 276-80. Mining Mag. [London] Crustal temperaGeophysical J. roy. astron. Soc. A modifica- tures: 50 ('34) 344-46. tion of Lomnitz's law of creep in rocks: 1 ('58) Monthly Notices roy. astron. Soc. On the 92-95. - The times of P up to 30°, 2: 154-61. origin of the solar system: 92 ('31/32) 887-91. — Bock creep and thermal instability: 162f. — The constitutions of the inner planets : 94 — On the interpretation of Pd: 191-97. — ('33/34) 823 f. — On the figures of the earth The reduction of gravity observations: 2 ('59) and moon: 97 ('36) 3-15; 101 ('41) 34-36. 42-44. — Small corrections in the theory of On statistically steady distributions in astrosurface waves: 6 ('61/62) 115-17. - Some nomy: 98 ('37/38) 59-64. — The correction normal earthquakes: 493-508. — Deep foci of frequencies for a known standard error of

2264

Jeffreys

observation: 190-94. — Note on the state of the outer planets: 214f. — The constant of nutation: 99 ('38/39) 206-10. - The law of error in the Greenwich variation of latitude observations: 703-09. — The variation of latitude: 100 ('39/40) 139-55. - On the lunar equation: 102 ('42) 194r-204. — J . Larmor, 1857-1942: 103 ('43) 67-69. - The relation of cohesion to Roche's limit: 107 ('47) 260-62. — The effects of collisions on Saturn's rings: 263-67. - The origin of the solar system: 108 ('48) 94-103. - The earth's core and the lunar nutation: 206-09. — Dynamic effects of a liquid core: 109 ('49) 670-87; ~ 2: 110 ('50) 460-66. — On the figure of a planet with homogeneous shell and core: 111 ('51) 410-12. — On the masses of Saturn's satellites: 113 ('53) 81-96. — The figures of rotating planets: 97-105. — Second-order terms in the figure of Saturn: 114 ('54) 433-36. - The earth's thermal history: 116 ('56) 231-38. - The damping of the variation of latitude: 362-64. — The theory of nutation and the variation of latitude 13 ): 117 ('57) 142-61; The Roche model core 13 ): 162-73. - H. F. Baker, 18661956: 248-50. — The president's address on the award of the Gold Medal to Professor Albrecht Unsold: 344-46. - R. P. de Kock: Jackson-Gwilt-Medal: 346. — Probability theory in astronomy: 347-55. — The moon's libration in longitude: 475-77. — Imperfections of elasticity in the small bodies of the solar system: 506-15. — The secular accelerations of satellites: 585-89. — Rock creep, tidal friction and the moon's ellipticities: 118 ('58) 14—17. — Nutation: comparison of theory and observations: 119 ('59) 75-80. — Rock creep: a correction 6 ): 121 ('60) 571-77. — On two methods of Brown and Shook: 122 ('61) 335-38. - The effect of tidal friction on eccentricity and inclination: 339-43. — Dissipative interaction between satellites: 34547. — On the figure of the moon: 421-32. — A canonical transformation for treating small coordinates: 127 ('64) I f . — On the structure of the moon: 136 ('67) 311 f. - The variation of latitude: 141 ('68) 255-68. Monthly Notices roy. astron. Soc., Geophysical Suppl. On the variation of melting point within the earth: 3 ('32/36) 6-9. — A smoothing device applied to the new seismologioal tables 5 ): 10-13. — On the stresses in the earth's crust required to support surface inequalities [, 1]: 30-41; ~ 2: 60-69. — The deformation of the earth due to asymmetrical cooling: 53-59. — A rediscussion of some near earthquakes: 131-56. — Upward curvature in seismic time-curves: 201 f. — The surface waves of earthquakes: 253-61. — On the ellipticity correction in seismology: 271-74. — Some deep-focus earthquakes: 310-43. — The structure of the earth down to the 20° discontinuity [, 1]: 401-22; ~ 2: 4 ('37/40)

13-39. — A comparison of seismological stations: 3 ('32/36) 423-43. - On the figures of the earth and moon: 4 ('37/40) 1-13; 5 ('40/49) 219-47. — On the materials and density of the earth's crust: 4 ('37/40) 50-61. — The density distributions in the inner planets: 62-71. — Note on Mr. Hales's paper [Convection currents in geysers]: 131 f. — The ellipticity correction to the P table: 165-84. — Further study of near earthquakes: 196225. — Further corrections to the P, S and SKS tables: 225-50. — Southern earthquakes and the core waves: 281-308. — The disturbance of the temperature gradient in the earth's crust by inequalities in height: 309-12. — The determination of gravity anomalies from deflexions of the vertical: 313f. — Some Japanese deep-focus earthquakes: 424-60. — The times of P, S and SKS, and the velocities of P and S: 498-533. - The times of P c P and ScS: 537-47. — The times of the core waves [, 1]: 548-61; ~ 2: 594-615. - Times of transmission for small distances and focal depths: 571-78. — The determination of the earth's gravitational field [, 1]: 6 ('40/49) 1-22; ~ 2: 55-66. — On the radioactivities of rocks, 2: 37-40. — On the Burton-on-Trent explosion of 1944, November 27: 100-04. — Seismic waves in western and central Europe: 105-19. — On the absolute measurement of gravity: 398—408. — Problems of thermal instability in a sphere: 6 ('50/54) 272-77. — The free-air reduction of gravity to the second order: 316-18. - The times of P up to 30°: 348-64. — The times of P in Japanese and European earthquakes: 557-65. — Elastic waves in a continuously stratified medium: 7 ('54/57) 332-37. Nature [London] Corrections to the times of the P wave in earthquakes 3 ): 131 ('33) 97. — Quantity of meteoric accretion: 132 ('33) 934. — State of the earth's central core: 134 ('34) 324. - The philosophy of Sir James Jeans: 499. — Constitution of the earth: 135 ('35) 678-80. — Philosophy and modern science: 911. — Reliability of seismograph stations: 138 ('36) 464. — Figures of the earth and moon: 139 ('37) 471. - Reliability of Pacific seismological stations: 140 ('37) 237f. — Science, logic and philosophy: 141 ('38) 672-76, 716-19, 977. - The law of error: 142 ('38) 534. — Frequency interpretations in probability: 143 ('39) 242. - Aspects of mathematical logic: 148 ('41) 396f. - Origin of the solar system: 163 ('44) 140f. - Lead isotopes and the age of the earth: 162 ('48) 822f.; 164 ('49) 1046f. - The figure of the earth: 162 ('48) 915-17. - Origin of the earth: 169 ('52) 260f. — A suggested reconstruction of the land masses of the earth as a complete crust: 195 ('62) 448. — Nearly diurnal nutation of the earth 13 ): 204 ('64) 120f. - Damping of S waves: 208 ('65) 675. - Radius of t h e

Jeffreys earth's core: 215 ('67) 1365f. — Imperfections of elasticity and continental drift: 225 ('70) 1007 f. — Some needs of geophysics: 1008. Observatory The dynamic of Saturn's rings: 58 ('35) 17f. — Terrestrial heights. Discussion 8 2 10 ) ) ): 60 ('37) 131-39. - The P, S notation in seismology: 219f. — Southern earthquakes and the core waves: 61 ('38) 73. — Another misleading case: 62 ('39) 239f. - The origin of the solar system: 63 ('40) 158f. - The figure of the earth 8 ): 69 ('49) 21-24. - Geology of the moon: 70 ('50) 39f. — The variation of latitude and the 19-yearly nutation: 71 ('51) 154. — E a r t h tides: 72 ('52) 17f. (Diskussionsbeitr.). — The masses of Saturn's satellites: 73 ('53) 19 f. — The figures of rotating planets: 89-91. — Rotating fluid masses: 161-63. — The theory of nutation and the variation of latitude 1 3 ): 76 ('56) 213-15. - Probability theory in astronomy: 77 ('57) 48-52. — Nutation: 79 ('59) 222.

2265

tial equations: 49 ('53) 601-11. - On the use of asymptotic approximations of Green's type when the coefficient has zeros: 52 ('56) 61-66. — An extension of the Pitman-Koopman theorem: 56 ('60) 393-95. Proc. physic. Soc. Time and amplitude relations in seismology: 47 ('35) 455-58. Proc. roy. Soc. Edinburgh Note on fracture: 56 ('35/36) 158-63. Proc. roy. Soc., London, Ser. A An alternative to the rejection of observations: 137 ('32) 78-87. — On the theory of errors and least squares: 138 ('32/33) 48-55. — On plasticity and creep in solids: 283-97. — Probability, statistics, and the theory of errors: 140 ('33) 523-35. - Probability and scientific method: 146 ('34) 9-16. - The oscillations of the atmosphere: 157 ('36) 53537. — On the relation between direct and inverse methods in statistics: 160 ('37) 32548. — The tests for sampling differences and contingency: 162 ('37) 479-95. - Significance tests for continuous departures from suggested distributions of chance: 164 ('38) 307-15. — Significance tests when several degrees of freedom arise simultaneously: 165 ('38) 16198. — The comparison of series of measures on different hypotheses concerning the standard errors: 167 ('38) 367-84. — The posterior probability distributions of the ordinary and intraclass correlation coefficients: 464—83. — On the significance tests for the introduction of new functions to represent measures: 180 ('42) 256-68. — A derivation of the tidal equations: 181 ('42) 20-22. — An invariant form for the prior probability in estimation problems: 186 ('46) 453-61. - The origin of the solar system: 214 ('52) 281-91. — The reflection of a pulse within a sphere 11 ): 241 ('57) 455-79. — The remainder in Watson's lemma: 248 ('58) 88-92. - Faults in a material t h a t hardens when it yields: 252 ('59) 431-35.

Philosophical Mag. and J. Sci. On the relation between fusion and strength: (7) 19 ('35) 840-46. — Asymptotic solutions of linear differential equations: 21 ('35) 544r-46. — On some criticisms of the theory of probability: 22 ('36) 337-59. — Epistemology and modem physics: 32 ('41) 177-206. — A derivation of the equations of equilibrium of a thin plate: 365-68. — Asymptotic solutions of linear differential equations: 33 ('42) 451-56. — Probability and quantum theory: 815-31. — On units and dimensions: 34 ('43) 837-42. Philosophical Trans, roy. Soc. London, Ser. A The law of error and the combination of observations: 237 ('38) 231-71. — Discussion [of physics of convection currents in the earth's mantle], in: A symposium on continental drift: 258 ('65) 314. Philosophy Sci. The nature of mathematics: 5 ('38) 434-51. Proc. aristotelian Soc. Scientific method, — Dynamics of the moon: 296 ('67) 245-47. causality and reality: 37 ('36/37) 61-70. Quarterly J. Mech. and appl. Math. The Proc. Cambridge philos. Soc. On the prior surface elevation in cellular convection: 4 ('51) probability in the theory of sampling: 29 ('33) 283-88. — On the highest gravity waves on 83-87. — On Gauss's proof of the normal law deep water: 385-87. — What is Hamilton's of errors: 231-34. — On smoothing and principle ?: 7 ('54) 335-37. — Two properties differentiation of tables: 30 ('34) 134-38. - of spherical harmonics: 8 ('55) 448-51. — Some tests of significance, treated by the The thermodynamics of thermal instability in theory of probability: 31 ('35) 203-22. - liquids: 9 ('56) 1-5. — A modification of Further significance tests: 32 ('36) 416-45. - Lagrange's equations for small oscillations The comparison of series of measures: 33 ('37) when some natural frequencies are high: 247f. 35—40. — On the smoothing of observed d a t a : — The simple pendulum under periodic 444-50. — The use of minimum x 2 a s a n disturbance: 12 ('59) 124-28. approximation to the method of maximum Quarterly J. roy. astron. Soc. B. Gutenberg, likelihood: 34 ('38) 156f. - The minimum X'2 approximation: 35 ('39) 520. — On the 1889-1960: 1 ('60) 239-42. - How soft is the 7 Heaviside operational calculus ): 36 ('40) e a r t h ? : 5 ('64) 10-22. 267-82. — Initial stress and elastic instability: Quarterly J. roy. meteorol. Soc. Cyclonic 38 ('42) 125-28. — On pulses whose travel motions: 64 ('38) 336-38. times are not true minima: 39 ('43) 48-51. — Rep. (annu.) Meeting, Brit. Assoc. AdvanceOn approximate solutions of linear differen- ment Sci. Transmission times: 105 ('35) 228.

2266

Jeffreys — Jeffries

Zur Biogr. Chemical Department News, — Work on transmission times and on periodicity: 108 ('38) 268f. - Deep foci and after- General Electric Company, Pittsfield, Masa. 1949, Nr. 47, 9. Dez., If. shocks: 391. Nekr. Berkshire Eagle 1965, 21. Mai (m. Smithsonian Contribut. Astrophysics The analysis of gravity: 6 ('63) 205-12. Bildn.). Autobiogr. Metallurgical Soc. Conf. 27 ('63) Trans, amer, geophysic. Union On the Burton-on-Trent explosion of 1944, November 109-19. Zur Bibliogr. A. D e a n , Zay Jeffries' con27: 29 ('48) 278f. Z. Geophysik Remarks on the paper of tributions to aluminum metallurgy: Metals G. Schmerwitz on central European earth- Rev. 89 ('66) 19-23, 41. quakes: 15 ('39) 168-75. S. Modern uses of nonferrous metals (C. H. Mathewson) (New York '35) 1-15: The new Mit: ») E. P. A r n o l d ; ») D. B r u n t ; ") K. E. B u l l e n ; «) — ; s ) L. T. Comrie; ') S. Crampin; ') D. P. industrial development and exploitation of D a l z e l l ; ") J. de G. H u n t e r ; ') J . A . H u d s o n ; metals and alloys. — Seventy-five years of ») H. L. P. J o l l y ; ») E. R. L a p w o o d ; ») M. progress in the mineral industry, 1871-1946 S h i m s h o n i ; ") R. O. V i c e n t e ; ") C. Sells. (American Institute of Mining and Metallurgical Engineers) (New York '48) 745-58: VI JEFFRIES, Zay. Metallurgie. - Metals and alloys of the future. 1911-16 Instructor, '16-17 Assist. Prof., Battelle techn. Bev. A prophetic letter (of '50-56 Prof., Chairman of the Committee July 1944 foretold most of the developments of Education Policy, Case Inst, of Tech- within the next decade): 3 ('54) 89-92. Biographical Mem., Nation. Acad. Sei. USA nol., Cleveland, 0.; '20-36 Consulting Dyer Merica, 1889-1957: 33 ('59) 226Metallurg. Engr., Aluminum Co. of Amer- Paul 40. - Charles Franklin Kettering, 1876-1958: ica; '25-36 Consultant, Incandescent 34 ('60) 106-22. - Herbert Clark Hoover f : Lamp Departm., '36-45 Techn. Dir., 39 ('67) 267-91. Lamp Departm., '45-50 Vice-Pres. in Iron Age Nonferrous metals - past and Charge of the Chemical Departm., General future: 134 ('34) Nr. 19, 20-23. - Aluminum. a chemical element to an industrial Electr. Co., Nela Park, Cleveland, O., From metal. A historical survey: 137 ('36) Nr. 8, later on Pittsfield, Mass. ; '29 Pres., Amer. 22-28. Soc. Metals; '32-36 Pres., Carboloy Co., J. appl. Physics [USA] Physics in the metal Inc. ; Former Dir. of Pittsfield National industry 1 ): 8 ('37) 48-54. — Alloys for tools Bank and of Berkshire Life Insurance Co. and wear-resistance: 380-84. Metal Industry [London] Introduction to — '30 Hon. Dr. Eng. (Harvard Univ., precipitation hardening: 56 ('40) 3-5. — Cambridge, Mass.); '37Hon. D. Sc. (Case Kupfer. Sparmaßnahmen und Ersatz: 60 Inst, of Technol., Cleveland, O.); '50 ('42) 9-11 [engl.]. Hon. D. Sc. (Clarkson College of Technol., Metal Market Bev. [Calcutta] The role of Potsdam, N. Y.); Hon. D. Sc. (South Da- metals in U.S. economy: 5 ('52) Nr. 38,11-14; kota State School of Mines, Rapid City, Nr. 39, 15f. Metal Progr. Nonferrous metals of to-day S. Dak.). — '27 James Douglas Medal and to-morrow: 27 ('35) Nr. 1, 17-21. (Amer. Inst, of Mining and Metallurg. Cemented carbide: 34 ('38) 314f. - Supply of Engrs.) ; '35 Albert Sauveur Achievement metals for national defense: 40 ('41) 747-51. Medal, '43 Gold Medal, '48 Distinguished — General survey of the American metallurgy: Service Award (Amer. Soc. Metals); '45 68 ('55) 74-76. Metals and Alloys Hard carbides: 10 ('39) Francis J. Clamer Medal (Franklin Inst., Philadelphia, Pa.); '45 Powder Metallur- Nr. 10, A58, A60. Metals Technol. Light-weight metals in the gy Medal (Stevens Inst. Technol., Hoboken, N.J.); '46 John Fritz Medal transportation industry: 3 ('36) Nr. 7, 21-39. Mining and Metallurgy Rare metals 3 ): 15 (Amer. Soc. Civil Engrs., Amer. Soc. Me- ('34) 59-62. — Rare metals and minerals: 21 chan. Engrs., Amer. Inst. Electr. Engrs., ('40) 10-12; 22 ('41) 82-85. - Rare and preAmer. Inst. Mining andMetallurg. Engrs.) ; cious metals: 23 ('42) 69f. '48 Medal for Merit (U. S. Government). Nucleonics Words of prophecy - atomic energy: 12 ('54) 8-11. *1888, Apr. 22, Willow Lake, S.Dak.; Proc. amer. philos. Soc. Some industrial tl965, Mai 21, Pittsfield, Mass. vitamins: 102 ('58) 396-99. - Gold: 108 ('64) Bildnis Scientific Monthly 48 ('39) 571. 437-42.

Jeffries — de Jekhowsky Proc. amer. Soc. civil Engr. Light-weight structural alloys 2 ) 4 ): 62 ('36) 1211-37; 63 ('37) 1267-93. Scientific Monthly Metallurgy and the war: 60 ('45) 67-70. - The efficient utilization of metáis: 65 ('47) 325-28. Yearb., Amer, philos. Soc. John Johnston, 1881-1950: 1950, 309-12. Mit: ») E. Q. A d a m s ; *) C. F. N a g e l ; 3 ) P. M. T y l e r ; •) R. T. W o o d . VI de JEKHOWSKY, Benjamin. Astron. — 1933-45 Astronome-Adjoint, Observât., Univ. de Toulouse; en retraite résidant à Encausse-les-Thermes, Haute Garonne. — '65 Prix Houillevigue (Acad. Sci. Paris). *1881, Juli 21 (9), Georgievskoe, Kr. Borovici, Geb. Novgorod, Rußland.

Annales Observât, astron., magnét. et météorol. Toulouse Tables pour le calcul de l'orientation du grand cercle de recherche des astéroïdes: 11 ('35) 89-168. — Recherches sur le nombre des astéroïdes: 12 ('36) 247-68. — Détermination des orbites des essaims d'étoiles filantes et leur relation avec les orbites des comètes, exposé succinct d'une méthode nouvelle suivie d'un exemple numérique. Application à l'essaim des étoiles filantes du 9 octobre 1933: 14 ('38) 51-95. Astronomische Nachr. Sur la détermination du grand cercle de recherche des astéroïdes: 246 ('32) 15. — Identification de la planète 1925 VF avec la planète 1933 UT: 251 ('34) 399 f. — Sur quelques relations nouvelles entre les constantes de Gauß: 252 ('34) 241-46. Bull, astron. [Paris] Détermination de la longitude de l'observatoire de Toulouse 1 ) : (2) 9 ('36) 307-10. — Sur les méthodes de première approximation dans la détermination des orbites cométaires: 13 ('48) 329-39. — Sur les différentes formes de systèmes d'équations auxquelles on peut réduire le système principal d'équations des méthodes d'Olbers et de Gauß pour la détermination des orbites paraboliques: 15 ('50) 151-58. — Réflexions sur la détermination du paramètre dans le problème d'Euler: 317-30. — Sur la détermination de l'attraction du zénith: (3) 1 ('66) 5-7. C.R. hebd. Séances Acad. Sci., Paris Sur l'angle S qui détermine l'orientation j du grand cercle de recherche des astéroïdes: 194 ('32) 530-32. - Sur le nombre probable d'astéroïdes que l'on peut découvrir avec les moyens actuels d'observation: 197 ('33) 57982. — Sur le nombre d'astéroïdes et leur masse effective: 200 ('35) 2061-63. - Sur un critérium pour l'identification des petites planètes: 206 ('38) 1361-64. - Sur la répartition des périhélies et des nœuds des petites planè-

2267

tes et sur les causes des variations dans le nombre mensuel de leurs découvertes: 209 ('39) 505-07. — Formules de contrôle et moyen d'augmenter la précision du calcul des déterminants de la méthode Lagrange-Andoyer pour la détermination d'une orbite képlérienne : 215 ('42) 220-22. - Sur la suppression des approximations successives dans la méthode de Lagrange-Andoyer de détermination des orbites paraboliques: 219 ('44) 605-07. - Sur la masse de Pluton: 222 ('46) 171-73. — Sur la comparaison des méthodes d'Olbers et Lagrange-Andoyer pour le calcul des orbites paraboliques et leur liaison avec d'autres méthodes: 783-85. — Simplification du système principal d'équations des méthodes d'Olbers et de Gauss pour la détermination des orbites paraboliques: 225 ('47) 489-91. — Réduction à sa plus simple expression du système principal d'équations des méthodes d'Olbers et de Gauss pour la détermination des orbites paraboliques: 226 ('48) 161 f., 1112. - Sur la détermination du paramètre dans le problème d'Euler: 228 ('49) 1925-27; 229 ('49) 795. - Démonstration simple et directe du théorème d'Euler relatif aux orbites paraboliques: 230 ('50) 1738-40. — Sur la résolution dè l'équation d'Euler relative aux orbites paraboliques: 231 ('50) 510f. — Détermination des orbites paraboliques à partir de plusieurs observations: 233 ('51) 779-81.— Sur la détermination des distances géocentrique Q et héliocentrique r d'astéroïdes dans la méthode de Laplace: 234 ('52) 1436-38. - Nouvelle méthode pour la détermination des orbites paraboliques: 237 ('53) 970-72. J. Observateurs Sur le réglage du moteur d'entraînement du fil d'ascension droite: 17 ('34) 170-72. - Sur la détermination de la date d'opposition d'une petite planète: 17393. — Sur la résolution de l'équation de Képler: 22 ('39) 197 f. — Répartition des périhélies